F473399
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 661 | 322 | 633 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10363459|Ga0105248_103634592 |
| Length | 302 |
| Sequence | MWQCDPFAVSRGVSDLEQFRCQFFVPMAYHRATRGTHMTAKSATTIEATHPVSRGEKLFLVLSGFFIANAIIAEFIGVKIFALEDTLGIAPLNWNLFGQTGSLNFTAGVLLWPVVFIMTDVINEYFGRKGVRMISWLAVALIVYAYLFAYITIHLAPASWWVGAGKNQGVDNLQTAFAAIFGQGLWTIGGSITAFILGQLIDVSIFHAIRNRTGERHIWLRATGSTLVSQFIDSFVVLYIAFVIGPQHWSIPLFLAVGSVNYIYKFIAAIVLTPLIYAARRGLDTYLGREQSEALKARAAEQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 3 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 4 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 5 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 6 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 7 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 8 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 9 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 10 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 11 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 12 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 13 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 14 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 15 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 16 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 17 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 18 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 19 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 20 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 21 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 22 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 23 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 24 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 25 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 26 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 27 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 28 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 29 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 30 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 31 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 32 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 33 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 35 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 36 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 37 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 38 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 97 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 120 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 197 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 198 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 203 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 221 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 222 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 223 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 224 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 227 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 228 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 229 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 230 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 231 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 232 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 233 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 234 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 235 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 236 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 262 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 263 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 264 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 265 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 266 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 267 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 292 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 297 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 307 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 308 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 309 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 310 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 311 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 312 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 313 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 314 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 315 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 316 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 317 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 318 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 319 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 320 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.46 |
| Metatranscriptomes | 0.3 |
| Isolates | 4.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.9 |
| Nodule | 0 |
| Rhizoplane | 2.27 |
| Rhizosphere | 86.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_493616 | 2162886007 | Bacteria | 15810 |
| 2 | JGI25152J39213_1000018 | 3300002773 | Bacteria | 109715 |
| 3 | JGI25152J39213_1000056 | 3300002773 | Bacteria | 75516 |
| 4 | JGI25150J39212_1000009 | 3300002774 | Bacteria | 249509 |
| 5 | JGI25150J39212_1000159 | 3300002774 | Bacteria | 38345 |
| 6 | JGI25151J46595_10000017 | 3300003187 | Bacteria | 249509 |
| 7 | JGI25151J46595_10000111 | 3300003187 | Bacteria | 111802 |
| 8 | JGI25406J46586_10010500 | 3300003203 | Bacteria | 4107 |
| 9 | JGI25153J46596_10000023 | 3300003215 | Bacteria | 249509 |
| 10 | JGI25153J46596_10000085 | 3300003215 | Bacteria | 111802 |
| 11 | rootH1_10007102 | 3300003316 | Bacteria | 23916 |
| 12 | rootL2_10078753 | 3300003322 | Bacteria | 6474 |
| 13 | rootL2_10104587 | 3300003322 | Bacteria | 9038 |
| 14 | rootL2_10115706 | 3300003322 | Bacteria | 22521 |
| 15 | rootH1_10005821 | 3300003323 | Bacteria | 129122 |
| 16 | rootH1_10197067 | 3300003323 | Bacteria | 3767 |
| 17 | Ga0055536_1000030 | 3300003781 | Bacteria | 153926 |
| 18 | Ga0055530_10002863 | 3300003791 | Bacteria | 10516 |
| 19 | Ga0065714_10002192 | 3300005288 | Bacteria | 92967 |
| 20 | Ga0065714_10003657 | 3300005288 | Bacteria | 30790 |
| 21 | Ga0065714_10008213 | 3300005288 | Bacteria | 6299 |
| 22 | Ga0065714_10064664 | 3300005288 | Bacteria | 25064 |
| 23 | Ga0065714_10064897 | 3300005288 | Bacteria | 15960 |
| 24 | Ga0065714_10072134 | 3300005288 | Bacteria | 3425 |
| 25 | Ga0065704_10000193 | 3300005289 | Bacteria | 203271 |
| 26 | Ga0065704_10088158 | 3300005289 | Bacteria | 2962 |
| 27 | Ga0065712_10069113 | 3300005290 | Bacteria | 7999 |
| 28 | Ga0070690_100037213 | 3300005330 | Bacteria | 3066 |
| 29 | Ga0070670_100027911 | 3300005331 | Bacteria | 4857 |
| 30 | Ga0070670_100048722 | 3300005331 | Bacteria | 3645 |
| 31 | Ga0070670_100116787 | 3300005331 | Bacteria | 2301 |
| 32 | Ga0070670_100130960 | 3300005331 | Bacteria | 2166 |
| 33 | Ga0070670_100179312 | 3300005331 | Bacteria | 1839 |
| 34 | Ga0070677_10003138 | 3300005333 | Bacteria | 5311 |
| 35 | Ga0068869_100086812 | 3300005334 | Bacteria | 2346 |
| 36 | Ga0070682_100009288 | 3300005337 | Bacteria | 5565 |
| 37 | Ga0070682_100042905 | 3300005337 | Bacteria | 2795 |
| 38 | Ga0070682_100406652 | 3300005337 | Bacteria | 1031 |
| 39 | Ga0068868_100181368 | 3300005338 | Bacteria | 1747 |
| 40 | Ga0068868_100289660 | 3300005338 | Bacteria | 1388 |
| 41 | Ga0070689_100046123 | 3300005340 | Bacteria | 3357 |
| 42 | Ga0070689_100056744 | 3300005340 | Bacteria | 3037 |
| 43 | Ga0070687_100009254 | 3300005343 | Bacteria | 4213 |
| 44 | Ga0070661_100010630 | 3300005344 | Bacteria | 6405 |
| 45 | Ga0070661_100160429 | 3300005344 | Bacteria | 1703 |
| 46 | Ga0070692_10050412 | 3300005345 | Bacteria | 2162 |
| 47 | Ga0070668_100021125 | 3300005347 | Bacteria | 4921 |
| 48 | Ga0070668_100433186 | 3300005347 | Bacteria | 1127 |
| 49 | Ga0070669_100022350 | 3300005353 | Bacteria | 4521 |
| 50 | Ga0070669_100081104 | 3300005353 | Bacteria | 2416 |
| 51 | Ga0070675_100009725 | 3300005354 | Bacteria | 7491 |
| 52 | Ga0070675_100027806 | 3300005354 | Bacteria | 4547 |
| 53 | Ga0070675_100064599 | 3300005354 | Bacteria | 3026 |
| 54 | Ga0070671_100107212 | 3300005355 | Bacteria | 2346 |
| 55 | Ga0070671_100353988 | 3300005355 | Bacteria | 1253 |
| 56 | Ga0070671_100421029 | 3300005355 | Bacteria | 1144 |
| 57 | Ga0070674_100023152 | 3300005356 | Bacteria | 4015 |
| 58 | Ga0070674_100079456 | 3300005356 | Bacteria | 2340 |
| 59 | Ga0070674_100185658 | 3300005356 | Bacteria | 1596 |
| 60 | Ga0070673_100037601 | 3300005364 | Bacteria | 3689 |
| 61 | Ga0070673_100042111 | 3300005364 | Bacteria | 3518 |
| 62 | Ga0070673_100109531 | 3300005364 | Bacteria | 2288 |
| 63 | Ga0070673_100803477 | 3300005364 | Bacteria | 869 |
| 64 | Ga0070688_100248477 | 3300005365 | Bacteria | 1265 |
| 65 | Ga0070667_100002844 | 3300005367 | Bacteria | 14938 |
| 66 | Ga0070667_100021422 | 3300005367 | Bacteria | 5367 |
| 67 | Ga0070667_100106926 | 3300005367 | Bacteria | 2422 |
| 68 | Ga0070667_100682330 | 3300005367 | Bacteria | 950 |
| 69 | Ga0070710_10024018 | 3300005437 | Bacteria | 3211 |
| 70 | Ga0070701_10014880 | 3300005438 | Bacteria | 3577 |
| 71 | Ga0070711_100031580 | 3300005439 | Bacteria | 3517 |
| 72 | Ga0070705_100092474 | 3300005440 | Bacteria | 1888 |
| 73 | Ga0070700_100024517 | 3300005441 | Bacteria | 3543 |
| 74 | Ga0070700_100127352 | 3300005441 | Bacteria | 1714 |
| 75 | Ga0070700_100602779 | 3300005441 | Bacteria | 861 |
| 76 | Ga0070694_100078342 | 3300005444 | Bacteria | 2292 |
| 77 | Ga0070663_100082003 | 3300005455 | Bacteria | 2372 |
| 78 | Ga0070678_100011129 | 3300005456 | Bacteria | 5535 |
| 79 | Ga0070678_100031756 | 3300005456 | Bacteria | 3648 |
| 80 | Ga0070662_100003547 | 3300005457 | Bacteria | 9730 |
| 81 | Ga0070662_100341085 | 3300005457 | Bacteria | 1226 |
| 82 | Ga0068867_100323726 | 3300005459 | Bacteria | 1278 |
| 83 | Ga0070685_10046505 | 3300005466 | Bacteria | 2491 |
| 84 | Ga0070685_10061020 | 3300005466 | Bacteria | 2207 |
| 85 | Ga0070685_10212982 | 3300005466 | Bacteria | 1262 |
| 86 | Ga0068853_100136187 | 3300005539 | Bacteria | 2202 |
| 87 | Ga0068853_100312672 | 3300005539 | Bacteria | 1455 |
| 88 | Ga0068853_100687862 | 3300005539 | Bacteria | 975 |
| 89 | Ga0070672_100039511 | 3300005543 | Bacteria | 3615 |
| 90 | Ga0070672_100052136 | 3300005543 | Bacteria | 3193 |
| 91 | Ga0070672_100053985 | 3300005543 | Bacteria | 3144 |
| 92 | Ga0070672_100070859 | 3300005543 | Bacteria | 2771 |
| 93 | Ga0070672_100472587 | 3300005543 | Bacteria | 1082 |
| 94 | Ga0070686_100024869 | 3300005544 | Bacteria | 3594 |
| 95 | Ga0070686_100152854 | 3300005544 | Bacteria | 1618 |
| 96 | Ga0070695_100221314 | 3300005545 | Unclassified | 1364 |
| 97 | Ga0070696_100060692 | 3300005546 | Bacteria | 2644 |
| 98 | Ga0070665_100000077 | 3300005548 | Bacteria | 188308 |
| 99 | Ga0070665_100002747 | 3300005548 | Bacteria | 19072 |
| 100 | Ga0070665_100004552 | 3300005548 | Bacteria | 14531 |
| 101 | Ga0070665_100045417 | 3300005548 | Bacteria | 4412 |
| 102 | Ga0070665_100187310 | 3300005548 | Bacteria | 2070 |
| 103 | Ga0070665_100461321 | 3300005548 | Bacteria | 1280 |
| 104 | Ga0070704_100113391 | 3300005549 | Bacteria | 2067 |
| 105 | Ga0070704_100593070 | 3300005549 | Bacteria | 973 |
| 106 | Ga0068855_100591419 | 3300005563 | Bacteria | 1198 |
| 107 | Ga0070664_100003153 | 3300005564 | Bacteria | 13328 |
| 108 | Ga0070664_100419186 | 3300005564 | Bacteria | 1226 |
| 109 | Ga0068854_100470373 | 3300005578 | Bacteria | 1053 |
| 110 | Ga0068856_100031658 | 3300005614 | Bacteria | 5176 |
| 111 | Ga0070702_100006739 | 3300005615 | Bacteria | 5459 |
| 112 | Ga0070702_100024173 | 3300005615 | Bacteria | 3237 |
| 113 | Ga0068852_100241101 | 3300005616 | Bacteria | 1728 |
| 114 | Ga0068859_100001149 | 3300005617 | Bacteria | 26992 |
| 115 | Ga0068859_100014785 | 3300005617 | Bacteria | 7841 |
| 116 | Ga0068859_100175963 | 3300005617 | Bacteria | 2221 |
| 117 | Ga0068859_100346682 | 3300005617 | Bacteria | 1580 |
| 118 | Ga0068864_100002318 | 3300005618 | Bacteria | 15746 |
| 119 | Ga0068864_100020929 | 3300005618 | Bacteria | 5475 |
| 120 | Ga0068864_100056667 | 3300005618 | Bacteria | 3386 |
| 121 | Ga0068864_100099546 | 3300005618 | Bacteria | 2576 |
| 122 | Ga0068866_10053652 | 3300005718 | Bacteria | 2062 |
| 123 | Ga0068861_100000256 | 3300005719 | Bacteria | 29591 |
| 124 | Ga0068861_100009322 | 3300005719 | Bacteria | 6775 |
| 125 | Ga0068861_100026187 | 3300005719 | Bacteria | 4238 |
| 126 | Ga0068861_100026857 | 3300005719 | Bacteria | 4189 |
| 127 | Ga0068861_100057256 | 3300005719 | Bacteria | 2976 |
| 128 | Ga0068861_100077237 | 3300005719 | Bacteria | 2597 |
| 129 | Ga0068861_100095243 | 3300005719 | Bacteria | 2357 |
| 130 | Ga0068851_10000471 | 3300005834 | Bacteria | 17764 |
| 131 | Ga0068870_10006049 | 3300005840 | Bacteria | 5316 |
| 132 | Ga0068870_10026226 | 3300005840 | Bacteria | 2904 |
| 133 | Ga0068863_100000669 | 3300005841 | Bacteria | 34544 |
| 134 | Ga0068863_100017715 | 3300005841 | Bacteria | 6819 |
| 135 | Ga0068863_100042992 | 3300005841 | Bacteria | 4291 |
| 136 | Ga0068863_100480339 | 3300005841 | Bacteria | 1222 |
| 137 | Ga0068860_100040742 | 3300005843 | Bacteria | 4438 |
| 138 | Ga0068860_100071566 | 3300005843 | Bacteria | 3295 |
| 139 | Ga0068860_100451323 | 3300005843 | Bacteria | 1278 |
| 140 | Ga0068862_100000453 | 3300005844 | Bacteria | 44400 |
| 141 | Ga0068862_100000878 | 3300005844 | Bacteria | 29297 |
| 142 | Ga0068862_100009137 | 3300005844 | Bacteria | 8205 |
| 143 | Ga0068862_100012930 | 3300005844 | Bacteria | 6906 |
| 144 | Ga0068862_100018285 | 3300005844 | Bacteria | 5837 |
| 145 | Ga0068862_100412627 | 3300005844 | Bacteria | 1265 |
| 146 | Ga0081455_10000043 | 3300005937 | Bacteria | 132283 |
| 147 | Ga0081540_1005554 | 3300005983 | Bacteria | 9389 |
| 148 | Ga0081539_10000046 | 3300005985 | Bacteria | 275677 |
| 149 | Ga0075364_10187919 | 3300006051 | Bacteria | 1399 |
| 150 | Ga0097621_100020849 | 3300006237 | Bacteria | 5057 |
| 151 | Ga0097621_100022710 | 3300006237 | Bacteria | 4873 |
| 152 | Ga0097621_100085538 | 3300006237 | Bacteria | 2630 |
| 153 | Ga0068871_100031521 | 3300006358 | Bacteria | 4182 |
| 154 | Ga0068871_100075919 | 3300006358 | Bacteria | 2775 |
| 155 | Ga0075428_100001451 | 3300006844 | Bacteria | 25355 |
| 156 | Ga0075428_100015420 | 3300006844 | Bacteria | 8471 |
| 157 | Ga0075428_100019438 | 3300006844 | Bacteria | 7518 |
| 158 | Ga0075428_100021514 | 3300006844 | Bacteria | 7139 |
| 159 | Ga0075428_100038382 | 3300006844 | Bacteria | 5270 |
| 160 | Ga0075428_100090636 | 3300006844 | Bacteria | 3335 |
| 161 | Ga0075430_100022366 | 3300006846 | Bacteria | 5379 |
| 162 | Ga0075430_100073376 | 3300006846 | Bacteria | 2870 |
| 163 | Ga0075430_100085988 | 3300006846 | Bacteria | 2632 |
| 164 | Ga0075431_100012402 | 3300006847 | Bacteria | 8602 |
| 165 | Ga0075431_100017639 | 3300006847 | Bacteria | 7257 |
| 166 | Ga0075431_100487574 | 3300006847 | Bacteria | 1225 |
| 167 | Ga0075433_10000056 | 3300006852 | Bacteria | 48702 |
| 168 | Ga0075433_10422960 | 3300006852 | Bacteria | 1175 |
| 169 | Ga0075434_100021092 | 3300006871 | Bacteria | 6331 |
| 170 | Ga0075429_100010555 | 3300006880 | Bacteria | 7988 |
| 171 | Ga0075429_100115776 | 3300006880 | Bacteria | 2343 |
| 172 | Ga0075429_100283927 | 3300006880 | Bacteria | 1450 |
| 173 | Ga0068865_100051849 | 3300006881 | Bacteria | 2841 |
| 174 | Ga0068865_100090407 | 3300006881 | Bacteria | 2220 |
| 175 | Ga0068865_100262464 | 3300006881 | Bacteria | 1368 |
| 176 | Ga0068865_100268803 | 3300006881 | Bacteria | 1353 |
| 177 | Ga0097620_100001149 | 3300006931 | Bacteria | 26992 |
| 178 | Ga0097620_100014785 | 3300006931 | Bacteria | 7841 |
| 179 | Ga0097620_100175962 | 3300006931 | Bacteria | 2221 |
| 180 | Ga0097620_100346657 | 3300006931 | Bacteria | 1580 |
| 181 | Ga0075435_100146385 | 3300007076 | Bacteria | 1984 |
| 182 | Ga0105244_10051457 | 3300009036 | Bacteria | 2099 |
| 183 | Ga0105250_10146565 | 3300009092 | Bacteria | 980 |
| 184 | Ga0111539_10001328 | 3300009094 | Bacteria | 32966 |
| 185 | Ga0111539_10004344 | 3300009094 | Bacteria | 18562 |
| 186 | Ga0111539_10005730 | 3300009094 | Bacteria | 16066 |
| 187 | Ga0111539_10007197 | 3300009094 | Bacteria | 14258 |
| 188 | Ga0111539_10020366 | 3300009094 | Bacteria | 8169 |
| 189 | Ga0111539_10041801 | 3300009094 | Bacteria | 5509 |
| 190 | Ga0114129_10244198 | 3300009147 | Bacteria | 2413 |
| 191 | Ga0114129_10412781 | 3300009147 | Bacteria | 1777 |
| 192 | Ga0105243_10104671 | 3300009148 | Bacteria | 2356 |
| 193 | Ga0105243_10601043 | 3300009148 | Bacteria | 1059 |
| 194 | Ga0105242_10159491 | 3300009176 | Bacteria | 1973 |
| 195 | Ga0105242_10293101 | 3300009176 | Bacteria | 1482 |
| 196 | Ga0105248_10001157 | 3300009177 | Bacteria | 29438 |
| 197 | Ga0105248_10363459 | 3300009177 | Bacteria | 1630 |
| 198 | Ga0105237_10034815 | 3300009545 | Bacteria | 5096 |
| 199 | Ga0105237_10081287 | 3300009545 | Bacteria | 3231 |
| 200 | Ga0105238_10382044 | 3300009551 | Bacteria | 1400 |
| 201 | Ga0105249_10007356 | 3300009553 | Bacteria | 9599 |
| 202 | Ga0105249_10026665 | 3300009553 | Bacteria | 5209 |
| 203 | Ga0105249_10541710 | 3300009553 | Bacteria | 1214 |
| 204 | Ga0105032_100079 | 3300009979 | Bacteria | 10287 |
| 205 | Ga0105030_102897 | 3300009987 | Bacteria | 1488 |
| 206 | Ga0105239_10014254 | 3300010375 | Bacteria | 8825 |
| 207 | Ga0157316_1000482 | 3300012510 | Bacteria | 2109 |
| 208 | Ga0157373_10000136 | 3300013100 | Bacteria | 57912 |
| 209 | Ga0157373_10005081 | 3300013100 | Bacteria | 9885 |
| 210 | Ga0157373_10016193 | 3300013100 | Bacteria | 5441 |
| 211 | Ga0157373_10138343 | 3300013100 | Bacteria | 1712 |
| 212 | Ga0157373_10197065 | 3300013100 | Bacteria | 1420 |
| 213 | Ga0157371_10000034 | 3300013102 | Bacteria | 223947 |
| 214 | Ga0157371_10003233 | 3300013102 | Bacteria | 14952 |
| 215 | Ga0157371_10008786 | 3300013102 | Bacteria | 8010 |
| 216 | Ga0157371_10017967 | 3300013102 | Bacteria | 5239 |
| 217 | Ga0157370_10003221 | 3300013104 | Bacteria | 19273 |
| 218 | Ga0157370_10005022 | 3300013104 | Bacteria | 14947 |
| 219 | Ga0157370_10008391 | 3300013104 | Bacteria | 11143 |
| 220 | Ga0157370_10013310 | 3300013104 | Bacteria | 8474 |
| 221 | Ga0157370_10020179 | 3300013104 | Bacteria | 6660 |
| 222 | Ga0157370_10053620 | 3300013104 | Bacteria | 3845 |
| 223 | Ga0157370_10080579 | 3300013104 | Bacteria | 3065 |
| 224 | Ga0157370_10113186 | 3300013104 | Bacteria | 2536 |
| 225 | Ga0157370_10265454 | 3300013104 | Bacteria | 1586 |
| 226 | Ga0157370_10273953 | 3300013104 | Bacteria | 1559 |
| 227 | Ga0157369_10000002 | 3300013105 | Bacteria | 524510 |
| 228 | Ga0157369_10030662 | 3300013105 | Bacteria | 5929 |
| 229 | Ga0157374_10418984 | 3300013296 | Bacteria | 1338 |
| 230 | Ga0157374_10594519 | 3300013296 | Bacteria | 1116 |
| 231 | Ga0157378_10056295 | 3300013297 | Bacteria | 3504 |
| 232 | Ga0163162_10087883 | 3300013306 | Bacteria | 3188 |
| 233 | Ga0163162_10121857 | 3300013306 | Bacteria | 2712 |
| 234 | Ga0163162_10211503 | 3300013306 | Bacteria | 2069 |
| 235 | Ga0157375_10017828 | 3300013308 | Bacteria | 6422 |
| 236 | Ga0157375_10094562 | 3300013308 | Bacteria | 3058 |
| 237 | Ga0157375_10335280 | 3300013308 | Bacteria | 1678 |
| 238 | Ga0157375_10539916 | 3300013308 | Bacteria | 1328 |
| 239 | Ga0157375_10975291 | 3300013308 | Bacteria | 988 |
| 240 | Ga0157514_114954 | 3300013874 | Bacteria | 1237 |
| 241 | Ga0163163_10017551 | 3300014325 | Bacteria | 6678 |
| 242 | Ga0163163_10024275 | 3300014325 | Bacteria | 5769 |
| 243 | Ga0157380_10002823 | 3300014326 | Bacteria | 11811 |
| 244 | Ga0157380_10009355 | 3300014326 | Bacteria | 7017 |
| 245 | Ga0157380_10013438 | 3300014326 | Bacteria | 5968 |
| 246 | Ga0157380_10016352 | 3300014326 | Bacteria | 5470 |
| 247 | Ga0157380_10297777 | 3300014326 | Bacteria | 1484 |
| 248 | Ga0157380_10335501 | 3300014326 | Bacteria | 1408 |
| 249 | Ga0157380_10339673 | 3300014326 | Bacteria | 1400 |
| 250 | Ga0182008_10000018 | 3300014497 | Bacteria | 230609 |
| 251 | Ga0182008_10000524 | 3300014497 | Bacteria | 28770 |
| 252 | Ga0182008_10001182 | 3300014497 | Bacteria | 17998 |
| 253 | Ga0157377_10250591 | 3300014745 | Bacteria | 1147 |
| 254 | Ga0157376_10020516 | 3300014969 | Bacteria | 5113 |
| 255 | Ga0157376_10354312 | 3300014969 | Bacteria | 1405 |
| 256 | Ga0157376_10485344 | 3300014969 | Bacteria | 1212 |
| 257 | Ga0157376_10624471 | 3300014969 | Bacteria | 1075 |
| 258 | Ga0157376_10939444 | 3300014969 | Bacteria | 885 |
| 259 | Ga0182006_1000382 | 3300015261 | Bacteria | 36661 |
| 260 | Ga0182006_1002866 | 3300015261 | Bacteria | 9172 |
| 261 | Ga0182006_1007137 | 3300015261 | Bacteria | 5138 |
| 262 | Ga0182007_10000001 | 3300015262 | Bacteria | 1127301 |
| 263 | Ga0183373_1010 | 3300015682 | Bacteria | 196982 |
| 264 | Ga0163161_10000153 | 3300017792 | Bacteria | 63614 |
| 265 | Ga0163161_10000211 | 3300017792 | Bacteria | 53320 |
| 266 | Ga0163161_10000218 | 3300017792 | Bacteria | 52323 |
| 267 | Ga0163161_10001606 | 3300017792 | Bacteria | 16680 |
| 268 | Ga0163161_10034090 | 3300017792 | Bacteria | 3640 |
| 269 | Ga0163161_10058043 | 3300017792 | Bacteria | 2813 |
| 270 | Ga0163161_10067352 | 3300017792 | Bacteria | 2615 |
| 271 | Ga0163161_10391346 | 3300017792 | Bacteria | 1113 |
| 272 | Ga0163161_10490799 | 3300017792 | Bacteria | 999 |
| 273 | Ga0207425_1000007 | 3300025245 | Bacteria | 777411 |
| 274 | Ga0207425_1000028 | 3300025245 | Bacteria | 286333 |
| 275 | Ga0209129_1000006 | 3300025258 | Bacteria | 777761 |
| 276 | Ga0209129_1000065 | 3300025258 | Bacteria | 232568 |
| 277 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 278 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 279 | Ga0209025_1000025 | 3300025294 | Bacteria | 524454 |
| 280 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 281 | Ga0209758_1000016 | 3300025297 | Bacteria | 778557 |
| 282 | Ga0209050_1000018 | 3300025298 | Bacteria | 723263 |
| 283 | Ga0209050_1021987 | 3300025298 | Bacteria | 2302 |
| 284 | Ga0207682_10004828 | 3300025893 | Bacteria | 5581 |
| 285 | Ga0207682_10006865 | 3300025893 | Bacteria | 4570 |
| 286 | Ga0207692_10090477 | 3300025898 | Bacteria | 1658 |
| 287 | Ga0207642_10162314 | 3300025899 | Bacteria | 1201 |
| 288 | Ga0207688_10048537 | 3300025901 | Bacteria | 2372 |
| 289 | Ga0207645_10008140 | 3300025907 | Bacteria | 7345 |
| 290 | Ga0207643_10002859 | 3300025908 | Bacteria | 9322 |
| 291 | Ga0207643_10261330 | 3300025908 | Bacteria | 1069 |
| 292 | Ga0207707_10385987 | 3300025912 | Bacteria | 1204 |
| 293 | Ga0207671_10020108 | 3300025914 | Bacteria | 5090 |
| 294 | Ga0207671_10100419 | 3300025914 | Bacteria | 2191 |
| 295 | Ga0207663_10069550 | 3300025916 | Bacteria | 2265 |
| 296 | Ga0207662_10015156 | 3300025918 | Bacteria | 4334 |
| 297 | Ga0207657_10253352 | 3300025919 | Bacteria | 1403 |
| 298 | Ga0207649_10132809 | 3300025920 | Bacteria | 1693 |
| 299 | Ga0207681_10035952 | 3300025923 | Bacteria | 3265 |
| 300 | Ga0207681_10210126 | 3300025923 | Bacteria | 1499 |
| 301 | Ga0207650_10023024 | 3300025925 | Bacteria | 4414 |
| 302 | Ga0207650_10143539 | 3300025925 | Bacteria | 1879 |
| 303 | Ga0207650_10207340 | 3300025925 | Bacteria | 1573 |
| 304 | Ga0207659_10012387 | 3300025926 | Bacteria | 5423 |
| 305 | Ga0207659_10030591 | 3300025926 | Bacteria | 3680 |
| 306 | Ga0207659_10469336 | 3300025926 | Bacteria | 1062 |
| 307 | Ga0207659_10568502 | 3300025926 | Bacteria | 965 |
| 308 | Ga0207644_10020294 | 3300025931 | Bacteria | 4518 |
| 309 | Ga0207644_10124880 | 3300025931 | Bacteria | 1963 |
| 310 | Ga0207644_10368945 | 3300025931 | Bacteria | 1169 |
| 311 | Ga0207706_10014709 | 3300025933 | Bacteria | 7089 |
| 312 | Ga0207706_10074555 | 3300025933 | Bacteria | 2984 |
| 313 | Ga0207670_10047124 | 3300025936 | Bacteria | 2868 |
| 314 | Ga0207670_10220934 | 3300025936 | Bacteria | 1450 |
| 315 | Ga0207669_10010796 | 3300025937 | Bacteria | 4413 |
| 316 | Ga0207669_10078323 | 3300025937 | Bacteria | 2106 |
| 317 | Ga0207669_10102078 | 3300025937 | Bacteria | 1899 |
| 318 | Ga0207704_10141413 | 3300025938 | Bacteria | 1684 |
| 319 | Ga0207704_10215131 | 3300025938 | Bacteria | 1417 |
| 320 | Ga0207704_10348264 | 3300025938 | Bacteria | 1152 |
| 321 | Ga0207691_10013086 | 3300025940 | Bacteria | 7942 |
| 322 | Ga0207691_10047401 | 3300025940 | Bacteria | 3943 |
| 323 | Ga0207691_10053881 | 3300025940 | Bacteria | 3671 |
| 324 | Ga0207691_10065138 | 3300025940 | Bacteria | 3300 |
| 325 | Ga0207691_10110205 | 3300025940 | Bacteria | 2449 |
| 326 | Ga0207711_10006071 | 3300025941 | Bacteria | 10206 |
| 327 | Ga0207711_10286786 | 3300025941 | Bacteria | 1517 |
| 328 | Ga0207689_10065958 | 3300025942 | Bacteria | 2977 |
| 329 | Ga0207689_10119636 | 3300025942 | Bacteria | 2167 |
| 330 | Ga0207679_10001705 | 3300025945 | Bacteria | 13701 |
| 331 | Ga0207667_10572285 | 3300025949 | Bacteria | 1141 |
| 332 | Ga0207651_10017784 | 3300025960 | Bacteria | 4209 |
| 333 | Ga0207651_10078569 | 3300025960 | Bacteria | 2367 |
| 334 | Ga0207668_10072791 | 3300025972 | Bacteria | 2460 |
| 335 | Ga0207668_10523839 | 3300025972 | Bacteria | 1023 |
| 336 | Ga0207658_10010629 | 3300025986 | Bacteria | 6256 |
| 337 | Ga0207658_10194194 | 3300025986 | Bacteria | 1690 |
| 338 | Ga0207658_10620593 | 3300025986 | Bacteria | 973 |
| 339 | Ga0207677_10085585 | 3300026023 | Bacteria | 2276 |
| 340 | Ga0207703_10237675 | 3300026035 | Bacteria | 1636 |
| 341 | Ga0207639_10633149 | 3300026041 | Bacteria | 988 |
| 342 | Ga0207678_10008753 | 3300026067 | Bacteria | 8909 |
| 343 | Ga0207708_10023307 | 3300026075 | Bacteria | 4677 |
| 344 | Ga0207708_10045928 | 3300026075 | Bacteria | 3328 |
| 345 | Ga0207708_10172081 | 3300026075 | Bacteria | 1716 |
| 346 | Ga0207708_10326899 | 3300026075 | Bacteria | 1253 |
| 347 | Ga0207702_10242561 | 3300026078 | Bacteria | 1689 |
| 348 | Ga0207641_10463971 | 3300026088 | Bacteria | 1225 |
| 349 | Ga0207641_10813312 | 3300026088 | Bacteria | 925 |
| 350 | Ga0207648_10020686 | 3300026089 | Bacteria | 5923 |
| 351 | Ga0207648_10023400 | 3300026089 | Bacteria | 5534 |
| 352 | Ga0207648_10027409 | 3300026089 | Bacteria | 5057 |
| 353 | Ga0207648_10308645 | 3300026089 | Bacteria | 1420 |
| 354 | Ga0207648_10331072 | 3300026089 | Bacteria | 1370 |
| 355 | Ga0207676_10048097 | 3300026095 | Bacteria | 3309 |
| 356 | Ga0207676_10083393 | 3300026095 | Bacteria | 2603 |
| 357 | Ga0207676_10537228 | 3300026095 | Bacteria | 1115 |
| 358 | Ga0207674_10053147 | 3300026116 | Bacteria | 4129 |
| 359 | Ga0207674_10229605 | 3300026116 | Bacteria | 1804 |
| 360 | Ga0207675_100001062 | 3300026118 | Bacteria | 27254 |
| 361 | Ga0207675_100014561 | 3300026118 | Bacteria | 7330 |
| 362 | Ga0207675_100024041 | 3300026118 | Bacteria | 5664 |
| 363 | Ga0207675_100042940 | 3300026118 | Bacteria | 4222 |
| 364 | Ga0207675_100054162 | 3300026118 | Bacteria | 3742 |
| 365 | Ga0207675_100121874 | 3300026118 | Bacteria | 2468 |
| 366 | Ga0207675_100138649 | 3300026118 | Bacteria | 2309 |
| 367 | Ga0207683_10038587 | 3300026121 | Bacteria | 4164 |
| 368 | Ga0207683_10053089 | 3300026121 | Bacteria | 3553 |
| 369 | Ga0207683_10149117 | 3300026121 | Bacteria | 2110 |
| 370 | Ga0209973_1011888 | 3300027252 | Bacteria | 1051 |
| 371 | Ga0209967_1014944 | 3300027364 | Bacteria | 1109 |
| 372 | Ga0209995_1030015 | 3300027471 | Bacteria | 909 |
| 373 | Ga0209999_1012934 | 3300027543 | Bacteria | 1514 |
| 374 | Ga0209983_1001496 | 3300027665 | Bacteria | 5198 |
| 375 | Ga0207428_10014130 | 3300027907 | Bacteria | 6951 |
| 376 | Ga0207428_10030963 | 3300027907 | Bacteria | 4420 |
| 377 | Ga0207428_10034755 | 3300027907 | Bacteria | 4127 |
| 378 | Ga0207428_10179941 | 3300027907 | Bacteria | 1598 |
| 379 | Ga0207428_10460882 | 3300027907 | Bacteria | 926 |
| 380 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 381 | Ga0268266_10024293 | 3300028379 | Bacteria | 5156 |
| 382 | Ga0268266_10034734 | 3300028379 | Bacteria | 4288 |
| 383 | Ga0268266_10402460 | 3300028379 | Bacteria | 1294 |
| 384 | Ga0268265_10000431 | 3300028380 | Bacteria | 44419 |
| 385 | Ga0268265_10000559 | 3300028380 | Bacteria | 37946 |
| 386 | Ga0268265_10004326 | 3300028380 | Bacteria | 9890 |
| 387 | Ga0268265_10007113 | 3300028380 | Bacteria | 7554 |
| 388 | Ga0268265_10014927 | 3300028380 | Bacteria | 5303 |
| 389 | Ga0268265_10146017 | 3300028380 | Bacteria | 1988 |
| 390 | Ga0268265_10167959 | 3300028380 | Bacteria | 1872 |
| 391 | Ga0268265_10638154 | 3300028380 | Bacteria | 1022 |
| 392 | Ga0268264_10006609 | 3300028381 | Bacteria | 9751 |
| 393 | Ga0307515_10000003 | 3300028794 | Bacteria | 891317 |
| 394 | Ga0307515_10051252 | 3300028794 | Bacteria | 6161 |
| 395 | Ga0307515_10148514 | 3300028794 | Bacteria | 2465 |
| 396 | Ga0307515_10362363 | 3300028794 | Bacteria | 1090 |
| 397 | Ga0316181_1173906 | 3300030744 | Bacteria | 1107 |
| 398 | Ga0265327_10049545 | 3300031251 | Bacteria | 2202 |
| 399 | Ga0307513_10007437 | 3300031456 | Bacteria | 14201 |
| 400 | Ga0307513_10018327 | 3300031456 | Bacteria | 8369 |
| 401 | Ga0307513_10215159 | 3300031456 | Bacteria | 1749 |
| 402 | Ga0307513_10299977 | 3300031456 | Bacteria | 1374 |
| 403 | Ga0307509_10241858 | 3300031507 | Bacteria | 1597 |
| 404 | Ga0307408_100082417 | 3300031548 | Bacteria | 2407 |
| 405 | Ga0307408_100294398 | 3300031548 | Bacteria | 1357 |
| 406 | Ga0316576_10002653 | 3300031727 | Bacteria | 10215 |
| 407 | Ga0316576_10122373 | 3300031727 | Bacteria | 1954 |
| 408 | Ga0316576_10265766 | 3300031727 | Bacteria | 1287 |
| 409 | Ga0316578_10000173 | 3300031728 | Bacteria | 17651 |
| 410 | Ga0316578_10018529 | 3300031728 | Bacteria | 3818 |
| 411 | Ga0307405_10000046 | 3300031731 | Bacteria | 71442 |
| 412 | Ga0307413_10007747 | 3300031824 | Bacteria | 5013 |
| 413 | Ga0307413_10133035 | 3300031824 | Bacteria | 1705 |
| 414 | Ga0307410_10033919 | 3300031852 | Bacteria | 3300 |
| 415 | Ga0307406_10006309 | 3300031901 | Bacteria | 6538 |
| 416 | Ga0307406_10029727 | 3300031901 | Bacteria | 3311 |
| 417 | Ga0307407_10000090 | 3300031903 | Bacteria | 32483 |
| 418 | Ga0307412_10000077 | 3300031911 | Bacteria | 96375 |
| 419 | Ga0307412_10550802 | 3300031911 | Bacteria | 969 |
| 420 | Ga0307409_100032279 | 3300031995 | Bacteria | 3794 |
| 421 | Ga0307409_100036344 | 3300031995 | Bacteria | 3620 |
| 422 | Ga0307416_100000195 | 3300032002 | Bacteria | 32400 |
| 423 | Ga0307416_100025475 | 3300032002 | Bacteria | 4336 |
| 424 | Ga0307416_100079738 | 3300032002 | Bacteria | 2760 |
| 425 | Ga0307416_100109376 | 3300032002 | Bacteria | 2431 |
| 426 | Ga0307416_100219624 | 3300032002 | Bacteria | 1821 |
| 427 | Ga0307414_10000722 | 3300032004 | Bacteria | 16914 |
| 428 | Ga0307414_10001142 | 3300032004 | Bacteria | 13596 |
| 429 | Ga0307414_10001246 | 3300032004 | Bacteria | 13119 |
| 430 | Ga0307414_10006868 | 3300032004 | Bacteria | 6368 |
| 431 | Ga0307414_10009803 | 3300032004 | Bacteria | 5521 |
| 432 | Ga0307414_10031256 | 3300032004 | Bacteria | 3490 |
| 433 | Ga0307414_10293009 | 3300032004 | Bacteria | 1373 |
| 434 | Ga0307414_10313940 | 3300032004 | Bacteria | 1331 |
| 435 | Ga0307411_10040215 | 3300032005 | Bacteria | 2964 |
| 436 | Ga0307415_100028253 | 3300032126 | Bacteria | 3566 |
| 437 | Ga0316592_1004591 | 3300033524 | Bacteria | 2577 |
| 438 | Ga0316596_1034715 | 3300033541 | Bacteria | 1317 |
| 439 | Ga0373955_0148008 | 3300035172 | Bacteria | 1381 |
| 440 | Ga0316574_0012357 | 3300035398 | Bacteria | 4883 |
| 441 | Ga0316574_0400375 | 3300035398 | Bacteria | 864 |
| 442 | Ga0373931_0161963 | 3300035691 | Bacteria | 1312 |
| 443 | Ga0316582_0115077 | 3300036647 | Bacteria | 1794 |
| 444 | Ga0316584_0046123 | 3300036712 | Bacteria | 3254 |
| 445 | Ga0316584_0078686 | 3300036712 | Bacteria | 2469 |
| 446 | Ga0237819_00129 | 3300038705 | Bacteria | 28352 |
| 447 | Ga0400483_113295 | 3300039062 | Bacteria | 1757 |
| 448 | Ga0451791_0832387 | 3300041451 | Bacteria | 3324 |
| 449 | Ga0451802_1227194 | 3300041460 | Bacteria | 1775 |
| 450 | Ga0451807_1278395 | 3300041486 | Bacteria | 3892 |
| 451 | Ga0450921_002850 | 3300042123 | Bacteria | 1181 |
| 452 | Ga0450922_005787 | 3300042124 | Bacteria | 1148 |
| 453 | Ga0450923_001583 | 3300042125 | Bacteria | 3065 |
| 454 | Ga0450923_036460 | 3300042125 | Bacteria | 1020 |
| 455 | Ga0450895_000914 | 3300042132 | Bacteria | 1903 |
| 456 | Ga0450908_001163 | 3300042184 | Bacteria | 5103 |
| 457 | Ga0439434_0007219 | 3300042435 | Bacteria | 3256 |
| 458 | Ga0439444_0001530 | 3300042437 | Bacteria | 3032 |
| 459 | Ga0450918_002643 | 3300042531 | Bacteria | 3378 |
| 460 | Ga0451577_0360327 | 3300042876 | Bacteria | 1319 |
| 461 | Ga0466965_0121914 | 3300044683 | Bacteria | 1347 |
| 462 | Ga0453684_0009848 | 3300044712 | Bacteria | 16550 |
| 463 | Ga0453684_0015777 | 3300044712 | Bacteria | 11888 |
| 464 | Ga0453684_0157621 | 3300044712 | Bacteria | 2689 |
| 465 | Ga0453684_0312123 | 3300044712 | Bacteria | 1784 |
| 466 | Ga0453684_0339806 | 3300044712 | Bacteria | 1696 |
| 467 | Ga0453684_0384599 | 3300044712 | Bacteria | 1575 |
| 468 | Ga0453684_0469156 | 3300044712 | Bacteria | 1398 |
| 469 | Ga0451576_0008691 | 3300045051 | Bacteria | 11887 |
| 470 | Ga0451576_0016207 | 3300045051 | Bacteria | 8231 |
| 471 | Ga0451576_0256191 | 3300045051 | Bacteria | 1829 |
| 472 | Ga0451576_0867453 | 3300045051 | Bacteria | 947 |
| 473 | Ga0495590_0003508 | 3300046457 | Bacteria | 6407 |
| 474 | Ga0495591_019542 | 3300046458 | Bacteria | 2263 |
| 475 | Ga0495638_0000026 | 3300046460 | Bacteria | 347061 |
| 476 | Ga0495638_0046248 | 3300046460 | Bacteria | 2735 |
| 477 | Ga0495650_0011525 | 3300046471 | Bacteria | 4836 |
| 478 | Ga0495650_0108552 | 3300046471 | Bacteria | 1033 |
| 479 | Ga0495606_0252855 | 3300046507 | Bacteria | 976 |
| 480 | Ga0495610_0000126 | 3300046512 | Bacteria | 85368 |
| 481 | Ga0495610_0001202 | 3300046512 | Bacteria | 23373 |
| 482 | Ga0495616_0001490 | 3300046513 | Bacteria | 16200 |
| 483 | Ga0495609_0012187 | 3300046538 | Bacteria | 4079 |
| 484 | Ga0495621_0000313 | 3300046539 | Bacteria | 11770 |
| 485 | Ga0495621_0214333 | 3300046539 | Bacteria | 778 |
| 486 | Ga0495656_0095444 | 3300046615 | Unclassified | 1367 |
| 487 | Ga0495625_0032579 | 3300046660 | Bacteria | 3862 |
| 488 | Ga0495625_0063084 | 3300046660 | Bacteria | 2618 |
| 489 | Ga0495647_0007361 | 3300046681 | Bacteria | 3685 |
| 490 | Ga0495658_0224691 | 3300046683 | Bacteria | 1176 |
| 491 | Ga0495670_0116873 | 3300046691 | Bacteria | 1384 |
| 492 | Ga0495649_0023307 | 3300046694 | Bacteria | 3459 |
| 493 | Ga0495649_0063443 | 3300046694 | Bacteria | 1985 |
| 494 | Ga0495649_0217454 | 3300046694 | Bacteria | 989 |
| 495 | Ga0495636_0014136 | 3300047318 | Bacteria | 3174 |
| 496 | Ga0495636_0016893 | 3300047318 | Bacteria | 2918 |
| 497 | Ga0495636_0159765 | 3300047318 | Bacteria | 1015 |
| 498 | Ga0495615_0068053 | 3300048090 | Bacteria | 954 |
| 499 | Ga0496102_0368090 | 3300048905 | Bacteria | 1353 |
| 500 | Ga0496103_0070806 | 3300048906 | Bacteria | 2182 |
| 501 | Ga0496104_0030225 | 3300048907 | Bacteria | 5033 |
| 502 | Ga0496104_0289977 | 3300048907 | Bacteria | 1549 |
| 503 | Ga0496107_0067275 | 3300048910 | Bacteria | 2599 |
| 504 | Ga0496108_0026584 | 3300048911 | Bacteria | 4773 |
| 505 | Ga0496108_0530247 | 3300048911 | Bacteria | 1028 |
| 506 | Ga0496111_0025838 | 3300048914 | Bacteria | 4143 |
| 507 | Ga0496112_0073419 | 3300048915 | Bacteria | 3382 |
| 508 | Ga0496113_0006223 | 3300048916 | Bacteria | 7539 |
| 509 | Ga0496114_0150470 | 3300048917 | Bacteria | 2019 |
| 510 | Ga0496114_0391462 | 3300048917 | Bacteria | 1231 |
| 511 | Ga0496122_0000746 | 3300048925 | Bacteria | 63466 |
| 512 | Ga0496125_0022164 | 3300048928 | Bacteria | 5903 |
| 513 | Ga0501031_0123465 | 3300049568 | Bacteria | 1691 |
| 514 | Ga0501032_0033823 | 3300049569 | Bacteria | 3501 |
| 515 | Ga0501033_0000565 | 3300049570 | Bacteria | 34468 |
| 516 | Ga0501033_0015891 | 3300049570 | Bacteria | 5700 |
| 517 | Ga0501033_0022293 | 3300049570 | Bacteria | 4777 |
| 518 | Ga0501033_0192381 | 3300049570 | Bacteria | 1459 |
| 519 | Ga0501033_0456927 | 3300049570 | Bacteria | 886 |
| 520 | Ga0501034_0001186 | 3300049571 | Bacteria | 35964 |
| 521 | Ga0501034_0061993 | 3300049571 | Bacteria | 3754 |
| 522 | Ga0501034_0069399 | 3300049571 | Bacteria | 3535 |
| 523 | Ga0501034_0295214 | 3300049571 | Bacteria | 1558 |
| 524 | Ga0501036_0015572 | 3300049572 | Bacteria | 6353 |
| 525 | Ga0501036_0164596 | 3300049572 | Bacteria | 1869 |
| 526 | Ga0501036_0300973 | 3300049572 | Bacteria | 1341 |
| 527 | Ga0501037_0007563 | 3300049573 | Bacteria | 7954 |
| 528 | Ga0501037_0206052 | 3300049573 | Bacteria | 1388 |
| 529 | Ga0501038_0014963 | 3300049574 | Bacteria | 7065 |
| 530 | Ga0501038_0026112 | 3300049574 | Bacteria | 5202 |
| 531 | Ga0501038_0162507 | 3300049574 | Bacteria | 1814 |
| 532 | Ga0501038_0224979 | 3300049574 | Bacteria | 1495 |
| 533 | Ga0501039_0019264 | 3300049575 | Bacteria | 5233 |
| 534 | Ga0501040_0117674 | 3300049576 | Bacteria | 1863 |
| 535 | Ga0501042_0301781 | 3300049578 | Bacteria | 1157 |
| 536 | Ga0501043_0055049 | 3300049579 | Bacteria | 3125 |
| 537 | Ga0501043_0108230 | 3300049579 | Bacteria | 2183 |
| 538 | Ga0501043_0148018 | 3300049579 | Bacteria | 1838 |
| 539 | Ga0501043_0351686 | 3300049579 | Bacteria | 1119 |
| 540 | Ga0501046_0119402 | 3300049580 | Bacteria | 2007 |
| 541 | Ga0501047_0077449 | 3300049581 | Bacteria | 3198 |
| 542 | Ga0501047_0676901 | 3300049581 | Bacteria | 850 |
| 543 | Ga0501048_0088141 | 3300049582 | Bacteria | 2189 |
| 544 | Ga0501067_0005653 | 3300049583 | Bacteria | 6942 |
| 545 | Ga0501067_0252129 | 3300049583 | Bacteria | 982 |
| 546 | Ga0501068_0002289 | 3300049584 | Bacteria | 10196 |
| 547 | Ga0501068_0008783 | 3300049584 | Bacteria | 5636 |
| 548 | Ga0501068_0037284 | 3300049584 | Bacteria | 2911 |
| 549 | Ga0501068_0254563 | 3300049584 | Bacteria | 1119 |
| 550 | Ga0501069_0053721 | 3300049585 | Bacteria | 2243 |
| 551 | Ga0501070_0010032 | 3300049586 | Bacteria | 8013 |
| 552 | Ga0501070_0049919 | 3300049586 | Bacteria | 3473 |
| 553 | Ga0501070_0266187 | 3300049586 | Bacteria | 1400 |
| 554 | Ga0501070_0287403 | 3300049586 | Bacteria | 1341 |
| 555 | Ga0501071_0006079 | 3300049587 | Bacteria | 7824 |
| 556 | Ga0501071_0151457 | 3300049587 | Bacteria | 1730 |
| 557 | Ga0501072_0045113 | 3300049588 | Bacteria | 3465 |
| 558 | Ga0501073_0010204 | 3300049589 | Bacteria | 6899 |
| 559 | Ga0501073_0031115 | 3300049589 | Bacteria | 3808 |
| 560 | Ga0501073_0031708 | 3300049589 | Bacteria | 3770 |
| 561 | Ga0501073_0149009 | 3300049589 | Bacteria | 1621 |
| 562 | Ga0501074_0000122 | 3300049590 | Bacteria | 39373 |
| 563 | Ga0501074_0146970 | 3300049590 | Bacteria | 1685 |
| 564 | Ga0501074_0277709 | 3300049590 | Bacteria | 1191 |
| 565 | Ga0501076_0003260 | 3300049592 | Bacteria | 11363 |
| 566 | Ga0501076_0064474 | 3300049592 | Bacteria | 2920 |
| 567 | Ga0501077_0012335 | 3300049593 | Bacteria | 5353 |
| 568 | Ga0501202_025353 | 3300049652 | Bacteria | 1208 |
| 569 | Ga0501223_015409 | 3300049663 | Bacteria | 1514 |
| 570 | Ga0501080_0004743 | 3300049742 | Bacteria | 12123 |
| 571 | Ga0501080_0009990 | 3300049742 | Bacteria | 8675 |
| 572 | Ga0501080_0051688 | 3300049742 | Bacteria | 3824 |
| 573 | Ga0501080_0430244 | 3300049742 | Bacteria | 1185 |
| 574 | Ga0501081_0183210 | 3300049743 | Bacteria | 1515 |
| 575 | Ga0501083_0021903 | 3300049744 | Bacteria | 4437 |
| 576 | Ga0501083_0040105 | 3300049744 | Bacteria | 3179 |
| 577 | Ga0501083_0070248 | 3300049744 | Bacteria | 2329 |
| 578 | Ga0501241_001635 | 3300049758 | Bacteria | 4488 |
| 579 | Ga0501241_010730 | 3300049758 | Bacteria | 1664 |
| 580 | Ga0501035_0042356 | 3300049822 | Bacteria | 4106 |
| 581 | Ga0501035_0053386 | 3300049822 | Bacteria | 3614 |
| 582 | Ga0501035_0070638 | 3300049822 | Bacteria | 3092 |
| 583 | Ga0501035_0260658 | 3300049822 | Bacteria | 1469 |
| 584 | Ga0501044_0118123 | 3300049823 | Bacteria | 2655 |
| 585 | Ga0501044_0165803 | 3300049823 | Bacteria | 2183 |
| 586 | Ga0501044_0179541 | 3300049823 | Bacteria | 2084 |
| 587 | Ga0501044_0243286 | 3300049823 | Bacteria | 1742 |
| 588 | Ga0501044_0368423 | 3300049823 | Bacteria | 1353 |
| 589 | nmdc:mga05p37_324208_c1 | 3300050507 | Bacteria | 1822 |
| 590 | nmdc:mga05p37_555197_c1 | 3300050507 | Bacteria | 1306 |
| 591 | nmdc:mga09592_333937_c1 | 3300050508 | Bacteria | 1312 |
| 592 | nmdc:mga09592_3569_c1 | 3300050508 | Bacteria | 12561 |
| 593 | nmdc:mga09592_41467_c1 | 3300050508 | Bacteria | 3871 |
| 594 | nmdc:mga0qj67_18387_c1 | 3300050509 | Bacteria | 5326 |
| 595 | nmdc:mga0qj67_306244_c1 | 3300050509 | Bacteria | 1287 |
| 596 | nmdc:mga0qj67_3538_c1 | 3300050509 | Bacteria | 11284 |
| 597 | nmdc:mga06r32_1358_c1 | 3300050510 | Bacteria | 22092 |
| 598 | nmdc:mga06r32_29_c1 | 3300050510 | Bacteria | 85620 |
| 599 | nmdc:mga06r32_415440_c1 | 3300050510 | Bacteria | 1327 |
| 600 | nmdc:mga08y16_1085_c1 | 3300050511 | Bacteria | 26787 |
| 601 | nmdc:mga08y16_21076_c1 | 3300050511 | Bacteria | 6882 |
| 602 | nmdc:mga08y16_420582_c1 | 3300050511 | Bacteria | 1366 |
| 603 | nmdc:mga08y16_4769_c1 | 3300050511 | Bacteria | 14148 |
| 604 | nmdc:mga08y16_5940_c1 | 3300050511 | Bacteria | 12798 |
| 605 | nmdc:mga08y16_620164_c1 | 3300050511 | Bacteria | 1088 |
| 606 | nmdc:mga0n895_3290_c1 | 3300050512 | Bacteria | 12974 |
| 607 | nmdc:mga0a205_340_c1 | 3300050515 | Bacteria | 35138 |
| 608 | Ga0500578_0088549 | 3300053086 | Unclassified | 1966 |
| 609 | Ga0500583_0070489 | 3300053092 | Bacteria | 1670 |
| 610 | Ga0500651_0000127 | 3300053093 | Bacteria | 47010 |
| 611 | Ga0500651_0105507 | 3300053093 | Bacteria | 1724 |
| 612 | Ga0500641_0037149 | 3300053096 | Bacteria | 1951 |
| 613 | Ga0500556_0065218 | 3300053104 | Bacteria | 1350 |
| 614 | Ga0500617_012758 | 3300053124 | Bacteria | 3546 |
| 615 | Ga0500658_0008694 | 3300053134 | Bacteria | 3748 |
| 616 | Ga0500568_0000457 | 3300053139 | Bacteria | 30439 |
| 617 | Ga0500588_0001244 | 3300053146 | Bacteria | 4742 |
| 618 | Ga0500616_0000004 | 3300053153 | Bacteria | 1002714 |
| 619 | Ga0500616_0000130 | 3300053153 | Bacteria | 132948 |
| 620 | Ga0500622_0002376 | 3300053156 | Bacteria | 13637 |
| 621 | Ga0500622_0021105 | 3300053156 | Bacteria | 3457 |
| 622 | Ga0500634_0007244 | 3300053161 | Bacteria | 5448 |
| 623 | Ga0500637_0215840 | 3300053178 | Bacteria | 1087 |
| 624 | Ga0500656_008583 | 3300053732 | Bacteria | 1086 |
| 625 | Ga0501084_0039566 | 3300054114 | Bacteria | 3944 |
| 626 | Ga0501084_0056470 | 3300054114 | Bacteria | 3285 |
| 627 | Ga0501084_0071684 | 3300054114 | Bacteria | 2901 |
| 628 | Ga0501084_0162656 | 3300054114 | Bacteria | 1883 |
| 629 | Ga0501082_0000792 | 3300060353 | Bacteria | 27834 |
| 630 | Ga0501082_0006985 | 3300060353 | Bacteria | 9749 |
| 631 | Ga0501082_0012251 | 3300060353 | Bacteria | 7370 |
| 632 | Ga0501082_0225618 | 3300060353 | Bacteria | 1630 |
| 633 | Ga0530510_0081160 | 3300061734 | Bacteria | 2361 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0360327 | Ga0451577_0360327_660_1304 | 209 |
| 2 | 3300046539 | Ga0495621_0214333 | Ga0495621_0214333_14_658 | 209 |
| 3 | 3300006844 | Ga0075428_100021514 | Ga0075428_1000215148 | 237 |
| 4 | 3300009094 | Ga0111539_10020366 | Ga0111539_100203667 | 237 |
| 5 | 3300027907 | Ga0207428_10030963 | Ga0207428_100309632 | 237 |
| 6 | 3300050511 | nmdc:mga08y16_5940_c1 | nmdc:mga08y16_5940_c1_3304_4119 | 237 |
| 7 | 3300047318 | Ga0495636_0014136 | Ga0495636_0014136_1277_2047 | 238 |
| 8 | 3300053086 | Ga0500578_0088549 | Ga0500578_0088549_694_1479 | 238 |
| 9 | 3300005841 | Ga0068863_100042992 | Ga0068863_1000429923 | 239 |
| 10 | 3300006844 | Ga0075428_100019438 | Ga0075428_1000194385 | 240 |
| 11 | 3300009094 | Ga0111539_10001328 | Ga0111539_1000132822 | 240 |
| 12 | 3300027907 | Ga0207428_10460882 | Ga0207428_104608822 | 240 |
| 13 | 3300028794 | Ga0307515_10000003 | Ga0307515_10000003218 | 240 |
| 14 | 3300039062 | Ga0400483_113295 | Ga0400483_113295_80_856 | 241 |
| 15 | 3300005437 | Ga0070710_10024018 | Ga0070710_100240183 | 242 |
| 16 | 3300005439 | Ga0070711_100031580 | Ga0070711_1000315803 | 242 |
| 17 | 3300044712 | Ga0453684_0009848 | Ga0453684_0009848_2395_3174 | 242 |
| 18 | 3300045051 | Ga0451576_0008691 | Ga0451576_0008691_1666_2445 | 242 |
| 19 | 3300048907 | Ga0496104_0030225 | Ga0496104_0030225_564_1295 | 242 |
| 20 | 3300048917 | Ga0496114_0150470 | Ga0496114_0150470_761_1492 | 242 |
| 21 | 3300006844 | Ga0075428_100090636 | Ga0075428_1000906362 | 243 |
| 22 | 3300006880 | Ga0075429_100283927 | Ga0075429_1002839272 | 243 |
| 23 | 3300009094 | Ga0111539_10005730 | Ga0111539_100057302 | 243 |
| 24 | 3300009147 | Ga0114129_10244198 | Ga0114129_102441982 | 243 |
| 25 | 3300014326 | Ga0157380_10297777 | Ga0157380_102977772 | 243 |
| 26 | 3300027907 | Ga0207428_10014130 | Ga0207428_100141302 | 243 |
| 27 | 3300046681 | Ga0495647_0007361 | Ga0495647_0007361_1830_2621 | 243 |
| 28 | 3300046683 | Ga0495658_0224691 | Ga0495658_0224691_98_889 | 243 |
| 29 | 3300050507 | nmdc:mga05p37_324208_c1 | nmdc:mga05p37_324208_c1_367_1155 | 243 |
| 30 | 3300050511 | nmdc:mga08y16_4769_c1 | nmdc:mga08y16_4769_c1_5866_6654 | 243 |
| 31 | 3300053178 | Ga0500637_0215840 | Ga0500637_0215840_30_764 | 244 |
| 32 | 3300042124 | Ga0450922_005787 | Ga0450922_005787_43_780 | 245 |
| 33 | 3300042125 | Ga0450923_036460 | Ga0450923_036460_26_763 | 245 |
| 34 | 3300049578 | Ga0501042_0301781 | Ga0501042_0301781_187_960 | 245 |
| 35 | 3300031727 | Ga0316576_10265766 | Ga0316576_102657661 | 246 |
| 36 | 3300049586 | Ga0501070_0287403 | Ga0501070_0287403_242_1009 | 246 |
| 37 | 3300006852 | Ga0075433_10000056 | Ga0075433_100000569 | 247 |
| 38 | 3300006871 | Ga0075434_100021092 | Ga0075434_1000210923 | 247 |
| 39 | 3300007076 | Ga0075435_100146385 | Ga0075435_1001463852 | 247 |
| 40 | 3300014326 | Ga0157380_10016352 | Ga0157380_100163524 | 247 |
| 41 | 3300026116 | Ga0207674_10229605 | Ga0207674_102296052 | 247 |
| 42 | 3300027364 | Ga0209967_1014944 | Ga0209967_10149442 | 247 |
| 43 | 3300031548 | Ga0307408_100082417 | Ga0307408_1000824173 | 247 |
| 44 | 3300031901 | Ga0307406_10029727 | Ga0307406_100297272 | 247 |
| 45 | 3300032002 | Ga0307416_100079738 | Ga0307416_1000797382 | 247 |
| 46 | 3300042132 | Ga0450895_000914 | Ga0450895_000914_338_1138 | 247 |
| 47 | 3300042184 | Ga0450908_001163 | Ga0450908_001163_579_1379 | 247 |
| 48 | 3300042435 | Ga0439434_0007219 | Ga0439434_0007219_1458_2225 | 247 |
| 49 | 3300042437 | Ga0439444_0001530 | Ga0439444_0001530_1866_2666 | 247 |
| 50 | 3300042531 | Ga0450918_002643 | Ga0450918_002643_1753_2553 | 247 |
| 51 | 3300044712 | Ga0453684_0469156 | Ga0453684_0469156_203_988 | 247 |
| 52 | 3300049582 | Ga0501048_0088141 | Ga0501048_0088141_1220_2020 | 247 |
| 53 | 3300049584 | Ga0501068_0037284 | Ga0501068_0037284_1198_1998 | 247 |
| 54 | 3300049590 | Ga0501074_0277709 | Ga0501074_0277709_28_828 | 247 |
| 55 | 3300050512 | nmdc:mga0n895_3290_c1 | nmdc:mga0n895_3290_c1_11378_12178 | 247 |
| 56 | 3300050515 | nmdc:mga0a205_340_c1 | nmdc:mga0a205_340_c1_29396_30196 | 247 |
| 57 | 3300005355 | Ga0070671_100353988 | Ga0070671_1003539882 | 248 |
| 58 | 3300005618 | Ga0068864_100020929 | Ga0068864_1000209293 | 248 |
| 59 | 3300009092 | Ga0105250_10146565 | Ga0105250_101465651 | 248 |
| 60 | 3300009987 | Ga0105030_102897 | Ga0105030_1028971 | 248 |
| 61 | 3300012510 | Ga0157316_1000482 | Ga0157316_10004823 | 248 |
| 62 | 3300013874 | Ga0157514_114954 | Ga0157514_1149541 | 248 |
| 63 | 3300025941 | Ga0207711_10286786 | Ga0207711_102867862 | 248 |
| 64 | 3300026095 | Ga0207676_10083393 | Ga0207676_100833932 | 248 |
| 65 | 3300047318 | Ga0495636_0016893 | Ga0495636_0016893_1325_2146 | 248 |
| 66 | 3300048905 | Ga0496102_0368090 | Ga0496102_0368090_80_901 | 248 |
| 67 | 3300048906 | Ga0496103_0070806 | Ga0496103_0070806_1115_1936 | 248 |
| 68 | 3300048910 | Ga0496107_0067275 | Ga0496107_0067275_511_1332 | 248 |
| 69 | 3300048911 | Ga0496108_0026584 | Ga0496108_0026584_652_1473 | 248 |
| 70 | 3300048914 | Ga0496111_0025838 | Ga0496111_0025838_1283_2104 | 248 |
| 71 | 3300048916 | Ga0496113_0006223 | Ga0496113_0006223_1328_2149 | 248 |
| 72 | 3300049583 | Ga0501067_0005653 | Ga0501067_0005653_2543_3346 | 248 |
| 73 | 3300049589 | Ga0501073_0010204 | Ga0501073_0010204_1781_2584 | 248 |
| 74 | 3300049742 | Ga0501080_0004743 | Ga0501080_0004743_7921_8724 | 248 |
| 75 | 3300049744 | Ga0501083_0040105 | Ga0501083_0040105_1108_1911 | 248 |
| 76 | 3300054114 | Ga0501084_0162656 | Ga0501084_0162656_841_1644 | 248 |
| 77 | 3300060353 | Ga0501082_0012251 | Ga0501082_0012251_3358_4161 | 248 |
| 78 | 3300013104 | Ga0157370_10013310 | Ga0157370_100133108 | 249 |
| 79 | 3300032002 | Ga0307416_100025475 | Ga0307416_1000254752 | 249 |
| 80 | 3300005331 | Ga0070670_100116787 | Ga0070670_1001167873 | 250 |
| 81 | 3300005337 | Ga0070682_100406652 | Ga0070682_1004066521 | 250 |
| 82 | 3300005466 | Ga0070685_10212982 | Ga0070685_102129822 | 250 |
| 83 | 3300005545 | Ga0070695_100221314 | Ga0070695_1002213142 | 250 |
| 84 | 3300006844 | Ga0075428_100038382 | Ga0075428_1000383822 | 250 |
| 85 | 3300006846 | Ga0075430_100085988 | Ga0075430_1000859883 | 250 |
| 86 | 3300006880 | Ga0075429_100115776 | Ga0075429_1001157761 | 250 |
| 87 | 3300042123 | Ga0450921_002850 | Ga0450921_002850_41_805 | 250 |
| 88 | 3300042125 | Ga0450923_001583 | Ga0450923_001583_1454_2218 | 250 |
| 89 | 3300045051 | Ga0451576_0256191 | Ga0451576_0256191_192_974 | 250 |
| 90 | 3300049574 | Ga0501038_0162507 | Ga0501038_0162507_143_907 | 250 |
| 91 | 3300049576 | Ga0501040_0117674 | Ga0501040_0117674_987_1751 | 250 |
| 92 | 3300049592 | Ga0501076_0064474 | Ga0501076_0064474_1696_2460 | 250 |
| 93 | 3300050508 | nmdc:mga09592_41467_c1 | nmdc:mga09592_41467_c1_627_1391 | 250 |
| 94 | 3300050509 | nmdc:mga0qj67_18387_c1 | nmdc:mga0qj67_18387_c1_3573_4337 | 250 |
| 95 | iso_pu_bacteria | 2524614729 | 2525556094 | 250 |
| 96 | iso_pu_bacteria | 2627854209 | 2630651108 | 250 |
| 97 | 3300002773 | JGI25152J39213_1000018 | JGI25152J39213_100001865 | 251 |
| 98 | 3300002774 | JGI25150J39212_1000159 | JGI25150J39212_10001598 | 251 |
| 99 | 3300003187 | JGI25151J46595_10000111 | JGI25151J46595_1000011166 | 251 |
| 100 | 3300003215 | JGI25153J46596_10000085 | JGI25153J46596_1000008536 | 251 |
| 101 | 3300003322 | rootL2_10078753 | rootL2_100787534 | 251 |
| 102 | 3300003322 | rootL2_10104587 | rootL2_101045879 | 251 |
| 103 | 3300003323 | rootH1_10005821 | rootH1_1000582184 | 251 |
| 104 | 3300005367 | Ga0070667_100682330 | Ga0070667_1006823301 | 251 |
| 105 | 3300005548 | Ga0070665_100000077 | Ga0070665_10000007750 | 251 |
| 106 | 3300005719 | Ga0068861_100009322 | Ga0068861_1000093225 | 251 |
| 107 | 3300009094 | Ga0111539_10007197 | Ga0111539_100071973 | 251 |
| 108 | 3300014326 | Ga0157380_10009355 | Ga0157380_100093553 | 251 |
| 109 | 3300025245 | Ga0207425_1000028 | Ga0207425_1000028235 | 251 |
| 110 | 3300025258 | Ga0209129_1000065 | Ga0209129_1000065183 | 251 |
| 111 | 3300025294 | Ga0209025_1000002 | Ga0209025_100000237 | 251 |
| 112 | 3300025297 | Ga0209758_1000003 | Ga0209758_100000344 | 251 |
| 113 | 3300025298 | Ga0209050_1021987 | Ga0209050_10219872 | 251 |
| 114 | 3300026118 | Ga0207675_100014561 | Ga0207675_1000145615 | 251 |
| 115 | 3300027907 | Ga0207428_10179941 | Ga0207428_101799412 | 251 |
| 116 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000011460 | 251 |
| 117 | 3300031251 | Ga0265327_10049545 | Ga0265327_100495452 | 251 |
| 118 | 3300031456 | Ga0307513_10215159 | Ga0307513_102151592 | 251 |
| 119 | 3300031456 | Ga0307513_10299977 | Ga0307513_102999772 | 251 |
| 120 | 3300031507 | Ga0307509_10241858 | Ga0307509_102418581 | 251 |
| 121 | 3300031727 | Ga0316576_10002653 | Ga0316576_100026538 | 251 |
| 122 | 3300031728 | Ga0316578_10000173 | Ga0316578_100001734 | 251 |
| 123 | 3300035398 | Ga0316574_0400375 | Ga0316574_0400375_86_844 | 251 |
| 124 | 3300036712 | Ga0316584_0046123 | Ga0316584_0046123_151_909 | 251 |
| 125 | 3300038705 | Ga0237819_00129 | Ga0237819_00129_26442_27209 | 251 |
| 126 | 3300044712 | Ga0453684_0015777 | Ga0453684_0015777_9686_10459 | 251 |
| 127 | 3300044712 | Ga0453684_0312123 | Ga0453684_0312123_605_1375 | 251 |
| 128 | 3300045051 | Ga0451576_0016207 | Ga0451576_0016207_7299_8084 | 251 |
| 129 | 3300046460 | Ga0495638_0000026 | Ga0495638_0000026_43278_44057 | 251 |
| 130 | 3300049652 | Ga0501202_025353 | Ga0501202_025353_19_789 | 251 |
| 131 | 3300049663 | Ga0501223_015409 | Ga0501223_015409_685_1455 | 251 |
| 132 | 3300050511 | nmdc:mga08y16_420582_c1 | nmdc:mga08y16_420582_c1_76_855 | 251 |
| 133 | 3300053153 | Ga0500616_0000004 | Ga0500616_0000004_184437_185216 | 251 |
| 134 | 3300053161 | Ga0500634_0007244 | Ga0500634_0007244_2507_3280 | 251 |
| 135 | iso_pu_bacteria | 2884634485 | 2884634988 | 251 |
| 136 | iso_pu_bacteria | 2895498888 | 2895500990 | 251 |
| 137 | iso_pu_bacteria | 2919692658 | 2919694660 | 251 |
| 138 | 3300003316 | rootH1_10007102 | rootH1_1000710223 | 252 |
| 139 | 3300003322 | rootL2_10115706 | rootL2_101157068 | 252 |
| 140 | 3300005331 | Ga0070670_100048722 | Ga0070670_1000487223 | 252 |
| 141 | 3300005338 | Ga0068868_100289660 | Ga0068868_1002896601 | 252 |
| 142 | 3300005347 | Ga0070668_100021125 | Ga0070668_1000211253 | 252 |
| 143 | 3300005353 | Ga0070669_100081104 | Ga0070669_1000811044 | 252 |
| 144 | 3300005355 | Ga0070671_100107212 | Ga0070671_1001072123 | 252 |
| 145 | 3300005356 | Ga0070674_100079456 | Ga0070674_1000794563 | 252 |
| 146 | 3300005367 | Ga0070667_100002844 | Ga0070667_1000028446 | 252 |
| 147 | 3300005367 | Ga0070667_100021422 | Ga0070667_1000214223 | 252 |
| 148 | 3300005367 | Ga0070667_100106926 | Ga0070667_1001069264 | 252 |
| 149 | 3300005440 | Ga0070705_100092474 | Ga0070705_1000924742 | 252 |
| 150 | 3300005441 | Ga0070700_100602779 | Ga0070700_1006027791 | 252 |
| 151 | 3300005444 | Ga0070694_100078342 | Ga0070694_1000783422 | 252 |
| 152 | 3300005457 | Ga0070662_100003547 | Ga0070662_1000035476 | 252 |
| 153 | 3300005539 | Ga0068853_100136187 | Ga0068853_1001361872 | 252 |
| 154 | 3300005539 | Ga0068853_100312672 | Ga0068853_1003126721 | 252 |
| 155 | 3300005543 | Ga0070672_100039511 | Ga0070672_1000395113 | 252 |
| 156 | 3300005548 | Ga0070665_100045417 | Ga0070665_1000454173 | 252 |
| 157 | 3300005548 | Ga0070665_100187310 | Ga0070665_1001873101 | 252 |
| 158 | 3300005548 | Ga0070665_100461321 | Ga0070665_1004613211 | 252 |
| 159 | 3300005563 | Ga0068855_100591419 | Ga0068855_1005914191 | 252 |
| 160 | 3300005614 | Ga0068856_100031658 | Ga0068856_1000316582 | 252 |
| 161 | 3300005616 | Ga0068852_100241101 | Ga0068852_1002411012 | 252 |
| 162 | 3300005617 | Ga0068859_100001149 | Ga0068859_10000114918 | 252 |
| 163 | 3300005719 | Ga0068861_100000256 | Ga0068861_10000025611 | 252 |
| 164 | 3300005841 | Ga0068863_100017715 | Ga0068863_1000177152 | 252 |
| 165 | 3300005843 | Ga0068860_100451323 | Ga0068860_1004513231 | 252 |
| 166 | 3300005844 | Ga0068862_100000453 | Ga0068862_10000045331 | 252 |
| 167 | 3300005844 | Ga0068862_100000878 | Ga0068862_10000087829 | 252 |
| 168 | 3300005983 | Ga0081540_1005554 | Ga0081540_10055548 | 252 |
| 169 | 3300006237 | Ga0097621_100020849 | Ga0097621_1000208494 | 252 |
| 170 | 3300006358 | Ga0068871_100075919 | Ga0068871_1000759192 | 252 |
| 171 | 3300006844 | Ga0075428_100015420 | Ga0075428_1000154204 | 252 |
| 172 | 3300006846 | Ga0075430_100022366 | Ga0075430_1000223663 | 252 |
| 173 | 3300006847 | Ga0075431_100017639 | Ga0075431_1000176393 | 252 |
| 174 | 3300006847 | Ga0075431_100487574 | Ga0075431_1004875742 | 252 |
| 175 | 3300006881 | Ga0068865_100262464 | Ga0068865_1002624642 | 252 |
| 176 | 3300006931 | Ga0097620_100001149 | Ga0097620_10000114918 | 252 |
| 177 | 3300009094 | Ga0111539_10041801 | Ga0111539_100418013 | 252 |
| 178 | 3300009147 | Ga0114129_10412781 | Ga0114129_104127812 | 252 |
| 179 | 3300009176 | Ga0105242_10293101 | Ga0105242_102931012 | 252 |
| 180 | 3300009545 | Ga0105237_10081287 | Ga0105237_100812872 | 252 |
| 181 | 3300009553 | Ga0105249_10007356 | Ga0105249_100073563 | 252 |
| 182 | 3300009979 | Ga0105032_100079 | Ga0105032_1000792 | 252 |
| 183 | 3300010375 | Ga0105239_10014254 | Ga0105239_100142543 | 252 |
| 184 | 3300013100 | Ga0157373_10197065 | Ga0157373_101970652 | 252 |
| 185 | 3300013308 | Ga0157375_10975291 | Ga0157375_109752912 | 252 |
| 186 | 3300014326 | Ga0157380_10339673 | Ga0157380_103396732 | 252 |
| 187 | 3300014969 | Ga0157376_10020516 | Ga0157376_100205164 | 252 |
| 188 | 3300025912 | Ga0207707_10385987 | Ga0207707_103859871 | 252 |
| 189 | 3300025914 | Ga0207671_10100419 | Ga0207671_101004192 | 252 |
| 190 | 3300025919 | Ga0207657_10253352 | Ga0207657_102533522 | 252 |
| 191 | 3300025925 | Ga0207650_10023024 | Ga0207650_100230242 | 252 |
| 192 | 3300025931 | Ga0207644_10020294 | Ga0207644_100202943 | 252 |
| 193 | 3300025931 | Ga0207644_10368945 | Ga0207644_103689452 | 252 |
| 194 | 3300025933 | Ga0207706_10014709 | Ga0207706_100147096 | 252 |
| 195 | 3300025937 | Ga0207669_10102078 | Ga0207669_101020783 | 252 |
| 196 | 3300025940 | Ga0207691_10047401 | Ga0207691_100474012 | 252 |
| 197 | 3300025940 | Ga0207691_10053881 | Ga0207691_100538812 | 252 |
| 198 | 3300025949 | Ga0207667_10572285 | Ga0207667_105722851 | 252 |
| 199 | 3300025972 | Ga0207668_10072791 | Ga0207668_100727914 | 252 |
| 200 | 3300025986 | Ga0207658_10010629 | Ga0207658_100106292 | 252 |
| 201 | 3300025986 | Ga0207658_10194194 | Ga0207658_101941941 | 252 |
| 202 | 3300026067 | Ga0207678_10008753 | Ga0207678_100087532 | 252 |
| 203 | 3300026075 | Ga0207708_10326899 | Ga0207708_103268991 | 252 |
| 204 | 3300026078 | Ga0207702_10242561 | Ga0207702_102425612 | 252 |
| 205 | 3300026089 | Ga0207648_10020686 | Ga0207648_100206863 | 252 |
| 206 | 3300026116 | Ga0207674_10053147 | Ga0207674_100531473 | 252 |
| 207 | 3300026118 | Ga0207675_100001062 | Ga0207675_10000106211 | 252 |
| 208 | 3300026121 | Ga0207683_10149117 | Ga0207683_101491172 | 252 |
| 209 | 3300027471 | Ga0209995_1030015 | Ga0209995_10300151 | 252 |
| 210 | 3300027665 | Ga0209983_1001496 | Ga0209983_10014962 | 252 |
| 211 | 3300028379 | Ga0268266_10402460 | Ga0268266_104024601 | 252 |
| 212 | 3300028380 | Ga0268265_10000431 | Ga0268265_1000043131 | 252 |
| 213 | 3300028380 | Ga0268265_10000559 | Ga0268265_1000055928 | 252 |
| 214 | 3300028381 | Ga0268264_10006609 | Ga0268264_100066096 | 252 |
| 215 | 3300028794 | Ga0307515_10148514 | Ga0307515_101485142 | 252 |
| 216 | 3300031727 | Ga0316576_10122373 | Ga0316576_101223732 | 252 |
| 217 | 3300031728 | Ga0316578_10018529 | Ga0316578_100185294 | 252 |
| 218 | 3300033524 | Ga0316592_1004591 | Ga0316592_10045911 | 252 |
| 219 | 3300033541 | Ga0316596_1034715 | Ga0316596_10347152 | 252 |
| 220 | 3300035398 | Ga0316574_0012357 | Ga0316574_0012357_1113_1877 | 252 |
| 221 | 3300036647 | Ga0316582_0115077 | Ga0316582_0115077_951_1712 | 252 |
| 222 | 3300036712 | Ga0316584_0078686 | Ga0316584_0078686_249_1013 | 252 |
| 223 | 3300044712 | Ga0453684_0384599 | Ga0453684_0384599_158_967 | 252 |
| 224 | 3300045051 | Ga0451576_0867453 | Ga0451576_0867453_114_923 | 252 |
| 225 | 3300048090 | Ga0495615_0068053 | Ga0495615_0068053_119_892 | 252 |
| 226 | 3300048911 | Ga0496108_0530247 | Ga0496108_0530247_114_887 | 252 |
| 227 | 3300048917 | Ga0496114_0391462 | Ga0496114_0391462_403_1188 | 252 |
| 228 | 3300049568 | Ga0501031_0123465 | Ga0501031_0123465_395_1180 | 252 |
| 229 | 3300049569 | Ga0501032_0033823 | Ga0501032_0033823_1732_2517 | 252 |
| 230 | 3300049570 | Ga0501033_0000565 | Ga0501033_0000565_20706_21476 | 252 |
| 231 | 3300049570 | Ga0501033_0015891 | Ga0501033_0015891_3184_3969 | 252 |
| 232 | 3300049570 | Ga0501033_0192381 | Ga0501033_0192381_600_1385 | 252 |
| 233 | 3300049570 | Ga0501033_0456927 | Ga0501033_0456927_75_860 | 252 |
| 234 | 3300049571 | Ga0501034_0001186 | Ga0501034_0001186_6161_6931 | 252 |
| 235 | 3300049571 | Ga0501034_0061993 | Ga0501034_0061993_2770_3555 | 252 |
| 236 | 3300049571 | Ga0501034_0295214 | Ga0501034_0295214_440_1225 | 252 |
| 237 | 3300049572 | Ga0501036_0015572 | Ga0501036_0015572_2550_3335 | 252 |
| 238 | 3300049572 | Ga0501036_0164596 | Ga0501036_0164596_889_1674 | 252 |
| 239 | 3300049572 | Ga0501036_0300973 | Ga0501036_0300973_197_982 | 252 |
| 240 | 3300049573 | Ga0501037_0007563 | Ga0501037_0007563_6104_6889 | 252 |
| 241 | 3300049574 | Ga0501038_0026112 | Ga0501038_0026112_3775_4560 | 252 |
| 242 | 3300049574 | Ga0501038_0224979 | Ga0501038_0224979_515_1300 | 252 |
| 243 | 3300049575 | Ga0501039_0019264 | Ga0501039_0019264_2742_3527 | 252 |
| 244 | 3300049579 | Ga0501043_0055049 | Ga0501043_0055049_2171_2956 | 252 |
| 245 | 3300049579 | Ga0501043_0108230 | Ga0501043_0108230_629_1414 | 252 |
| 246 | 3300049579 | Ga0501043_0351686 | Ga0501043_0351686_162_947 | 252 |
| 247 | 3300049580 | Ga0501046_0119402 | Ga0501046_0119402_835_1620 | 252 |
| 248 | 3300049581 | Ga0501047_0077449 | Ga0501047_0077449_26_811 | 252 |
| 249 | 3300049583 | Ga0501067_0252129 | Ga0501067_0252129_22_807 | 252 |
| 250 | 3300049584 | Ga0501068_0008783 | Ga0501068_0008783_4657_5442 | 252 |
| 251 | 3300049584 | Ga0501068_0254563 | Ga0501068_0254563_136_921 | 252 |
| 252 | 3300049585 | Ga0501069_0053721 | Ga0501069_0053721_924_1709 | 252 |
| 253 | 3300049586 | Ga0501070_0049919 | Ga0501070_0049919_985_1770 | 252 |
| 254 | 3300049586 | Ga0501070_0266187 | Ga0501070_0266187_458_1243 | 252 |
| 255 | 3300049587 | Ga0501071_0151457 | Ga0501071_0151457_648_1433 | 252 |
| 256 | 3300049589 | Ga0501073_0031115 | Ga0501073_0031115_1731_2516 | 252 |
| 257 | 3300049589 | Ga0501073_0149009 | Ga0501073_0149009_570_1355 | 252 |
| 258 | 3300049590 | Ga0501074_0146970 | Ga0501074_0146970_493_1278 | 252 |
| 259 | 3300049742 | Ga0501080_0051688 | Ga0501080_0051688_2840_3625 | 252 |
| 260 | 3300049742 | Ga0501080_0430244 | Ga0501080_0430244_374_1138 | 252 |
| 261 | 3300049743 | Ga0501081_0183210 | Ga0501081_0183210_365_1150 | 252 |
| 262 | 3300049744 | Ga0501083_0070248 | Ga0501083_0070248_566_1351 | 252 |
| 263 | 3300049822 | Ga0501035_0042356 | Ga0501035_0042356_2351_3136 | 252 |
| 264 | 3300049822 | Ga0501035_0053386 | Ga0501035_0053386_289_1074 | 252 |
| 265 | 3300049822 | Ga0501035_0260658 | Ga0501035_0260658_662_1447 | 252 |
| 266 | 3300049823 | Ga0501044_0118123 | Ga0501044_0118123_1199_1984 | 252 |
| 267 | 3300049823 | Ga0501044_0165803 | Ga0501044_0165803_629_1414 | 252 |
| 268 | 3300049823 | Ga0501044_0179541 | Ga0501044_0179541_1277_2062 | 252 |
| 269 | 3300049823 | Ga0501044_0243286 | Ga0501044_0243286_591_1376 | 252 |
| 270 | 3300050507 | nmdc:mga05p37_555197_c1 | nmdc:mga05p37_555197_c1_54_830 | 252 |
| 271 | 3300050508 | nmdc:mga09592_333937_c1 | nmdc:mga09592_333937_c1_496_1272 | 252 |
| 272 | 3300050509 | nmdc:mga0qj67_3538_c1 | nmdc:mga0qj67_3538_c1_2209_2985 | 252 |
| 273 | 3300050510 | nmdc:mga06r32_1358_c1 | nmdc:mga06r32_1358_c1_3482_4258 | 252 |
| 274 | 3300050510 | nmdc:mga06r32_415440_c1 | nmdc:mga06r32_415440_c1_291_1067 | 252 |
| 275 | 3300050511 | nmdc:mga08y16_21076_c1 | nmdc:mga08y16_21076_c1_201_977 | 252 |
| 276 | 3300053093 | Ga0500651_0105507 | Ga0500651_0105507_394_1179 | 252 |
| 277 | 3300053139 | Ga0500568_0000457 | Ga0500568_0000457_9942_10727 | 252 |
| 278 | 3300054114 | Ga0501084_0039566 | Ga0501084_0039566_2297_3082 | 252 |
| 279 | 3300054114 | Ga0501084_0056470 | Ga0501084_0056470_2319_3104 | 252 |
| 280 | 3300060353 | Ga0501082_0000792 | Ga0501082_0000792_9243_10028 | 252 |
| 281 | 3300060353 | Ga0501082_0225618 | Ga0501082_0225618_650_1435 | 252 |
| 282 | iso_pu_bacteria | 2585427687 | 2586209968 | 252 |
| 283 | iso_pu_bacteria | 2738541283 | 2738755039 | 252 |
| 284 | iso_pu_bacteria | 2738541284 | 2738760994 | 252 |
| 285 | iso_pu_bacteria | 2738541302 | 2738853212 | 252 |
| 286 | iso_pu_bacteria | 2738543023 | 2739301195 | 252 |
| 287 | iso_pu_bacteria | 2739367651 | 2739588774 | 252 |
| 288 | iso_pu_bacteria | 2739367656 | 2739616033 | 252 |
| 289 | iso_pu_bacteria | 2739367663 | 2739645193 | 252 |
| 290 | iso_pu_bacteria | 2775506987 | 2776613180 | 252 |
| 291 | iso_pu_bacteria | 2818991437 | 2819548762 | 252 |
| 292 | iso_pu_bacteria | 2842722452 | 2842726199 | 252 |
| 293 | iso_pu_bacteria | 2842909656 | 2842910443 | 252 |
| 294 | iso_pu_bacteria | 2849281842 | 2849282263 | 252 |
| 295 | iso_pu_bacteria | 2852627209 | 2852631328 | 252 |
| 296 | iso_pu_bacteria | 2857627736 | 2857629173 | 252 |
| 297 | iso_pu_bacteria | 2904445276 | 2904445596 | 252 |
| 298 | iso_pu_bacteria | 2919130084 | 2919130566 | 252 |
| 299 | iso_pu_bacteria | 2919186247 | 2919187231 | 252 |
| 300 | iso_pu_bacteria | 2929195423 | 2929198430 | 252 |
| 301 | iso_pu_bacteria | 2939664404 | 2939665500 | 252 |
| 302 | iso_pu_bacteria | 2945997725 | 2946000798 | 252 |
| 303 | iso_pu_bacteria | 2954016120 | 2954017668 | 252 |
| 304 | 3300003203 | JGI25406J46586_10010500 | JGI25406J46586_100105004 | 253 |
| 305 | 3300005937 | Ga0081455_10000043 | Ga0081455_1000004311 | 253 |
| 306 | 3300005985 | Ga0081539_10000046 | Ga0081539_100000467 | 253 |
| 307 | 3300009553 | Ga0105249_10026665 | Ga0105249_100266655 | 253 |
| 308 | 3300014969 | Ga0157376_10624471 | Ga0157376_106244711 | 253 |
| 309 | 3300028380 | Ga0268265_10146017 | Ga0268265_101460172 | 253 |
| 310 | 3300032004 | Ga0307414_10001246 | Ga0307414_100012461 | 253 |
| 311 | 3300032004 | Ga0307414_10031256 | Ga0307414_100312562 | 253 |
| 312 | 3300032004 | Ga0307414_10313940 | Ga0307414_103139401 | 253 |
| 313 | 3300044683 | Ga0466965_0121914 | Ga0466965_0121914_160_993 | 253 |
| 314 | 3300044712 | Ga0453684_0157621 | Ga0453684_0157621_558_1337 | 253 |
| 315 | 3300046458 | Ga0495591_019542 | Ga0495591_019542_1003_1794 | 253 |
| 316 | 3300046539 | Ga0495621_0000313 | Ga0495621_0000313_3760_4551 | 253 |
| 317 | 3300046691 | Ga0495670_0116873 | Ga0495670_0116873_504_1295 | 253 |
| 318 | 3300047318 | Ga0495636_0159765 | Ga0495636_0159765_76_861 | 253 |
| 319 | 3300049581 | Ga0501047_0676901 | Ga0501047_0676901_51_821 | 253 |
| 320 | 3300053092 | Ga0500583_0070489 | Ga0500583_0070489_419_1183 | 253 |
| 321 | 3300053096 | Ga0500641_0037149 | Ga0500641_0037149_147_911 | 253 |
| 322 | 3300053104 | Ga0500556_0065218 | Ga0500556_0065218_203_967 | 253 |
| 323 | 3300053124 | Ga0500617_012758 | Ga0500617_012758_380_1144 | 253 |
| 324 | 3300053134 | Ga0500658_0008694 | Ga0500658_0008694_540_1304 | 253 |
| 325 | 3300053146 | Ga0500588_0001244 | Ga0500588_0001244_168_932 | 253 |
| 326 | 3300053153 | Ga0500616_0000130 | Ga0500616_0000130_51765_52529 | 253 |
| 327 | 3300053732 | Ga0500656_008583 | Ga0500656_008583_60_824 | 253 |
| 328 | 3300005290 | Ga0065712_10069113 | Ga0065712_100691133 | 254 |
| 329 | 3300005330 | Ga0070690_100037213 | Ga0070690_1000372132 | 254 |
| 330 | 3300005331 | Ga0070670_100027911 | Ga0070670_1000279112 | 254 |
| 331 | 3300005331 | Ga0070670_100130960 | Ga0070670_1001309603 | 254 |
| 332 | 3300005331 | Ga0070670_100179312 | Ga0070670_1001793122 | 254 |
| 333 | 3300005333 | Ga0070677_10003138 | Ga0070677_100031384 | 254 |
| 334 | 3300005334 | Ga0068869_100086812 | Ga0068869_1000868122 | 254 |
| 335 | 3300005337 | Ga0070682_100009288 | Ga0070682_1000092883 | 254 |
| 336 | 3300005337 | Ga0070682_100042905 | Ga0070682_1000429053 | 254 |
| 337 | 3300005338 | Ga0068868_100181368 | Ga0068868_1001813682 | 254 |
| 338 | 3300005340 | Ga0070689_100046123 | Ga0070689_1000461233 | 254 |
| 339 | 3300005340 | Ga0070689_100056744 | Ga0070689_1000567444 | 254 |
| 340 | 3300005343 | Ga0070687_100009254 | Ga0070687_1000092545 | 254 |
| 341 | 3300005344 | Ga0070661_100010630 | Ga0070661_1000106301 | 254 |
| 342 | 3300005344 | Ga0070661_100160429 | Ga0070661_1001604293 | 254 |
| 343 | 3300005345 | Ga0070692_10050412 | Ga0070692_100504122 | 254 |
| 344 | 3300005347 | Ga0070668_100433186 | Ga0070668_1004331861 | 254 |
| 345 | 3300005353 | Ga0070669_100022350 | Ga0070669_1000223504 | 254 |
| 346 | 3300005354 | Ga0070675_100009725 | Ga0070675_1000097253 | 254 |
| 347 | 3300005354 | Ga0070675_100027806 | Ga0070675_1000278065 | 254 |
| 348 | 3300005354 | Ga0070675_100064599 | Ga0070675_1000645993 | 254 |
| 349 | 3300005355 | Ga0070671_100421029 | Ga0070671_1004210292 | 254 |
| 350 | 3300005356 | Ga0070674_100023152 | Ga0070674_1000231525 | 254 |
| 351 | 3300005356 | Ga0070674_100185658 | Ga0070674_1001856583 | 254 |
| 352 | 3300005364 | Ga0070673_100037601 | Ga0070673_1000376012 | 254 |
| 353 | 3300005364 | Ga0070673_100042111 | Ga0070673_1000421113 | 254 |
| 354 | 3300005364 | Ga0070673_100109531 | Ga0070673_1001095313 | 254 |
| 355 | 3300005364 | Ga0070673_100803477 | Ga0070673_1008034771 | 254 |
| 356 | 3300005365 | Ga0070688_100248477 | Ga0070688_1002484773 | 254 |
| 357 | 3300005438 | Ga0070701_10014880 | Ga0070701_100148803 | 254 |
| 358 | 3300005441 | Ga0070700_100024517 | Ga0070700_1000245172 | 254 |
| 359 | 3300005441 | Ga0070700_100127352 | Ga0070700_1001273522 | 254 |
| 360 | 3300005455 | Ga0070663_100082003 | Ga0070663_1000820033 | 254 |
| 361 | 3300005456 | Ga0070678_100011129 | Ga0070678_1000111293 | 254 |
| 362 | 3300005456 | Ga0070678_100031756 | Ga0070678_1000317562 | 254 |
| 363 | 3300005457 | Ga0070662_100341085 | Ga0070662_1003410852 | 254 |
| 364 | 3300005459 | Ga0068867_100323726 | Ga0068867_1003237263 | 254 |
| 365 | 3300005466 | Ga0070685_10046505 | Ga0070685_100465051 | 254 |
| 366 | 3300005466 | Ga0070685_10061020 | Ga0070685_100610202 | 254 |
| 367 | 3300005539 | Ga0068853_100687862 | Ga0068853_1006878621 | 254 |
| 368 | 3300005543 | Ga0070672_100052136 | Ga0070672_1000521364 | 254 |
| 369 | 3300005543 | Ga0070672_100053985 | Ga0070672_1000539852 | 254 |
| 370 | 3300005543 | Ga0070672_100070859 | Ga0070672_1000708593 | 254 |
| 371 | 3300005543 | Ga0070672_100472587 | Ga0070672_1004725872 | 254 |
| 372 | 3300005544 | Ga0070686_100024869 | Ga0070686_1000248693 | 254 |
| 373 | 3300005544 | Ga0070686_100152854 | Ga0070686_1001528542 | 254 |
| 374 | 3300005546 | Ga0070696_100060692 | Ga0070696_1000606923 | 254 |
| 375 | 3300005548 | Ga0070665_100002747 | Ga0070665_10000274719 | 254 |
| 376 | 3300005548 | Ga0070665_100004552 | Ga0070665_1000045522 | 254 |
| 377 | 3300005549 | Ga0070704_100113391 | Ga0070704_1001133913 | 254 |
| 378 | 3300005549 | Ga0070704_100593070 | Ga0070704_1005930702 | 254 |
| 379 | 3300005564 | Ga0070664_100003153 | Ga0070664_1000031531 | 254 |
| 380 | 3300005564 | Ga0070664_100419186 | Ga0070664_1004191862 | 254 |
| 381 | 3300005578 | Ga0068854_100470373 | Ga0068854_1004703732 | 254 |
| 382 | 3300005615 | Ga0070702_100006739 | Ga0070702_1000067394 | 254 |
| 383 | 3300005615 | Ga0070702_100024173 | Ga0070702_1000241733 | 254 |
| 384 | 3300005617 | Ga0068859_100014785 | Ga0068859_1000147858 | 254 |
| 385 | 3300005617 | Ga0068859_100175963 | Ga0068859_1001759633 | 254 |
| 386 | 3300005617 | Ga0068859_100346682 | Ga0068859_1003466822 | 254 |
| 387 | 3300005618 | Ga0068864_100002318 | Ga0068864_1000023183 | 254 |
| 388 | 3300005618 | Ga0068864_100056667 | Ga0068864_1000566674 | 254 |
| 389 | 3300005618 | Ga0068864_100099546 | Ga0068864_1000995463 | 254 |
| 390 | 3300005718 | Ga0068866_10053652 | Ga0068866_100536522 | 254 |
| 391 | 3300005719 | Ga0068861_100026187 | Ga0068861_1000261873 | 254 |
| 392 | 3300005719 | Ga0068861_100026857 | Ga0068861_1000268573 | 254 |
| 393 | 3300005719 | Ga0068861_100057256 | Ga0068861_1000572562 | 254 |
| 394 | 3300005719 | Ga0068861_100077237 | Ga0068861_1000772373 | 254 |
| 395 | 3300005719 | Ga0068861_100095243 | Ga0068861_1000952433 | 254 |
| 396 | 3300005834 | Ga0068851_10000471 | Ga0068851_100004717 | 254 |
| 397 | 3300005840 | Ga0068870_10006049 | Ga0068870_100060494 | 254 |
| 398 | 3300005840 | Ga0068870_10026226 | Ga0068870_100262262 | 254 |
| 399 | 3300005841 | Ga0068863_100000669 | Ga0068863_1000006693 | 254 |
| 400 | 3300005841 | Ga0068863_100480339 | Ga0068863_1004803392 | 254 |
| 401 | 3300005843 | Ga0068860_100040742 | Ga0068860_1000407423 | 254 |
| 402 | 3300005843 | Ga0068860_100071566 | Ga0068860_1000715663 | 254 |
| 403 | 3300005844 | Ga0068862_100009137 | Ga0068862_1000091373 | 254 |
| 404 | 3300005844 | Ga0068862_100012930 | Ga0068862_1000129304 | 254 |
| 405 | 3300005844 | Ga0068862_100018285 | Ga0068862_1000182854 | 254 |
| 406 | 3300005844 | Ga0068862_100412627 | Ga0068862_1004126272 | 254 |
| 407 | 3300006051 | Ga0075364_10187919 | Ga0075364_101879192 | 254 |
| 408 | 3300006237 | Ga0097621_100022710 | Ga0097621_1000227103 | 254 |
| 409 | 3300006237 | Ga0097621_100085538 | Ga0097621_1000855382 | 254 |
| 410 | 3300006358 | Ga0068871_100031521 | Ga0068871_1000315213 | 254 |
| 411 | 3300006844 | Ga0075428_100001451 | Ga0075428_1000014516 | 254 |
| 412 | 3300006846 | Ga0075430_100073376 | Ga0075430_1000733762 | 254 |
| 413 | 3300006847 | Ga0075431_100012402 | Ga0075431_1000124026 | 254 |
| 414 | 3300006852 | Ga0075433_10422960 | Ga0075433_104229602 | 254 |
| 415 | 3300006880 | Ga0075429_100010555 | Ga0075429_1000105556 | 254 |
| 416 | 3300006881 | Ga0068865_100051849 | Ga0068865_1000518493 | 254 |
| 417 | 3300006881 | Ga0068865_100090407 | Ga0068865_1000904073 | 254 |
| 418 | 3300006881 | Ga0068865_100268803 | Ga0068865_1002688032 | 254 |
| 419 | 3300006931 | Ga0097620_100014785 | Ga0097620_1000147858 | 254 |
| 420 | 3300006931 | Ga0097620_100175962 | Ga0097620_1001759623 | 254 |
| 421 | 3300006931 | Ga0097620_100346657 | Ga0097620_1003466572 | 254 |
| 422 | 3300009094 | Ga0111539_10004344 | Ga0111539_1000434416 | 254 |
| 423 | 3300009148 | Ga0105243_10104671 | Ga0105243_101046711 | 254 |
| 424 | 3300009148 | Ga0105243_10601043 | Ga0105243_106010432 | 254 |
| 425 | 3300009176 | Ga0105242_10159491 | Ga0105242_101594913 | 254 |
| 426 | 3300009177 | Ga0105248_10001157 | Ga0105248_1000115726 | 254 |
| 427 | 3300009177 | Ga0105248_10363459 | Ga0105248_103634592 | 254 |
| 428 | 3300009551 | Ga0105238_10382044 | Ga0105238_103820442 | 254 |
| 429 | 3300009553 | Ga0105249_10541710 | Ga0105249_105417102 | 254 |
| 430 | 3300013296 | Ga0157374_10418984 | Ga0157374_104189841 | 254 |
| 431 | 3300013296 | Ga0157374_10594519 | Ga0157374_105945191 | 254 |
| 432 | 3300013297 | Ga0157378_10056295 | Ga0157378_100562952 | 254 |
| 433 | 3300013306 | Ga0163162_10087883 | Ga0163162_100878835 | 254 |
| 434 | 3300013306 | Ga0163162_10211503 | Ga0163162_102115033 | 254 |
| 435 | 3300013308 | Ga0157375_10017828 | Ga0157375_100178283 | 254 |
| 436 | 3300013308 | Ga0157375_10094562 | Ga0157375_100945623 | 254 |
| 437 | 3300013308 | Ga0157375_10335280 | Ga0157375_103352803 | 254 |
| 438 | 3300013308 | Ga0157375_10539916 | Ga0157375_105399162 | 254 |
| 439 | 3300014325 | Ga0163163_10017551 | Ga0163163_100175517 | 254 |
| 440 | 3300014325 | Ga0163163_10024275 | Ga0163163_100242754 | 254 |
| 441 | 3300014326 | Ga0157380_10002823 | Ga0157380_100028232 | 254 |
| 442 | 3300014326 | Ga0157380_10013438 | Ga0157380_100134385 | 254 |
| 443 | 3300014326 | Ga0157380_10335501 | Ga0157380_103355012 | 254 |
| 444 | 3300014745 | Ga0157377_10250591 | Ga0157377_102505911 | 254 |
| 445 | 3300014969 | Ga0157376_10354312 | Ga0157376_103543123 | 254 |
| 446 | 3300014969 | Ga0157376_10485344 | Ga0157376_104853441 | 254 |
| 447 | 3300014969 | Ga0157376_10939444 | Ga0157376_109394441 | 254 |
| 448 | 3300017792 | Ga0163161_10058043 | Ga0163161_100580432 | 254 |
| 449 | 3300017792 | Ga0163161_10067352 | Ga0163161_100673523 | 254 |
| 450 | 3300017792 | Ga0163161_10391346 | Ga0163161_103913461 | 254 |
| 451 | 3300025893 | Ga0207682_10004828 | Ga0207682_100048283 | 254 |
| 452 | 3300025893 | Ga0207682_10006865 | Ga0207682_100068654 | 254 |
| 453 | 3300025898 | Ga0207692_10090477 | Ga0207692_100904773 | 254 |
| 454 | 3300025899 | Ga0207642_10162314 | Ga0207642_101623142 | 254 |
| 455 | 3300025901 | Ga0207688_10048537 | Ga0207688_100485372 | 254 |
| 456 | 3300025907 | Ga0207645_10008140 | Ga0207645_100081403 | 254 |
| 457 | 3300025908 | Ga0207643_10002859 | Ga0207643_100028595 | 254 |
| 458 | 3300025908 | Ga0207643_10261330 | Ga0207643_102613301 | 254 |
| 459 | 3300025916 | Ga0207663_10069550 | Ga0207663_100695503 | 254 |
| 460 | 3300025918 | Ga0207662_10015156 | Ga0207662_100151565 | 254 |
| 461 | 3300025920 | Ga0207649_10132809 | Ga0207649_101328092 | 254 |
| 462 | 3300025923 | Ga0207681_10035952 | Ga0207681_100359523 | 254 |
| 463 | 3300025923 | Ga0207681_10210126 | Ga0207681_102101262 | 254 |
| 464 | 3300025925 | Ga0207650_10143539 | Ga0207650_101435393 | 254 |
| 465 | 3300025925 | Ga0207650_10207340 | Ga0207650_102073402 | 254 |
| 466 | 3300025926 | Ga0207659_10012387 | Ga0207659_100123872 | 254 |
| 467 | 3300025926 | Ga0207659_10030591 | Ga0207659_100305912 | 254 |
| 468 | 3300025926 | Ga0207659_10469336 | Ga0207659_104693362 | 254 |
| 469 | 3300025926 | Ga0207659_10568502 | Ga0207659_105685022 | 254 |
| 470 | 3300025931 | Ga0207644_10124880 | Ga0207644_101248802 | 254 |
| 471 | 3300025933 | Ga0207706_10074555 | Ga0207706_100745552 | 254 |
| 472 | 3300025936 | Ga0207670_10047124 | Ga0207670_100471243 | 254 |
| 473 | 3300025936 | Ga0207670_10220934 | Ga0207670_102209341 | 254 |
| 474 | 3300025937 | Ga0207669_10010796 | Ga0207669_100107962 | 254 |
| 475 | 3300025937 | Ga0207669_10078323 | Ga0207669_100783232 | 254 |
| 476 | 3300025938 | Ga0207704_10141413 | Ga0207704_101414133 | 254 |
| 477 | 3300025938 | Ga0207704_10215131 | Ga0207704_102151312 | 254 |
| 478 | 3300025938 | Ga0207704_10348264 | Ga0207704_103482641 | 254 |
| 479 | 3300025940 | Ga0207691_10013086 | Ga0207691_100130864 | 254 |
| 480 | 3300025940 | Ga0207691_10065138 | Ga0207691_100651384 | 254 |
| 481 | 3300025940 | Ga0207691_10110205 | Ga0207691_101102054 | 254 |
| 482 | 3300025941 | Ga0207711_10006071 | Ga0207711_100060712 | 254 |
| 483 | 3300025942 | Ga0207689_10065958 | Ga0207689_100659583 | 254 |
| 484 | 3300025942 | Ga0207689_10119636 | Ga0207689_101196363 | 254 |
| 485 | 3300025945 | Ga0207679_10001705 | Ga0207679_100017053 | 254 |
| 486 | 3300025960 | Ga0207651_10017784 | Ga0207651_100177841 | 254 |
| 487 | 3300025960 | Ga0207651_10078569 | Ga0207651_100785693 | 254 |
| 488 | 3300025972 | Ga0207668_10523839 | Ga0207668_105238391 | 254 |
| 489 | 3300025986 | Ga0207658_10620593 | Ga0207658_106205932 | 254 |
| 490 | 3300026023 | Ga0207677_10085585 | Ga0207677_100855854 | 254 |
| 491 | 3300026035 | Ga0207703_10237675 | Ga0207703_102376752 | 254 |
| 492 | 3300026041 | Ga0207639_10633149 | Ga0207639_106331492 | 254 |
| 493 | 3300026075 | Ga0207708_10023307 | Ga0207708_100233074 | 254 |
| 494 | 3300026075 | Ga0207708_10045928 | Ga0207708_100459283 | 254 |
| 495 | 3300026075 | Ga0207708_10172081 | Ga0207708_101720813 | 254 |
| 496 | 3300026088 | Ga0207641_10463971 | Ga0207641_104639711 | 254 |
| 497 | 3300026088 | Ga0207641_10813312 | Ga0207641_108133121 | 254 |
| 498 | 3300026089 | Ga0207648_10023400 | Ga0207648_100234004 | 254 |
| 499 | 3300026089 | Ga0207648_10027409 | Ga0207648_100274096 | 254 |
| 500 | 3300026089 | Ga0207648_10308645 | Ga0207648_103086452 | 254 |
| 501 | 3300026089 | Ga0207648_10331072 | Ga0207648_103310722 | 254 |
| 502 | 3300026095 | Ga0207676_10048097 | Ga0207676_100480973 | 254 |
| 503 | 3300026095 | Ga0207676_10537228 | Ga0207676_105372282 | 254 |
| 504 | 3300026118 | Ga0207675_100024041 | Ga0207675_1000240413 | 254 |
| 505 | 3300026118 | Ga0207675_100042940 | Ga0207675_1000429403 | 254 |
| 506 | 3300026118 | Ga0207675_100054162 | Ga0207675_1000541621 | 254 |
| 507 | 3300026118 | Ga0207675_100121874 | Ga0207675_1001218743 | 254 |
| 508 | 3300026118 | Ga0207675_100138649 | Ga0207675_1001386492 | 254 |
| 509 | 3300026121 | Ga0207683_10038587 | Ga0207683_100385873 | 254 |
| 510 | 3300026121 | Ga0207683_10053089 | Ga0207683_100530893 | 254 |
| 511 | 3300027252 | Ga0209973_1011888 | Ga0209973_10118881 | 254 |
| 512 | 3300027543 | Ga0209999_1012934 | Ga0209999_10129342 | 254 |
| 513 | 3300027907 | Ga0207428_10034755 | Ga0207428_100347552 | 254 |
| 514 | 3300028379 | Ga0268266_10024293 | Ga0268266_100242932 | 254 |
| 515 | 3300028379 | Ga0268266_10034734 | Ga0268266_100347343 | 254 |
| 516 | 3300028380 | Ga0268265_10004326 | Ga0268265_100043263 | 254 |
| 517 | 3300028380 | Ga0268265_10007113 | Ga0268265_100071136 | 254 |
| 518 | 3300028380 | Ga0268265_10014927 | Ga0268265_100149272 | 254 |
| 519 | 3300028380 | Ga0268265_10167959 | Ga0268265_101679592 | 254 |
| 520 | 3300028380 | Ga0268265_10638154 | Ga0268265_106381542 | 254 |
| 521 | 3300028794 | Ga0307515_10362363 | Ga0307515_103623631 | 254 |
| 522 | 3300031456 | Ga0307513_10007437 | Ga0307513_100074373 | 254 |
| 523 | 3300031456 | Ga0307513_10018327 | Ga0307513_100183274 | 254 |
| 524 | 3300031548 | Ga0307408_100294398 | Ga0307408_1002943981 | 254 |
| 525 | 3300031824 | Ga0307413_10007747 | Ga0307413_100077472 | 254 |
| 526 | 3300031824 | Ga0307413_10133035 | Ga0307413_101330352 | 254 |
| 527 | 3300031852 | Ga0307410_10033919 | Ga0307410_100339192 | 254 |
| 528 | 3300031901 | Ga0307406_10006309 | Ga0307406_100063092 | 254 |
| 529 | 3300031995 | Ga0307409_100032279 | Ga0307409_1000322794 | 254 |
| 530 | 3300032002 | Ga0307416_100109376 | Ga0307416_1001093763 | 254 |
| 531 | 3300032002 | Ga0307416_100219624 | Ga0307416_1002196242 | 254 |
| 532 | 3300032004 | Ga0307414_10293009 | Ga0307414_102930092 | 254 |
| 533 | 3300032005 | Ga0307411_10040215 | Ga0307411_100402152 | 254 |
| 534 | 3300032126 | Ga0307415_100028253 | Ga0307415_1000282532 | 254 |
| 535 | 3300035172 | Ga0373955_0148008 | Ga0373955_0148008_508_1275 | 254 |
| 536 | 3300035691 | Ga0373931_0161963 | Ga0373931_0161963_174_989 | 254 |
| 537 | 3300041451 | Ga0451791_0832387 | Ga0451791_0832387_1268_2035 | 254 |
| 538 | 3300041460 | Ga0451802_1227194 | Ga0451802_1227194_40_858 | 254 |
| 539 | 3300041486 | Ga0451807_1278395 | Ga0451807_1278395_614_1432 | 254 |
| 540 | 3300046457 | Ga0495590_0003508 | Ga0495590_0003508_5430_6197 | 254 |
| 541 | 3300046460 | Ga0495638_0046248 | Ga0495638_0046248_463_1230 | 254 |
| 542 | 3300046471 | Ga0495650_0011525 | Ga0495650_0011525_3045_3863 | 254 |
| 543 | 3300046471 | Ga0495650_0108552 | Ga0495650_0108552_59_829 | 254 |
| 544 | 3300046513 | Ga0495616_0001490 | Ga0495616_0001490_8494_9261 | 254 |
| 545 | 3300046615 | Ga0495656_0095444 | Ga0495656_0095444_237_1004 | 254 |
| 546 | 3300046660 | Ga0495625_0032579 | Ga0495625_0032579_2682_3449 | 254 |
| 547 | 3300046660 | Ga0495625_0063084 | Ga0495625_0063084_886_1695 | 254 |
| 548 | 3300046694 | Ga0495649_0023307 | Ga0495649_0023307_1643_2410 | 254 |
| 549 | 3300046694 | Ga0495649_0063443 | Ga0495649_0063443_1047_1814 | 254 |
| 550 | 3300046694 | Ga0495649_0217454 | Ga0495649_0217454_74_841 | 254 |
| 551 | 3300048907 | Ga0496104_0289977 | Ga0496104_0289977_702_1517 | 254 |
| 552 | 3300048915 | Ga0496112_0073419 | Ga0496112_0073419_48_863 | 254 |
| 553 | 3300049570 | Ga0501033_0022293 | Ga0501033_0022293_3626_4435 | 254 |
| 554 | 3300049573 | Ga0501037_0206052 | Ga0501037_0206052_334_1143 | 254 |
| 555 | 3300049574 | Ga0501038_0014963 | Ga0501038_0014963_3606_4415 | 254 |
| 556 | 3300049579 | Ga0501043_0148018 | Ga0501043_0148018_573_1382 | 254 |
| 557 | 3300049584 | Ga0501068_0002289 | Ga0501068_0002289_2880_3647 | 254 |
| 558 | 3300049586 | Ga0501070_0010032 | Ga0501070_0010032_6421_7188 | 254 |
| 559 | 3300049587 | Ga0501071_0006079 | Ga0501071_0006079_1525_2292 | 254 |
| 560 | 3300049588 | Ga0501072_0045113 | Ga0501072_0045113_45_812 | 254 |
| 561 | 3300049589 | Ga0501073_0031708 | Ga0501073_0031708_2989_3756 | 254 |
| 562 | 3300049590 | Ga0501074_0000122 | Ga0501074_0000122_4553_5320 | 254 |
| 563 | 3300049592 | Ga0501076_0003260 | Ga0501076_0003260_7738_8505 | 254 |
| 564 | 3300049593 | Ga0501077_0012335 | Ga0501077_0012335_2328_3095 | 254 |
| 565 | 3300049742 | Ga0501080_0009990 | Ga0501080_0009990_5149_5916 | 254 |
| 566 | 3300049744 | Ga0501083_0021903 | Ga0501083_0021903_1487_2254 | 254 |
| 567 | 3300049822 | Ga0501035_0070638 | Ga0501035_0070638_1042_1851 | 254 |
| 568 | 3300049823 | Ga0501044_0368423 | Ga0501044_0368423_419_1228 | 254 |
| 569 | 3300050508 | nmdc:mga09592_3569_c1 | nmdc:mga09592_3569_c1_914_1708 | 254 |
| 570 | 3300050509 | nmdc:mga0qj67_306244_c1 | nmdc:mga0qj67_306244_c1_373_1167 | 254 |
| 571 | 3300050510 | nmdc:mga06r32_29_c1 | nmdc:mga06r32_29_c1_3371_4165 | 254 |
| 572 | 3300050511 | nmdc:mga08y16_1085_c1 | nmdc:mga08y16_1085_c1_17345_18139 | 254 |
| 573 | 3300050511 | nmdc:mga08y16_620164_c1 | nmdc:mga08y16_620164_c1_62_829 | 254 |
| 574 | 3300053156 | Ga0500622_0002376 | Ga0500622_0002376_1693_2544 | 254 |
| 575 | 3300053156 | Ga0500622_0021105 | Ga0500622_0021105_1136_1987 | 254 |
| 576 | 3300054114 | Ga0501084_0071684 | Ga0501084_0071684_1020_1787 | 254 |
| 577 | 3300060353 | Ga0501082_0006985 | Ga0501082_0006985_2627_3394 | 254 |
| 578 | 3300061734 | Ga0530510_0081160 | Ga0530510_0081160_218_985 | 254 |
| 579 | 3300005288 | Ga0065714_10072134 | Ga0065714_100721342 | 255 |
| 580 | 3300032004 | Ga0307414_10000722 | Ga0307414_1000072215 | 255 |
| 581 | 3300044712 | Ga0453684_0339806 | Ga0453684_0339806_468_1241 | 255 |
| 582 | 2162886007 | SwRhRL2b_contig_493616 | SwRhRL2b_0792.00006030 | 256 |
| 583 | 3300002773 | JGI25152J39213_1000056 | JGI25152J39213_100005650 | 256 |
| 584 | 3300002774 | JGI25150J39212_1000009 | JGI25150J39212_100000918 | 256 |
| 585 | 3300003187 | JGI25151J46595_10000017 | JGI25151J46595_1000001718 | 256 |
| 586 | 3300003215 | JGI25153J46596_10000023 | JGI25153J46596_10000023219 | 256 |
| 587 | 3300003323 | rootH1_10197067 | rootH1_101970673 | 256 |
| 588 | 3300003781 | Ga0055536_1000030 | Ga0055536_1000030106 | 256 |
| 589 | 3300003791 | Ga0055530_10002863 | Ga0055530_100028633 | 256 |
| 590 | 3300005288 | Ga0065714_10002192 | Ga0065714_1000219232 | 256 |
| 591 | 3300005288 | Ga0065714_10003657 | Ga0065714_1000365714 | 256 |
| 592 | 3300005288 | Ga0065714_10008213 | Ga0065714_100082133 | 256 |
| 593 | 3300005288 | Ga0065714_10064664 | Ga0065714_1006466412 | 256 |
| 594 | 3300005288 | Ga0065714_10064897 | Ga0065714_100648976 | 256 |
| 595 | 3300005289 | Ga0065704_10000193 | Ga0065704_1000019360 | 256 |
| 596 | 3300005289 | Ga0065704_10088158 | Ga0065704_100881582 | 256 |
| 597 | 3300009036 | Ga0105244_10051457 | Ga0105244_100514572 | 256 |
| 598 | 3300009545 | Ga0105237_10034815 | Ga0105237_100348155 | 256 |
| 599 | 3300013100 | Ga0157373_10000136 | Ga0157373_1000013612 | 256 |
| 600 | 3300013100 | Ga0157373_10005081 | Ga0157373_100050819 | 256 |
| 601 | 3300013100 | Ga0157373_10016193 | Ga0157373_100161938 | 256 |
| 602 | 3300013100 | Ga0157373_10138343 | Ga0157373_101383432 | 256 |
| 603 | 3300013102 | Ga0157371_10000034 | Ga0157371_1000003416 | 256 |
| 604 | 3300013102 | Ga0157371_10003233 | Ga0157371_100032336 | 256 |
| 605 | 3300013102 | Ga0157371_10008786 | Ga0157371_100087865 | 256 |
| 606 | 3300013102 | Ga0157371_10017967 | Ga0157371_100179675 | 256 |
| 607 | 3300013104 | Ga0157370_10003221 | Ga0157370_100032214 | 256 |
| 608 | 3300013104 | Ga0157370_10005022 | Ga0157370_100050229 | 256 |
| 609 | 3300013104 | Ga0157370_10008391 | Ga0157370_1000839110 | 256 |
| 610 | 3300013104 | Ga0157370_10020179 | Ga0157370_100201791 | 256 |
| 611 | 3300013104 | Ga0157370_10053620 | Ga0157370_100536204 | 256 |
| 612 | 3300013104 | Ga0157370_10080579 | Ga0157370_100805793 | 256 |
| 613 | 3300013104 | Ga0157370_10113186 | Ga0157370_101131862 | 256 |
| 614 | 3300013104 | Ga0157370_10265454 | Ga0157370_102654542 | 256 |
| 615 | 3300013104 | Ga0157370_10273953 | Ga0157370_102739532 | 256 |
| 616 | 3300013105 | Ga0157369_10000002 | Ga0157369_10000002275 | 256 |
| 617 | 3300013105 | Ga0157369_10030662 | Ga0157369_100306624 | 256 |
| 618 | 3300013306 | Ga0163162_10121857 | Ga0163162_101218572 | 256 |
| 619 | 3300014497 | Ga0182008_10000018 | Ga0182008_10000018141 | 256 |
| 620 | 3300014497 | Ga0182008_10000524 | Ga0182008_100005249 | 256 |
| 621 | 3300014497 | Ga0182008_10001182 | Ga0182008_100011826 | 256 |
| 622 | 3300015261 | Ga0182006_1000382 | Ga0182006_100038228 | 256 |
| 623 | 3300015261 | Ga0182006_1002866 | Ga0182006_10028667 | 256 |
| 624 | 3300015261 | Ga0182006_1007137 | Ga0182006_10071374 | 256 |
| 625 | 3300015262 | Ga0182007_10000001 | Ga0182007_10000001496 | 256 |
| 626 | 3300015682 | Ga0183373_1010 | Ga0183373_1010160 | 256 |
| 627 | 3300017792 | Ga0163161_10000153 | Ga0163161_1000015347 | 256 |
| 628 | 3300017792 | Ga0163161_10000211 | Ga0163161_1000021142 | 256 |
| 629 | 3300017792 | Ga0163161_10000218 | Ga0163161_1000021814 | 256 |
| 630 | 3300017792 | Ga0163161_10001606 | Ga0163161_100016066 | 256 |
| 631 | 3300017792 | Ga0163161_10034090 | Ga0163161_100340902 | 256 |
| 632 | 3300017792 | Ga0163161_10490799 | Ga0163161_104907991 | 256 |
| 633 | 3300025245 | Ga0207425_1000007 | Ga0207425_1000007535 | 256 |
| 634 | 3300025258 | Ga0209129_1000006 | Ga0209129_1000006535 | 256 |
| 635 | 3300025292 | Ga0209676_1000001 | Ga0209676_1000001992 | 256 |
| 636 | 3300025294 | Ga0209025_1000025 | Ga0209025_1000025365 | 256 |
| 637 | 3300025297 | Ga0209758_1000016 | Ga0209758_1000016535 | 256 |
| 638 | 3300025298 | Ga0209050_1000018 | Ga0209050_1000018591 | 256 |
| 639 | 3300025914 | Ga0207671_10020108 | Ga0207671_100201082 | 256 |
| 640 | 3300028794 | Ga0307515_10051252 | Ga0307515_100512525 | 256 |
| 641 | 3300030744 | Ga0316181_1173906 | Ga0316181_11739061 | 256 |
| 642 | 3300031731 | Ga0307405_10000046 | Ga0307405_1000004639 | 256 |
| 643 | 3300031903 | Ga0307407_10000090 | Ga0307407_1000009026 | 256 |
| 644 | 3300031911 | Ga0307412_10000077 | Ga0307412_1000007729 | 256 |
| 645 | 3300031911 | Ga0307412_10550802 | Ga0307412_105508021 | 256 |
| 646 | 3300031995 | Ga0307409_100036344 | Ga0307409_1000363445 | 256 |
| 647 | 3300032002 | Ga0307416_100000195 | Ga0307416_10000019525 | 256 |
| 648 | 3300032004 | Ga0307414_10001142 | Ga0307414_100011421 | 256 |
| 649 | 3300032004 | Ga0307414_10006868 | Ga0307414_100068684 | 256 |
| 650 | 3300032004 | Ga0307414_10009803 | Ga0307414_100098032 | 256 |
| 651 | 3300046507 | Ga0495606_0252855 | Ga0495606_0252855_190_960 | 256 |
| 652 | 3300046512 | Ga0495610_0000126 | Ga0495610_0000126_67747_68517 | 256 |
| 653 | 3300046512 | Ga0495610_0001202 | Ga0495610_0001202_2808_3578 | 256 |
| 654 | 3300046538 | Ga0495609_0012187 | Ga0495609_0012187_3163_3933 | 256 |
| 655 | 3300048925 | Ga0496122_0000746 | Ga0496122_0000746_2306_3076 | 256 |
| 656 | 3300048928 | Ga0496125_0022164 | Ga0496125_0022164_240_1010 | 256 |
| 657 | 3300049571 | Ga0501034_0069399 | Ga0501034_0069399_2353_3138 | 256 |
| 658 | 3300049758 | Ga0501241_001635 | Ga0501241_001635_993_1763 | 256 |
| 659 | 3300049758 | Ga0501241_010730 | Ga0501241_010730_576_1346 | 256 |
| 660 | 3300053093 | Ga0500651_0000127 | Ga0500651_0000127_46224_46994 | 256 |
| 661 | iso_pu_bacteria | 2902048731 | 2902051780 | 256 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7v2c-assembly1.cif.gz_V | active state complex i from q10 dataset | 0.5098 | 72 | 231 |
| 5kc4-assembly1.cif.gz_A | structure of tmribu, orthorhombic crystal form | 0.4903 | 8 | 235 |
| 5kc4-assembly1.cif.gz_A | structure of tmribu, orthorhombic crystal form | 0.4837 | 8 | 235 |
| 6zkb-assembly1.cif.gz_V | membrane domain of closed complex i during turnover | 0.4675 | 73 | 231 |
| 7v2c-assembly1.cif.gz_V | active state complex i from q10 dataset | 0.4604 | 72 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYK0_57_218_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.824 | 59 | 232 | 1.10.1760.20 |
| af_Q2FYK0_57_218_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8151 | 59 | 232 | 1.10.1760.20 |
| af_A4HUL3_67_268_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.6764 | 136 | 244 | 1.50.40.10 |
| af_K7N2M1_4_109_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.5377 | 136 | 223 | 1.20.1080.10 |
| af_Q5JJW1_207_373_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.5221 | 128 | 256 | 1.50.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A829YMQ2-F1-model_v4 | Probable queuosine precursor transporter (Q precursor transporter) | 0.9566 | 4 | 253 |
GO:0005886
GO:0022857 GO:1990397 |
| AF-A0A6G7ZU14-F1-model_v4 | Probable queuosine precursor transporter (Q precursor transporter) | 0.938 | 4 | 256 |
GO:0005886
GO:0022857 GO:1990397 |
| AF-A0A537KNF1-F1-model_v4 | Queuosine precursor transporter | 0.929 | 4 | 155 |
GO:0016020
GO:1990397 |
| AF-A0A521WBU0-F1-model_v4 | Probable queuosine precursor transporter (Q precursor transporter) | 0.9286 | 5 | 253 |
GO:0005886
GO:0022857 GO:1990397 |
| AF-A0A7X7JWI0-F1-model_v4 | Queuosine precursor transporter | 0.9265 | 13 | 196 |
GO:0016020
GO:1990397 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar