F473399

General Info

Members Datasets Scaffolds Average Seq Length
661 322 633 259

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10363459|Ga0105248_103634592
Length 302
Sequence MWQCDPFAVSRGVSDLEQFRCQFFVPMAYHRATRGTHMTAKSATTIEATHPVSRGEKLFLVLSGFFIANAIIAEFIGVKIFALEDTLGIAPLNWNLFGQTGSLNFTAGVLLWPVVFIMTDVINEYFGRKGVRMISWLAVALIVYAYLFAYITIHLAPASWWVGAGKNQGVDNLQTAFAAIFGQGLWTIGGSITAFILGQLIDVSIFHAIRNRTGERHIWLRATGSTLVSQFIDSFVVLYIAFVIGPQHWSIPLFLAVGSVNYIYKFIAAIVLTPLIYAARRGLDTYLGREQSEALKARAAEQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541284 Pedobacter sp. YR016 Isolate Unclassified
7 2738541302 Pedobacter sp. CF074 Isolate Unclassified
8 2738543023 Pedobacter sp. OK628 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2739367656 Pedobacter sp. CF523 Isolate Unclassified
11 2739367663 Pedobacter sp. YR510 Isolate Unclassified
12 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
13 2818991437 Pedobacter terrae 518 Isolate Unclassified
14 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
15 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
16 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
17 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
18 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
19 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
20 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
21 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
22 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
23 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
24 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
25 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
26 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
27 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
28 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
29 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
30 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
31 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
120 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
142 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
203 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
223 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
224 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
225 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
226 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
227 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
228 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
229 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
230 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
231 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
232 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
233 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
234 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
240 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
247 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
292 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
296 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
307 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
308 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
309 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
310 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
311 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
312 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
313 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
314 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
315 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
316 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
317 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
318 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
319 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.46
Metatranscriptomes 0.3
Isolates 4.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.9
Nodule 0
Rhizoplane 2.27
Rhizosphere 86.84
Stem 0
Stem Tuber 0
Unclassified 4.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_493616 2162886007 Bacteria 15810
2 JGI25152J39213_1000018 3300002773 Bacteria 109715
3 JGI25152J39213_1000056 3300002773 Bacteria 75516
4 JGI25150J39212_1000009 3300002774 Bacteria 249509
5 JGI25150J39212_1000159 3300002774 Bacteria 38345
6 JGI25151J46595_10000017 3300003187 Bacteria 249509
7 JGI25151J46595_10000111 3300003187 Bacteria 111802
8 JGI25406J46586_10010500 3300003203 Bacteria 4107
9 JGI25153J46596_10000023 3300003215 Bacteria 249509
10 JGI25153J46596_10000085 3300003215 Bacteria 111802
11 rootH1_10007102 3300003316 Bacteria 23916
12 rootL2_10078753 3300003322 Bacteria 6474
13 rootL2_10104587 3300003322 Bacteria 9038
14 rootL2_10115706 3300003322 Bacteria 22521
15 rootH1_10005821 3300003323 Bacteria 129122
16 rootH1_10197067 3300003323 Bacteria 3767
17 Ga0055536_1000030 3300003781 Bacteria 153926
18 Ga0055530_10002863 3300003791 Bacteria 10516
19 Ga0065714_10002192 3300005288 Bacteria 92967
20 Ga0065714_10003657 3300005288 Bacteria 30790
21 Ga0065714_10008213 3300005288 Bacteria 6299
22 Ga0065714_10064664 3300005288 Bacteria 25064
23 Ga0065714_10064897 3300005288 Bacteria 15960
24 Ga0065714_10072134 3300005288 Bacteria 3425
25 Ga0065704_10000193 3300005289 Bacteria 203271
26 Ga0065704_10088158 3300005289 Bacteria 2962
27 Ga0065712_10069113 3300005290 Bacteria 7999
28 Ga0070690_100037213 3300005330 Bacteria 3066
29 Ga0070670_100027911 3300005331 Bacteria 4857
30 Ga0070670_100048722 3300005331 Bacteria 3645
31 Ga0070670_100116787 3300005331 Bacteria 2301
32 Ga0070670_100130960 3300005331 Bacteria 2166
33 Ga0070670_100179312 3300005331 Bacteria 1839
34 Ga0070677_10003138 3300005333 Bacteria 5311
35 Ga0068869_100086812 3300005334 Bacteria 2346
36 Ga0070682_100009288 3300005337 Bacteria 5565
37 Ga0070682_100042905 3300005337 Bacteria 2795
38 Ga0070682_100406652 3300005337 Bacteria 1031
39 Ga0068868_100181368 3300005338 Bacteria 1747
40 Ga0068868_100289660 3300005338 Bacteria 1388
41 Ga0070689_100046123 3300005340 Bacteria 3357
42 Ga0070689_100056744 3300005340 Bacteria 3037
43 Ga0070687_100009254 3300005343 Bacteria 4213
44 Ga0070661_100010630 3300005344 Bacteria 6405
45 Ga0070661_100160429 3300005344 Bacteria 1703
46 Ga0070692_10050412 3300005345 Bacteria 2162
47 Ga0070668_100021125 3300005347 Bacteria 4921
48 Ga0070668_100433186 3300005347 Bacteria 1127
49 Ga0070669_100022350 3300005353 Bacteria 4521
50 Ga0070669_100081104 3300005353 Bacteria 2416
51 Ga0070675_100009725 3300005354 Bacteria 7491
52 Ga0070675_100027806 3300005354 Bacteria 4547
53 Ga0070675_100064599 3300005354 Bacteria 3026
54 Ga0070671_100107212 3300005355 Bacteria 2346
55 Ga0070671_100353988 3300005355 Bacteria 1253
56 Ga0070671_100421029 3300005355 Bacteria 1144
57 Ga0070674_100023152 3300005356 Bacteria 4015
58 Ga0070674_100079456 3300005356 Bacteria 2340
59 Ga0070674_100185658 3300005356 Bacteria 1596
60 Ga0070673_100037601 3300005364 Bacteria 3689
61 Ga0070673_100042111 3300005364 Bacteria 3518
62 Ga0070673_100109531 3300005364 Bacteria 2288
63 Ga0070673_100803477 3300005364 Bacteria 869
64 Ga0070688_100248477 3300005365 Bacteria 1265
65 Ga0070667_100002844 3300005367 Bacteria 14938
66 Ga0070667_100021422 3300005367 Bacteria 5367
67 Ga0070667_100106926 3300005367 Bacteria 2422
68 Ga0070667_100682330 3300005367 Bacteria 950
69 Ga0070710_10024018 3300005437 Bacteria 3211
70 Ga0070701_10014880 3300005438 Bacteria 3577
71 Ga0070711_100031580 3300005439 Bacteria 3517
72 Ga0070705_100092474 3300005440 Bacteria 1888
73 Ga0070700_100024517 3300005441 Bacteria 3543
74 Ga0070700_100127352 3300005441 Bacteria 1714
75 Ga0070700_100602779 3300005441 Bacteria 861
76 Ga0070694_100078342 3300005444 Bacteria 2292
77 Ga0070663_100082003 3300005455 Bacteria 2372
78 Ga0070678_100011129 3300005456 Bacteria 5535
79 Ga0070678_100031756 3300005456 Bacteria 3648
80 Ga0070662_100003547 3300005457 Bacteria 9730
81 Ga0070662_100341085 3300005457 Bacteria 1226
82 Ga0068867_100323726 3300005459 Bacteria 1278
83 Ga0070685_10046505 3300005466 Bacteria 2491
84 Ga0070685_10061020 3300005466 Bacteria 2207
85 Ga0070685_10212982 3300005466 Bacteria 1262
86 Ga0068853_100136187 3300005539 Bacteria 2202
87 Ga0068853_100312672 3300005539 Bacteria 1455
88 Ga0068853_100687862 3300005539 Bacteria 975
89 Ga0070672_100039511 3300005543 Bacteria 3615
90 Ga0070672_100052136 3300005543 Bacteria 3193
91 Ga0070672_100053985 3300005543 Bacteria 3144
92 Ga0070672_100070859 3300005543 Bacteria 2771
93 Ga0070672_100472587 3300005543 Bacteria 1082
94 Ga0070686_100024869 3300005544 Bacteria 3594
95 Ga0070686_100152854 3300005544 Bacteria 1618
96 Ga0070695_100221314 3300005545 Unclassified 1364
97 Ga0070696_100060692 3300005546 Bacteria 2644
98 Ga0070665_100000077 3300005548 Bacteria 188308
99 Ga0070665_100002747 3300005548 Bacteria 19072
100 Ga0070665_100004552 3300005548 Bacteria 14531
101 Ga0070665_100045417 3300005548 Bacteria 4412
102 Ga0070665_100187310 3300005548 Bacteria 2070
103 Ga0070665_100461321 3300005548 Bacteria 1280
104 Ga0070704_100113391 3300005549 Bacteria 2067
105 Ga0070704_100593070 3300005549 Bacteria 973
106 Ga0068855_100591419 3300005563 Bacteria 1198
107 Ga0070664_100003153 3300005564 Bacteria 13328
108 Ga0070664_100419186 3300005564 Bacteria 1226
109 Ga0068854_100470373 3300005578 Bacteria 1053
110 Ga0068856_100031658 3300005614 Bacteria 5176
111 Ga0070702_100006739 3300005615 Bacteria 5459
112 Ga0070702_100024173 3300005615 Bacteria 3237
113 Ga0068852_100241101 3300005616 Bacteria 1728
114 Ga0068859_100001149 3300005617 Bacteria 26992
115 Ga0068859_100014785 3300005617 Bacteria 7841
116 Ga0068859_100175963 3300005617 Bacteria 2221
117 Ga0068859_100346682 3300005617 Bacteria 1580
118 Ga0068864_100002318 3300005618 Bacteria 15746
119 Ga0068864_100020929 3300005618 Bacteria 5475
120 Ga0068864_100056667 3300005618 Bacteria 3386
121 Ga0068864_100099546 3300005618 Bacteria 2576
122 Ga0068866_10053652 3300005718 Bacteria 2062
123 Ga0068861_100000256 3300005719 Bacteria 29591
124 Ga0068861_100009322 3300005719 Bacteria 6775
125 Ga0068861_100026187 3300005719 Bacteria 4238
126 Ga0068861_100026857 3300005719 Bacteria 4189
127 Ga0068861_100057256 3300005719 Bacteria 2976
128 Ga0068861_100077237 3300005719 Bacteria 2597
129 Ga0068861_100095243 3300005719 Bacteria 2357
130 Ga0068851_10000471 3300005834 Bacteria 17764
131 Ga0068870_10006049 3300005840 Bacteria 5316
132 Ga0068870_10026226 3300005840 Bacteria 2904
133 Ga0068863_100000669 3300005841 Bacteria 34544
134 Ga0068863_100017715 3300005841 Bacteria 6819
135 Ga0068863_100042992 3300005841 Bacteria 4291
136 Ga0068863_100480339 3300005841 Bacteria 1222
137 Ga0068860_100040742 3300005843 Bacteria 4438
138 Ga0068860_100071566 3300005843 Bacteria 3295
139 Ga0068860_100451323 3300005843 Bacteria 1278
140 Ga0068862_100000453 3300005844 Bacteria 44400
141 Ga0068862_100000878 3300005844 Bacteria 29297
142 Ga0068862_100009137 3300005844 Bacteria 8205
143 Ga0068862_100012930 3300005844 Bacteria 6906
144 Ga0068862_100018285 3300005844 Bacteria 5837
145 Ga0068862_100412627 3300005844 Bacteria 1265
146 Ga0081455_10000043 3300005937 Bacteria 132283
147 Ga0081540_1005554 3300005983 Bacteria 9389
148 Ga0081539_10000046 3300005985 Bacteria 275677
149 Ga0075364_10187919 3300006051 Bacteria 1399
150 Ga0097621_100020849 3300006237 Bacteria 5057
151 Ga0097621_100022710 3300006237 Bacteria 4873
152 Ga0097621_100085538 3300006237 Bacteria 2630
153 Ga0068871_100031521 3300006358 Bacteria 4182
154 Ga0068871_100075919 3300006358 Bacteria 2775
155 Ga0075428_100001451 3300006844 Bacteria 25355
156 Ga0075428_100015420 3300006844 Bacteria 8471
157 Ga0075428_100019438 3300006844 Bacteria 7518
158 Ga0075428_100021514 3300006844 Bacteria 7139
159 Ga0075428_100038382 3300006844 Bacteria 5270
160 Ga0075428_100090636 3300006844 Bacteria 3335
161 Ga0075430_100022366 3300006846 Bacteria 5379
162 Ga0075430_100073376 3300006846 Bacteria 2870
163 Ga0075430_100085988 3300006846 Bacteria 2632
164 Ga0075431_100012402 3300006847 Bacteria 8602
165 Ga0075431_100017639 3300006847 Bacteria 7257
166 Ga0075431_100487574 3300006847 Bacteria 1225
167 Ga0075433_10000056 3300006852 Bacteria 48702
168 Ga0075433_10422960 3300006852 Bacteria 1175
169 Ga0075434_100021092 3300006871 Bacteria 6331
170 Ga0075429_100010555 3300006880 Bacteria 7988
171 Ga0075429_100115776 3300006880 Bacteria 2343
172 Ga0075429_100283927 3300006880 Bacteria 1450
173 Ga0068865_100051849 3300006881 Bacteria 2841
174 Ga0068865_100090407 3300006881 Bacteria 2220
175 Ga0068865_100262464 3300006881 Bacteria 1368
176 Ga0068865_100268803 3300006881 Bacteria 1353
177 Ga0097620_100001149 3300006931 Bacteria 26992
178 Ga0097620_100014785 3300006931 Bacteria 7841
179 Ga0097620_100175962 3300006931 Bacteria 2221
180 Ga0097620_100346657 3300006931 Bacteria 1580
181 Ga0075435_100146385 3300007076 Bacteria 1984
182 Ga0105244_10051457 3300009036 Bacteria 2099
183 Ga0105250_10146565 3300009092 Bacteria 980
184 Ga0111539_10001328 3300009094 Bacteria 32966
185 Ga0111539_10004344 3300009094 Bacteria 18562
186 Ga0111539_10005730 3300009094 Bacteria 16066
187 Ga0111539_10007197 3300009094 Bacteria 14258
188 Ga0111539_10020366 3300009094 Bacteria 8169
189 Ga0111539_10041801 3300009094 Bacteria 5509
190 Ga0114129_10244198 3300009147 Bacteria 2413
191 Ga0114129_10412781 3300009147 Bacteria 1777
192 Ga0105243_10104671 3300009148 Bacteria 2356
193 Ga0105243_10601043 3300009148 Bacteria 1059
194 Ga0105242_10159491 3300009176 Bacteria 1973
195 Ga0105242_10293101 3300009176 Bacteria 1482
196 Ga0105248_10001157 3300009177 Bacteria 29438
197 Ga0105248_10363459 3300009177 Bacteria 1630
198 Ga0105237_10034815 3300009545 Bacteria 5096
199 Ga0105237_10081287 3300009545 Bacteria 3231
200 Ga0105238_10382044 3300009551 Bacteria 1400
201 Ga0105249_10007356 3300009553 Bacteria 9599
202 Ga0105249_10026665 3300009553 Bacteria 5209
203 Ga0105249_10541710 3300009553 Bacteria 1214
204 Ga0105032_100079 3300009979 Bacteria 10287
205 Ga0105030_102897 3300009987 Bacteria 1488
206 Ga0105239_10014254 3300010375 Bacteria 8825
207 Ga0157316_1000482 3300012510 Bacteria 2109
208 Ga0157373_10000136 3300013100 Bacteria 57912
209 Ga0157373_10005081 3300013100 Bacteria 9885
210 Ga0157373_10016193 3300013100 Bacteria 5441
211 Ga0157373_10138343 3300013100 Bacteria 1712
212 Ga0157373_10197065 3300013100 Bacteria 1420
213 Ga0157371_10000034 3300013102 Bacteria 223947
214 Ga0157371_10003233 3300013102 Bacteria 14952
215 Ga0157371_10008786 3300013102 Bacteria 8010
216 Ga0157371_10017967 3300013102 Bacteria 5239
217 Ga0157370_10003221 3300013104 Bacteria 19273
218 Ga0157370_10005022 3300013104 Bacteria 14947
219 Ga0157370_10008391 3300013104 Bacteria 11143
220 Ga0157370_10013310 3300013104 Bacteria 8474
221 Ga0157370_10020179 3300013104 Bacteria 6660
222 Ga0157370_10053620 3300013104 Bacteria 3845
223 Ga0157370_10080579 3300013104 Bacteria 3065
224 Ga0157370_10113186 3300013104 Bacteria 2536
225 Ga0157370_10265454 3300013104 Bacteria 1586
226 Ga0157370_10273953 3300013104 Bacteria 1559
227 Ga0157369_10000002 3300013105 Bacteria 524510
228 Ga0157369_10030662 3300013105 Bacteria 5929
229 Ga0157374_10418984 3300013296 Bacteria 1338
230 Ga0157374_10594519 3300013296 Bacteria 1116
231 Ga0157378_10056295 3300013297 Bacteria 3504
232 Ga0163162_10087883 3300013306 Bacteria 3188
233 Ga0163162_10121857 3300013306 Bacteria 2712
234 Ga0163162_10211503 3300013306 Bacteria 2069
235 Ga0157375_10017828 3300013308 Bacteria 6422
236 Ga0157375_10094562 3300013308 Bacteria 3058
237 Ga0157375_10335280 3300013308 Bacteria 1678
238 Ga0157375_10539916 3300013308 Bacteria 1328
239 Ga0157375_10975291 3300013308 Bacteria 988
240 Ga0157514_114954 3300013874 Bacteria 1237
241 Ga0163163_10017551 3300014325 Bacteria 6678
242 Ga0163163_10024275 3300014325 Bacteria 5769
243 Ga0157380_10002823 3300014326 Bacteria 11811
244 Ga0157380_10009355 3300014326 Bacteria 7017
245 Ga0157380_10013438 3300014326 Bacteria 5968
246 Ga0157380_10016352 3300014326 Bacteria 5470
247 Ga0157380_10297777 3300014326 Bacteria 1484
248 Ga0157380_10335501 3300014326 Bacteria 1408
249 Ga0157380_10339673 3300014326 Bacteria 1400
250 Ga0182008_10000018 3300014497 Bacteria 230609
251 Ga0182008_10000524 3300014497 Bacteria 28770
252 Ga0182008_10001182 3300014497 Bacteria 17998
253 Ga0157377_10250591 3300014745 Bacteria 1147
254 Ga0157376_10020516 3300014969 Bacteria 5113
255 Ga0157376_10354312 3300014969 Bacteria 1405
256 Ga0157376_10485344 3300014969 Bacteria 1212
257 Ga0157376_10624471 3300014969 Bacteria 1075
258 Ga0157376_10939444 3300014969 Bacteria 885
259 Ga0182006_1000382 3300015261 Bacteria 36661
260 Ga0182006_1002866 3300015261 Bacteria 9172
261 Ga0182006_1007137 3300015261 Bacteria 5138
262 Ga0182007_10000001 3300015262 Bacteria 1127301
263 Ga0183373_1010 3300015682 Bacteria 196982
264 Ga0163161_10000153 3300017792 Bacteria 63614
265 Ga0163161_10000211 3300017792 Bacteria 53320
266 Ga0163161_10000218 3300017792 Bacteria 52323
267 Ga0163161_10001606 3300017792 Bacteria 16680
268 Ga0163161_10034090 3300017792 Bacteria 3640
269 Ga0163161_10058043 3300017792 Bacteria 2813
270 Ga0163161_10067352 3300017792 Bacteria 2615
271 Ga0163161_10391346 3300017792 Bacteria 1113
272 Ga0163161_10490799 3300017792 Bacteria 999
273 Ga0207425_1000007 3300025245 Bacteria 777411
274 Ga0207425_1000028 3300025245 Bacteria 286333
275 Ga0209129_1000006 3300025258 Bacteria 777761
276 Ga0209129_1000065 3300025258 Bacteria 232568
277 Ga0209676_1000001 3300025292 Bacteria 1852142
278 Ga0209025_1000002 3300025294 Bacteria 1393142
279 Ga0209025_1000025 3300025294 Bacteria 524454
280 Ga0209758_1000003 3300025297 Bacteria 1398533
281 Ga0209758_1000016 3300025297 Bacteria 778557
282 Ga0209050_1000018 3300025298 Bacteria 723263
283 Ga0209050_1021987 3300025298 Bacteria 2302
284 Ga0207682_10004828 3300025893 Bacteria 5581
285 Ga0207682_10006865 3300025893 Bacteria 4570
286 Ga0207692_10090477 3300025898 Bacteria 1658
287 Ga0207642_10162314 3300025899 Bacteria 1201
288 Ga0207688_10048537 3300025901 Bacteria 2372
289 Ga0207645_10008140 3300025907 Bacteria 7345
290 Ga0207643_10002859 3300025908 Bacteria 9322
291 Ga0207643_10261330 3300025908 Bacteria 1069
292 Ga0207707_10385987 3300025912 Bacteria 1204
293 Ga0207671_10020108 3300025914 Bacteria 5090
294 Ga0207671_10100419 3300025914 Bacteria 2191
295 Ga0207663_10069550 3300025916 Bacteria 2265
296 Ga0207662_10015156 3300025918 Bacteria 4334
297 Ga0207657_10253352 3300025919 Bacteria 1403
298 Ga0207649_10132809 3300025920 Bacteria 1693
299 Ga0207681_10035952 3300025923 Bacteria 3265
300 Ga0207681_10210126 3300025923 Bacteria 1499
301 Ga0207650_10023024 3300025925 Bacteria 4414
302 Ga0207650_10143539 3300025925 Bacteria 1879
303 Ga0207650_10207340 3300025925 Bacteria 1573
304 Ga0207659_10012387 3300025926 Bacteria 5423
305 Ga0207659_10030591 3300025926 Bacteria 3680
306 Ga0207659_10469336 3300025926 Bacteria 1062
307 Ga0207659_10568502 3300025926 Bacteria 965
308 Ga0207644_10020294 3300025931 Bacteria 4518
309 Ga0207644_10124880 3300025931 Bacteria 1963
310 Ga0207644_10368945 3300025931 Bacteria 1169
311 Ga0207706_10014709 3300025933 Bacteria 7089
312 Ga0207706_10074555 3300025933 Bacteria 2984
313 Ga0207670_10047124 3300025936 Bacteria 2868
314 Ga0207670_10220934 3300025936 Bacteria 1450
315 Ga0207669_10010796 3300025937 Bacteria 4413
316 Ga0207669_10078323 3300025937 Bacteria 2106
317 Ga0207669_10102078 3300025937 Bacteria 1899
318 Ga0207704_10141413 3300025938 Bacteria 1684
319 Ga0207704_10215131 3300025938 Bacteria 1417
320 Ga0207704_10348264 3300025938 Bacteria 1152
321 Ga0207691_10013086 3300025940 Bacteria 7942
322 Ga0207691_10047401 3300025940 Bacteria 3943
323 Ga0207691_10053881 3300025940 Bacteria 3671
324 Ga0207691_10065138 3300025940 Bacteria 3300
325 Ga0207691_10110205 3300025940 Bacteria 2449
326 Ga0207711_10006071 3300025941 Bacteria 10206
327 Ga0207711_10286786 3300025941 Bacteria 1517
328 Ga0207689_10065958 3300025942 Bacteria 2977
329 Ga0207689_10119636 3300025942 Bacteria 2167
330 Ga0207679_10001705 3300025945 Bacteria 13701
331 Ga0207667_10572285 3300025949 Bacteria 1141
332 Ga0207651_10017784 3300025960 Bacteria 4209
333 Ga0207651_10078569 3300025960 Bacteria 2367
334 Ga0207668_10072791 3300025972 Bacteria 2460
335 Ga0207668_10523839 3300025972 Bacteria 1023
336 Ga0207658_10010629 3300025986 Bacteria 6256
337 Ga0207658_10194194 3300025986 Bacteria 1690
338 Ga0207658_10620593 3300025986 Bacteria 973
339 Ga0207677_10085585 3300026023 Bacteria 2276
340 Ga0207703_10237675 3300026035 Bacteria 1636
341 Ga0207639_10633149 3300026041 Bacteria 988
342 Ga0207678_10008753 3300026067 Bacteria 8909
343 Ga0207708_10023307 3300026075 Bacteria 4677
344 Ga0207708_10045928 3300026075 Bacteria 3328
345 Ga0207708_10172081 3300026075 Bacteria 1716
346 Ga0207708_10326899 3300026075 Bacteria 1253
347 Ga0207702_10242561 3300026078 Bacteria 1689
348 Ga0207641_10463971 3300026088 Bacteria 1225
349 Ga0207641_10813312 3300026088 Bacteria 925
350 Ga0207648_10020686 3300026089 Bacteria 5923
351 Ga0207648_10023400 3300026089 Bacteria 5534
352 Ga0207648_10027409 3300026089 Bacteria 5057
353 Ga0207648_10308645 3300026089 Bacteria 1420
354 Ga0207648_10331072 3300026089 Bacteria 1370
355 Ga0207676_10048097 3300026095 Bacteria 3309
356 Ga0207676_10083393 3300026095 Bacteria 2603
357 Ga0207676_10537228 3300026095 Bacteria 1115
358 Ga0207674_10053147 3300026116 Bacteria 4129
359 Ga0207674_10229605 3300026116 Bacteria 1804
360 Ga0207675_100001062 3300026118 Bacteria 27254
361 Ga0207675_100014561 3300026118 Bacteria 7330
362 Ga0207675_100024041 3300026118 Bacteria 5664
363 Ga0207675_100042940 3300026118 Bacteria 4222
364 Ga0207675_100054162 3300026118 Bacteria 3742
365 Ga0207675_100121874 3300026118 Bacteria 2468
366 Ga0207675_100138649 3300026118 Bacteria 2309
367 Ga0207683_10038587 3300026121 Bacteria 4164
368 Ga0207683_10053089 3300026121 Bacteria 3553
369 Ga0207683_10149117 3300026121 Bacteria 2110
370 Ga0209973_1011888 3300027252 Bacteria 1051
371 Ga0209967_1014944 3300027364 Bacteria 1109
372 Ga0209995_1030015 3300027471 Bacteria 909
373 Ga0209999_1012934 3300027543 Bacteria 1514
374 Ga0209983_1001496 3300027665 Bacteria 5198
375 Ga0207428_10014130 3300027907 Bacteria 6951
376 Ga0207428_10030963 3300027907 Bacteria 4420
377 Ga0207428_10034755 3300027907 Bacteria 4127
378 Ga0207428_10179941 3300027907 Bacteria 1598
379 Ga0207428_10460882 3300027907 Bacteria 926
380 Ga0268266_10000001 3300028379 Bacteria 4040580
381 Ga0268266_10024293 3300028379 Bacteria 5156
382 Ga0268266_10034734 3300028379 Bacteria 4288
383 Ga0268266_10402460 3300028379 Bacteria 1294
384 Ga0268265_10000431 3300028380 Bacteria 44419
385 Ga0268265_10000559 3300028380 Bacteria 37946
386 Ga0268265_10004326 3300028380 Bacteria 9890
387 Ga0268265_10007113 3300028380 Bacteria 7554
388 Ga0268265_10014927 3300028380 Bacteria 5303
389 Ga0268265_10146017 3300028380 Bacteria 1988
390 Ga0268265_10167959 3300028380 Bacteria 1872
391 Ga0268265_10638154 3300028380 Bacteria 1022
392 Ga0268264_10006609 3300028381 Bacteria 9751
393 Ga0307515_10000003 3300028794 Bacteria 891317
394 Ga0307515_10051252 3300028794 Bacteria 6161
395 Ga0307515_10148514 3300028794 Bacteria 2465
396 Ga0307515_10362363 3300028794 Bacteria 1090
397 Ga0316181_1173906 3300030744 Bacteria 1107
398 Ga0265327_10049545 3300031251 Bacteria 2202
399 Ga0307513_10007437 3300031456 Bacteria 14201
400 Ga0307513_10018327 3300031456 Bacteria 8369
401 Ga0307513_10215159 3300031456 Bacteria 1749
402 Ga0307513_10299977 3300031456 Bacteria 1374
403 Ga0307509_10241858 3300031507 Bacteria 1597
404 Ga0307408_100082417 3300031548 Bacteria 2407
405 Ga0307408_100294398 3300031548 Bacteria 1357
406 Ga0316576_10002653 3300031727 Bacteria 10215
407 Ga0316576_10122373 3300031727 Bacteria 1954
408 Ga0316576_10265766 3300031727 Bacteria 1287
409 Ga0316578_10000173 3300031728 Bacteria 17651
410 Ga0316578_10018529 3300031728 Bacteria 3818
411 Ga0307405_10000046 3300031731 Bacteria 71442
412 Ga0307413_10007747 3300031824 Bacteria 5013
413 Ga0307413_10133035 3300031824 Bacteria 1705
414 Ga0307410_10033919 3300031852 Bacteria 3300
415 Ga0307406_10006309 3300031901 Bacteria 6538
416 Ga0307406_10029727 3300031901 Bacteria 3311
417 Ga0307407_10000090 3300031903 Bacteria 32483
418 Ga0307412_10000077 3300031911 Bacteria 96375
419 Ga0307412_10550802 3300031911 Bacteria 969
420 Ga0307409_100032279 3300031995 Bacteria 3794
421 Ga0307409_100036344 3300031995 Bacteria 3620
422 Ga0307416_100000195 3300032002 Bacteria 32400
423 Ga0307416_100025475 3300032002 Bacteria 4336
424 Ga0307416_100079738 3300032002 Bacteria 2760
425 Ga0307416_100109376 3300032002 Bacteria 2431
426 Ga0307416_100219624 3300032002 Bacteria 1821
427 Ga0307414_10000722 3300032004 Bacteria 16914
428 Ga0307414_10001142 3300032004 Bacteria 13596
429 Ga0307414_10001246 3300032004 Bacteria 13119
430 Ga0307414_10006868 3300032004 Bacteria 6368
431 Ga0307414_10009803 3300032004 Bacteria 5521
432 Ga0307414_10031256 3300032004 Bacteria 3490
433 Ga0307414_10293009 3300032004 Bacteria 1373
434 Ga0307414_10313940 3300032004 Bacteria 1331
435 Ga0307411_10040215 3300032005 Bacteria 2964
436 Ga0307415_100028253 3300032126 Bacteria 3566
437 Ga0316592_1004591 3300033524 Bacteria 2577
438 Ga0316596_1034715 3300033541 Bacteria 1317
439 Ga0373955_0148008 3300035172 Bacteria 1381
440 Ga0316574_0012357 3300035398 Bacteria 4883
441 Ga0316574_0400375 3300035398 Bacteria 864
442 Ga0373931_0161963 3300035691 Bacteria 1312
443 Ga0316582_0115077 3300036647 Bacteria 1794
444 Ga0316584_0046123 3300036712 Bacteria 3254
445 Ga0316584_0078686 3300036712 Bacteria 2469
446 Ga0237819_00129 3300038705 Bacteria 28352
447 Ga0400483_113295 3300039062 Bacteria 1757
448 Ga0451791_0832387 3300041451 Bacteria 3324
449 Ga0451802_1227194 3300041460 Bacteria 1775
450 Ga0451807_1278395 3300041486 Bacteria 3892
451 Ga0450921_002850 3300042123 Bacteria 1181
452 Ga0450922_005787 3300042124 Bacteria 1148
453 Ga0450923_001583 3300042125 Bacteria 3065
454 Ga0450923_036460 3300042125 Bacteria 1020
455 Ga0450895_000914 3300042132 Bacteria 1903
456 Ga0450908_001163 3300042184 Bacteria 5103
457 Ga0439434_0007219 3300042435 Bacteria 3256
458 Ga0439444_0001530 3300042437 Bacteria 3032
459 Ga0450918_002643 3300042531 Bacteria 3378
460 Ga0451577_0360327 3300042876 Bacteria 1319
461 Ga0466965_0121914 3300044683 Bacteria 1347
462 Ga0453684_0009848 3300044712 Bacteria 16550
463 Ga0453684_0015777 3300044712 Bacteria 11888
464 Ga0453684_0157621 3300044712 Bacteria 2689
465 Ga0453684_0312123 3300044712 Bacteria 1784
466 Ga0453684_0339806 3300044712 Bacteria 1696
467 Ga0453684_0384599 3300044712 Bacteria 1575
468 Ga0453684_0469156 3300044712 Bacteria 1398
469 Ga0451576_0008691 3300045051 Bacteria 11887
470 Ga0451576_0016207 3300045051 Bacteria 8231
471 Ga0451576_0256191 3300045051 Bacteria 1829
472 Ga0451576_0867453 3300045051 Bacteria 947
473 Ga0495590_0003508 3300046457 Bacteria 6407
474 Ga0495591_019542 3300046458 Bacteria 2263
475 Ga0495638_0000026 3300046460 Bacteria 347061
476 Ga0495638_0046248 3300046460 Bacteria 2735
477 Ga0495650_0011525 3300046471 Bacteria 4836
478 Ga0495650_0108552 3300046471 Bacteria 1033
479 Ga0495606_0252855 3300046507 Bacteria 976
480 Ga0495610_0000126 3300046512 Bacteria 85368
481 Ga0495610_0001202 3300046512 Bacteria 23373
482 Ga0495616_0001490 3300046513 Bacteria 16200
483 Ga0495609_0012187 3300046538 Bacteria 4079
484 Ga0495621_0000313 3300046539 Bacteria 11770
485 Ga0495621_0214333 3300046539 Bacteria 778
486 Ga0495656_0095444 3300046615 Unclassified 1367
487 Ga0495625_0032579 3300046660 Bacteria 3862
488 Ga0495625_0063084 3300046660 Bacteria 2618
489 Ga0495647_0007361 3300046681 Bacteria 3685
490 Ga0495658_0224691 3300046683 Bacteria 1176
491 Ga0495670_0116873 3300046691 Bacteria 1384
492 Ga0495649_0023307 3300046694 Bacteria 3459
493 Ga0495649_0063443 3300046694 Bacteria 1985
494 Ga0495649_0217454 3300046694 Bacteria 989
495 Ga0495636_0014136 3300047318 Bacteria 3174
496 Ga0495636_0016893 3300047318 Bacteria 2918
497 Ga0495636_0159765 3300047318 Bacteria 1015
498 Ga0495615_0068053 3300048090 Bacteria 954
499 Ga0496102_0368090 3300048905 Bacteria 1353
500 Ga0496103_0070806 3300048906 Bacteria 2182
501 Ga0496104_0030225 3300048907 Bacteria 5033
502 Ga0496104_0289977 3300048907 Bacteria 1549
503 Ga0496107_0067275 3300048910 Bacteria 2599
504 Ga0496108_0026584 3300048911 Bacteria 4773
505 Ga0496108_0530247 3300048911 Bacteria 1028
506 Ga0496111_0025838 3300048914 Bacteria 4143
507 Ga0496112_0073419 3300048915 Bacteria 3382
508 Ga0496113_0006223 3300048916 Bacteria 7539
509 Ga0496114_0150470 3300048917 Bacteria 2019
510 Ga0496114_0391462 3300048917 Bacteria 1231
511 Ga0496122_0000746 3300048925 Bacteria 63466
512 Ga0496125_0022164 3300048928 Bacteria 5903
513 Ga0501031_0123465 3300049568 Bacteria 1691
514 Ga0501032_0033823 3300049569 Bacteria 3501
515 Ga0501033_0000565 3300049570 Bacteria 34468
516 Ga0501033_0015891 3300049570 Bacteria 5700
517 Ga0501033_0022293 3300049570 Bacteria 4777
518 Ga0501033_0192381 3300049570 Bacteria 1459
519 Ga0501033_0456927 3300049570 Bacteria 886
520 Ga0501034_0001186 3300049571 Bacteria 35964
521 Ga0501034_0061993 3300049571 Bacteria 3754
522 Ga0501034_0069399 3300049571 Bacteria 3535
523 Ga0501034_0295214 3300049571 Bacteria 1558
524 Ga0501036_0015572 3300049572 Bacteria 6353
525 Ga0501036_0164596 3300049572 Bacteria 1869
526 Ga0501036_0300973 3300049572 Bacteria 1341
527 Ga0501037_0007563 3300049573 Bacteria 7954
528 Ga0501037_0206052 3300049573 Bacteria 1388
529 Ga0501038_0014963 3300049574 Bacteria 7065
530 Ga0501038_0026112 3300049574 Bacteria 5202
531 Ga0501038_0162507 3300049574 Bacteria 1814
532 Ga0501038_0224979 3300049574 Bacteria 1495
533 Ga0501039_0019264 3300049575 Bacteria 5233
534 Ga0501040_0117674 3300049576 Bacteria 1863
535 Ga0501042_0301781 3300049578 Bacteria 1157
536 Ga0501043_0055049 3300049579 Bacteria 3125
537 Ga0501043_0108230 3300049579 Bacteria 2183
538 Ga0501043_0148018 3300049579 Bacteria 1838
539 Ga0501043_0351686 3300049579 Bacteria 1119
540 Ga0501046_0119402 3300049580 Bacteria 2007
541 Ga0501047_0077449 3300049581 Bacteria 3198
542 Ga0501047_0676901 3300049581 Bacteria 850
543 Ga0501048_0088141 3300049582 Bacteria 2189
544 Ga0501067_0005653 3300049583 Bacteria 6942
545 Ga0501067_0252129 3300049583 Bacteria 982
546 Ga0501068_0002289 3300049584 Bacteria 10196
547 Ga0501068_0008783 3300049584 Bacteria 5636
548 Ga0501068_0037284 3300049584 Bacteria 2911
549 Ga0501068_0254563 3300049584 Bacteria 1119
550 Ga0501069_0053721 3300049585 Bacteria 2243
551 Ga0501070_0010032 3300049586 Bacteria 8013
552 Ga0501070_0049919 3300049586 Bacteria 3473
553 Ga0501070_0266187 3300049586 Bacteria 1400
554 Ga0501070_0287403 3300049586 Bacteria 1341
555 Ga0501071_0006079 3300049587 Bacteria 7824
556 Ga0501071_0151457 3300049587 Bacteria 1730
557 Ga0501072_0045113 3300049588 Bacteria 3465
558 Ga0501073_0010204 3300049589 Bacteria 6899
559 Ga0501073_0031115 3300049589 Bacteria 3808
560 Ga0501073_0031708 3300049589 Bacteria 3770
561 Ga0501073_0149009 3300049589 Bacteria 1621
562 Ga0501074_0000122 3300049590 Bacteria 39373
563 Ga0501074_0146970 3300049590 Bacteria 1685
564 Ga0501074_0277709 3300049590 Bacteria 1191
565 Ga0501076_0003260 3300049592 Bacteria 11363
566 Ga0501076_0064474 3300049592 Bacteria 2920
567 Ga0501077_0012335 3300049593 Bacteria 5353
568 Ga0501202_025353 3300049652 Bacteria 1208
569 Ga0501223_015409 3300049663 Bacteria 1514
570 Ga0501080_0004743 3300049742 Bacteria 12123
571 Ga0501080_0009990 3300049742 Bacteria 8675
572 Ga0501080_0051688 3300049742 Bacteria 3824
573 Ga0501080_0430244 3300049742 Bacteria 1185
574 Ga0501081_0183210 3300049743 Bacteria 1515
575 Ga0501083_0021903 3300049744 Bacteria 4437
576 Ga0501083_0040105 3300049744 Bacteria 3179
577 Ga0501083_0070248 3300049744 Bacteria 2329
578 Ga0501241_001635 3300049758 Bacteria 4488
579 Ga0501241_010730 3300049758 Bacteria 1664
580 Ga0501035_0042356 3300049822 Bacteria 4106
581 Ga0501035_0053386 3300049822 Bacteria 3614
582 Ga0501035_0070638 3300049822 Bacteria 3092
583 Ga0501035_0260658 3300049822 Bacteria 1469
584 Ga0501044_0118123 3300049823 Bacteria 2655
585 Ga0501044_0165803 3300049823 Bacteria 2183
586 Ga0501044_0179541 3300049823 Bacteria 2084
587 Ga0501044_0243286 3300049823 Bacteria 1742
588 Ga0501044_0368423 3300049823 Bacteria 1353
589 nmdc:mga05p37_324208_c1 3300050507 Bacteria 1822
590 nmdc:mga05p37_555197_c1 3300050507 Bacteria 1306
591 nmdc:mga09592_333937_c1 3300050508 Bacteria 1312
592 nmdc:mga09592_3569_c1 3300050508 Bacteria 12561
593 nmdc:mga09592_41467_c1 3300050508 Bacteria 3871
594 nmdc:mga0qj67_18387_c1 3300050509 Bacteria 5326
595 nmdc:mga0qj67_306244_c1 3300050509 Bacteria 1287
596 nmdc:mga0qj67_3538_c1 3300050509 Bacteria 11284
597 nmdc:mga06r32_1358_c1 3300050510 Bacteria 22092
598 nmdc:mga06r32_29_c1 3300050510 Bacteria 85620
599 nmdc:mga06r32_415440_c1 3300050510 Bacteria 1327
600 nmdc:mga08y16_1085_c1 3300050511 Bacteria 26787
601 nmdc:mga08y16_21076_c1 3300050511 Bacteria 6882
602 nmdc:mga08y16_420582_c1 3300050511 Bacteria 1366
603 nmdc:mga08y16_4769_c1 3300050511 Bacteria 14148
604 nmdc:mga08y16_5940_c1 3300050511 Bacteria 12798
605 nmdc:mga08y16_620164_c1 3300050511 Bacteria 1088
606 nmdc:mga0n895_3290_c1 3300050512 Bacteria 12974
607 nmdc:mga0a205_340_c1 3300050515 Bacteria 35138
608 Ga0500578_0088549 3300053086 Unclassified 1966
609 Ga0500583_0070489 3300053092 Bacteria 1670
610 Ga0500651_0000127 3300053093 Bacteria 47010
611 Ga0500651_0105507 3300053093 Bacteria 1724
612 Ga0500641_0037149 3300053096 Bacteria 1951
613 Ga0500556_0065218 3300053104 Bacteria 1350
614 Ga0500617_012758 3300053124 Bacteria 3546
615 Ga0500658_0008694 3300053134 Bacteria 3748
616 Ga0500568_0000457 3300053139 Bacteria 30439
617 Ga0500588_0001244 3300053146 Bacteria 4742
618 Ga0500616_0000004 3300053153 Bacteria 1002714
619 Ga0500616_0000130 3300053153 Bacteria 132948
620 Ga0500622_0002376 3300053156 Bacteria 13637
621 Ga0500622_0021105 3300053156 Bacteria 3457
622 Ga0500634_0007244 3300053161 Bacteria 5448
623 Ga0500637_0215840 3300053178 Bacteria 1087
624 Ga0500656_008583 3300053732 Bacteria 1086
625 Ga0501084_0039566 3300054114 Bacteria 3944
626 Ga0501084_0056470 3300054114 Bacteria 3285
627 Ga0501084_0071684 3300054114 Bacteria 2901
628 Ga0501084_0162656 3300054114 Bacteria 1883
629 Ga0501082_0000792 3300060353 Bacteria 27834
630 Ga0501082_0006985 3300060353 Bacteria 9749
631 Ga0501082_0012251 3300060353 Bacteria 7370
632 Ga0501082_0225618 3300060353 Bacteria 1630
633 Ga0530510_0081160 3300061734 Bacteria 2361

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0360327 Ga0451577_0360327_660_1304 209
2 3300046539 Ga0495621_0214333 Ga0495621_0214333_14_658 209
3 3300006844 Ga0075428_100021514 Ga0075428_1000215148 237
4 3300009094 Ga0111539_10020366 Ga0111539_100203667 237
5 3300027907 Ga0207428_10030963 Ga0207428_100309632 237
6 3300050511 nmdc:mga08y16_5940_c1 nmdc:mga08y16_5940_c1_3304_4119 237
7 3300047318 Ga0495636_0014136 Ga0495636_0014136_1277_2047 238
8 3300053086 Ga0500578_0088549 Ga0500578_0088549_694_1479 238
9 3300005841 Ga0068863_100042992 Ga0068863_1000429923 239
10 3300006844 Ga0075428_100019438 Ga0075428_1000194385 240
11 3300009094 Ga0111539_10001328 Ga0111539_1000132822 240
12 3300027907 Ga0207428_10460882 Ga0207428_104608822 240
13 3300028794 Ga0307515_10000003 Ga0307515_10000003218 240
14 3300039062 Ga0400483_113295 Ga0400483_113295_80_856 241
15 3300005437 Ga0070710_10024018 Ga0070710_100240183 242
16 3300005439 Ga0070711_100031580 Ga0070711_1000315803 242
17 3300044712 Ga0453684_0009848 Ga0453684_0009848_2395_3174 242
18 3300045051 Ga0451576_0008691 Ga0451576_0008691_1666_2445 242
19 3300048907 Ga0496104_0030225 Ga0496104_0030225_564_1295 242
20 3300048917 Ga0496114_0150470 Ga0496114_0150470_761_1492 242
21 3300006844 Ga0075428_100090636 Ga0075428_1000906362 243
22 3300006880 Ga0075429_100283927 Ga0075429_1002839272 243
23 3300009094 Ga0111539_10005730 Ga0111539_100057302 243
24 3300009147 Ga0114129_10244198 Ga0114129_102441982 243
25 3300014326 Ga0157380_10297777 Ga0157380_102977772 243
26 3300027907 Ga0207428_10014130 Ga0207428_100141302 243
27 3300046681 Ga0495647_0007361 Ga0495647_0007361_1830_2621 243
28 3300046683 Ga0495658_0224691 Ga0495658_0224691_98_889 243
29 3300050507 nmdc:mga05p37_324208_c1 nmdc:mga05p37_324208_c1_367_1155 243
30 3300050511 nmdc:mga08y16_4769_c1 nmdc:mga08y16_4769_c1_5866_6654 243
31 3300053178 Ga0500637_0215840 Ga0500637_0215840_30_764 244
32 3300042124 Ga0450922_005787 Ga0450922_005787_43_780 245
33 3300042125 Ga0450923_036460 Ga0450923_036460_26_763 245
34 3300049578 Ga0501042_0301781 Ga0501042_0301781_187_960 245
35 3300031727 Ga0316576_10265766 Ga0316576_102657661 246
36 3300049586 Ga0501070_0287403 Ga0501070_0287403_242_1009 246
37 3300006852 Ga0075433_10000056 Ga0075433_100000569 247
38 3300006871 Ga0075434_100021092 Ga0075434_1000210923 247
39 3300007076 Ga0075435_100146385 Ga0075435_1001463852 247
40 3300014326 Ga0157380_10016352 Ga0157380_100163524 247
41 3300026116 Ga0207674_10229605 Ga0207674_102296052 247
42 3300027364 Ga0209967_1014944 Ga0209967_10149442 247
43 3300031548 Ga0307408_100082417 Ga0307408_1000824173 247
44 3300031901 Ga0307406_10029727 Ga0307406_100297272 247
45 3300032002 Ga0307416_100079738 Ga0307416_1000797382 247
46 3300042132 Ga0450895_000914 Ga0450895_000914_338_1138 247
47 3300042184 Ga0450908_001163 Ga0450908_001163_579_1379 247
48 3300042435 Ga0439434_0007219 Ga0439434_0007219_1458_2225 247
49 3300042437 Ga0439444_0001530 Ga0439444_0001530_1866_2666 247
50 3300042531 Ga0450918_002643 Ga0450918_002643_1753_2553 247
51 3300044712 Ga0453684_0469156 Ga0453684_0469156_203_988 247
52 3300049582 Ga0501048_0088141 Ga0501048_0088141_1220_2020 247
53 3300049584 Ga0501068_0037284 Ga0501068_0037284_1198_1998 247
54 3300049590 Ga0501074_0277709 Ga0501074_0277709_28_828 247
55 3300050512 nmdc:mga0n895_3290_c1 nmdc:mga0n895_3290_c1_11378_12178 247
56 3300050515 nmdc:mga0a205_340_c1 nmdc:mga0a205_340_c1_29396_30196 247
57 3300005355 Ga0070671_100353988 Ga0070671_1003539882 248
58 3300005618 Ga0068864_100020929 Ga0068864_1000209293 248
59 3300009092 Ga0105250_10146565 Ga0105250_101465651 248
60 3300009987 Ga0105030_102897 Ga0105030_1028971 248
61 3300012510 Ga0157316_1000482 Ga0157316_10004823 248
62 3300013874 Ga0157514_114954 Ga0157514_1149541 248
63 3300025941 Ga0207711_10286786 Ga0207711_102867862 248
64 3300026095 Ga0207676_10083393 Ga0207676_100833932 248
65 3300047318 Ga0495636_0016893 Ga0495636_0016893_1325_2146 248
66 3300048905 Ga0496102_0368090 Ga0496102_0368090_80_901 248
67 3300048906 Ga0496103_0070806 Ga0496103_0070806_1115_1936 248
68 3300048910 Ga0496107_0067275 Ga0496107_0067275_511_1332 248
69 3300048911 Ga0496108_0026584 Ga0496108_0026584_652_1473 248
70 3300048914 Ga0496111_0025838 Ga0496111_0025838_1283_2104 248
71 3300048916 Ga0496113_0006223 Ga0496113_0006223_1328_2149 248
72 3300049583 Ga0501067_0005653 Ga0501067_0005653_2543_3346 248
73 3300049589 Ga0501073_0010204 Ga0501073_0010204_1781_2584 248
74 3300049742 Ga0501080_0004743 Ga0501080_0004743_7921_8724 248
75 3300049744 Ga0501083_0040105 Ga0501083_0040105_1108_1911 248
76 3300054114 Ga0501084_0162656 Ga0501084_0162656_841_1644 248
77 3300060353 Ga0501082_0012251 Ga0501082_0012251_3358_4161 248
78 3300013104 Ga0157370_10013310 Ga0157370_100133108 249
79 3300032002 Ga0307416_100025475 Ga0307416_1000254752 249
80 3300005331 Ga0070670_100116787 Ga0070670_1001167873 250
81 3300005337 Ga0070682_100406652 Ga0070682_1004066521 250
82 3300005466 Ga0070685_10212982 Ga0070685_102129822 250
83 3300005545 Ga0070695_100221314 Ga0070695_1002213142 250
84 3300006844 Ga0075428_100038382 Ga0075428_1000383822 250
85 3300006846 Ga0075430_100085988 Ga0075430_1000859883 250
86 3300006880 Ga0075429_100115776 Ga0075429_1001157761 250
87 3300042123 Ga0450921_002850 Ga0450921_002850_41_805 250
88 3300042125 Ga0450923_001583 Ga0450923_001583_1454_2218 250
89 3300045051 Ga0451576_0256191 Ga0451576_0256191_192_974 250
90 3300049574 Ga0501038_0162507 Ga0501038_0162507_143_907 250
91 3300049576 Ga0501040_0117674 Ga0501040_0117674_987_1751 250
92 3300049592 Ga0501076_0064474 Ga0501076_0064474_1696_2460 250
93 3300050508 nmdc:mga09592_41467_c1 nmdc:mga09592_41467_c1_627_1391 250
94 3300050509 nmdc:mga0qj67_18387_c1 nmdc:mga0qj67_18387_c1_3573_4337 250
95 iso_pu_bacteria 2524614729 2525556094 250
96 iso_pu_bacteria 2627854209 2630651108 250
97 3300002773 JGI25152J39213_1000018 JGI25152J39213_100001865 251
98 3300002774 JGI25150J39212_1000159 JGI25150J39212_10001598 251
99 3300003187 JGI25151J46595_10000111 JGI25151J46595_1000011166 251
100 3300003215 JGI25153J46596_10000085 JGI25153J46596_1000008536 251
101 3300003322 rootL2_10078753 rootL2_100787534 251
102 3300003322 rootL2_10104587 rootL2_101045879 251
103 3300003323 rootH1_10005821 rootH1_1000582184 251
104 3300005367 Ga0070667_100682330 Ga0070667_1006823301 251
105 3300005548 Ga0070665_100000077 Ga0070665_10000007750 251
106 3300005719 Ga0068861_100009322 Ga0068861_1000093225 251
107 3300009094 Ga0111539_10007197 Ga0111539_100071973 251
108 3300014326 Ga0157380_10009355 Ga0157380_100093553 251
109 3300025245 Ga0207425_1000028 Ga0207425_1000028235 251
110 3300025258 Ga0209129_1000065 Ga0209129_1000065183 251
111 3300025294 Ga0209025_1000002 Ga0209025_100000237 251
112 3300025297 Ga0209758_1000003 Ga0209758_100000344 251
113 3300025298 Ga0209050_1021987 Ga0209050_10219872 251
114 3300026118 Ga0207675_100014561 Ga0207675_1000145615 251
115 3300027907 Ga0207428_10179941 Ga0207428_101799412 251
116 3300028379 Ga0268266_10000001 Ga0268266_100000011460 251
117 3300031251 Ga0265327_10049545 Ga0265327_100495452 251
118 3300031456 Ga0307513_10215159 Ga0307513_102151592 251
119 3300031456 Ga0307513_10299977 Ga0307513_102999772 251
120 3300031507 Ga0307509_10241858 Ga0307509_102418581 251
121 3300031727 Ga0316576_10002653 Ga0316576_100026538 251
122 3300031728 Ga0316578_10000173 Ga0316578_100001734 251
123 3300035398 Ga0316574_0400375 Ga0316574_0400375_86_844 251
124 3300036712 Ga0316584_0046123 Ga0316584_0046123_151_909 251
125 3300038705 Ga0237819_00129 Ga0237819_00129_26442_27209 251
126 3300044712 Ga0453684_0015777 Ga0453684_0015777_9686_10459 251
127 3300044712 Ga0453684_0312123 Ga0453684_0312123_605_1375 251
128 3300045051 Ga0451576_0016207 Ga0451576_0016207_7299_8084 251
129 3300046460 Ga0495638_0000026 Ga0495638_0000026_43278_44057 251
130 3300049652 Ga0501202_025353 Ga0501202_025353_19_789 251
131 3300049663 Ga0501223_015409 Ga0501223_015409_685_1455 251
132 3300050511 nmdc:mga08y16_420582_c1 nmdc:mga08y16_420582_c1_76_855 251
133 3300053153 Ga0500616_0000004 Ga0500616_0000004_184437_185216 251
134 3300053161 Ga0500634_0007244 Ga0500634_0007244_2507_3280 251
135 iso_pu_bacteria 2884634485 2884634988 251
136 iso_pu_bacteria 2895498888 2895500990 251
137 iso_pu_bacteria 2919692658 2919694660 251
138 3300003316 rootH1_10007102 rootH1_1000710223 252
139 3300003322 rootL2_10115706 rootL2_101157068 252
140 3300005331 Ga0070670_100048722 Ga0070670_1000487223 252
141 3300005338 Ga0068868_100289660 Ga0068868_1002896601 252
142 3300005347 Ga0070668_100021125 Ga0070668_1000211253 252
143 3300005353 Ga0070669_100081104 Ga0070669_1000811044 252
144 3300005355 Ga0070671_100107212 Ga0070671_1001072123 252
145 3300005356 Ga0070674_100079456 Ga0070674_1000794563 252
146 3300005367 Ga0070667_100002844 Ga0070667_1000028446 252
147 3300005367 Ga0070667_100021422 Ga0070667_1000214223 252
148 3300005367 Ga0070667_100106926 Ga0070667_1001069264 252
149 3300005440 Ga0070705_100092474 Ga0070705_1000924742 252
150 3300005441 Ga0070700_100602779 Ga0070700_1006027791 252
151 3300005444 Ga0070694_100078342 Ga0070694_1000783422 252
152 3300005457 Ga0070662_100003547 Ga0070662_1000035476 252
153 3300005539 Ga0068853_100136187 Ga0068853_1001361872 252
154 3300005539 Ga0068853_100312672 Ga0068853_1003126721 252
155 3300005543 Ga0070672_100039511 Ga0070672_1000395113 252
156 3300005548 Ga0070665_100045417 Ga0070665_1000454173 252
157 3300005548 Ga0070665_100187310 Ga0070665_1001873101 252
158 3300005548 Ga0070665_100461321 Ga0070665_1004613211 252
159 3300005563 Ga0068855_100591419 Ga0068855_1005914191 252
160 3300005614 Ga0068856_100031658 Ga0068856_1000316582 252
161 3300005616 Ga0068852_100241101 Ga0068852_1002411012 252
162 3300005617 Ga0068859_100001149 Ga0068859_10000114918 252
163 3300005719 Ga0068861_100000256 Ga0068861_10000025611 252
164 3300005841 Ga0068863_100017715 Ga0068863_1000177152 252
165 3300005843 Ga0068860_100451323 Ga0068860_1004513231 252
166 3300005844 Ga0068862_100000453 Ga0068862_10000045331 252
167 3300005844 Ga0068862_100000878 Ga0068862_10000087829 252
168 3300005983 Ga0081540_1005554 Ga0081540_10055548 252
169 3300006237 Ga0097621_100020849 Ga0097621_1000208494 252
170 3300006358 Ga0068871_100075919 Ga0068871_1000759192 252
171 3300006844 Ga0075428_100015420 Ga0075428_1000154204 252
172 3300006846 Ga0075430_100022366 Ga0075430_1000223663 252
173 3300006847 Ga0075431_100017639 Ga0075431_1000176393 252
174 3300006847 Ga0075431_100487574 Ga0075431_1004875742 252
175 3300006881 Ga0068865_100262464 Ga0068865_1002624642 252
176 3300006931 Ga0097620_100001149 Ga0097620_10000114918 252
177 3300009094 Ga0111539_10041801 Ga0111539_100418013 252
178 3300009147 Ga0114129_10412781 Ga0114129_104127812 252
179 3300009176 Ga0105242_10293101 Ga0105242_102931012 252
180 3300009545 Ga0105237_10081287 Ga0105237_100812872 252
181 3300009553 Ga0105249_10007356 Ga0105249_100073563 252
182 3300009979 Ga0105032_100079 Ga0105032_1000792 252
183 3300010375 Ga0105239_10014254 Ga0105239_100142543 252
184 3300013100 Ga0157373_10197065 Ga0157373_101970652 252
185 3300013308 Ga0157375_10975291 Ga0157375_109752912 252
186 3300014326 Ga0157380_10339673 Ga0157380_103396732 252
187 3300014969 Ga0157376_10020516 Ga0157376_100205164 252
188 3300025912 Ga0207707_10385987 Ga0207707_103859871 252
189 3300025914 Ga0207671_10100419 Ga0207671_101004192 252
190 3300025919 Ga0207657_10253352 Ga0207657_102533522 252
191 3300025925 Ga0207650_10023024 Ga0207650_100230242 252
192 3300025931 Ga0207644_10020294 Ga0207644_100202943 252
193 3300025931 Ga0207644_10368945 Ga0207644_103689452 252
194 3300025933 Ga0207706_10014709 Ga0207706_100147096 252
195 3300025937 Ga0207669_10102078 Ga0207669_101020783 252
196 3300025940 Ga0207691_10047401 Ga0207691_100474012 252
197 3300025940 Ga0207691_10053881 Ga0207691_100538812 252
198 3300025949 Ga0207667_10572285 Ga0207667_105722851 252
199 3300025972 Ga0207668_10072791 Ga0207668_100727914 252
200 3300025986 Ga0207658_10010629 Ga0207658_100106292 252
201 3300025986 Ga0207658_10194194 Ga0207658_101941941 252
202 3300026067 Ga0207678_10008753 Ga0207678_100087532 252
203 3300026075 Ga0207708_10326899 Ga0207708_103268991 252
204 3300026078 Ga0207702_10242561 Ga0207702_102425612 252
205 3300026089 Ga0207648_10020686 Ga0207648_100206863 252
206 3300026116 Ga0207674_10053147 Ga0207674_100531473 252
207 3300026118 Ga0207675_100001062 Ga0207675_10000106211 252
208 3300026121 Ga0207683_10149117 Ga0207683_101491172 252
209 3300027471 Ga0209995_1030015 Ga0209995_10300151 252
210 3300027665 Ga0209983_1001496 Ga0209983_10014962 252
211 3300028379 Ga0268266_10402460 Ga0268266_104024601 252
212 3300028380 Ga0268265_10000431 Ga0268265_1000043131 252
213 3300028380 Ga0268265_10000559 Ga0268265_1000055928 252
214 3300028381 Ga0268264_10006609 Ga0268264_100066096 252
215 3300028794 Ga0307515_10148514 Ga0307515_101485142 252
216 3300031727 Ga0316576_10122373 Ga0316576_101223732 252
217 3300031728 Ga0316578_10018529 Ga0316578_100185294 252
218 3300033524 Ga0316592_1004591 Ga0316592_10045911 252
219 3300033541 Ga0316596_1034715 Ga0316596_10347152 252
220 3300035398 Ga0316574_0012357 Ga0316574_0012357_1113_1877 252
221 3300036647 Ga0316582_0115077 Ga0316582_0115077_951_1712 252
222 3300036712 Ga0316584_0078686 Ga0316584_0078686_249_1013 252
223 3300044712 Ga0453684_0384599 Ga0453684_0384599_158_967 252
224 3300045051 Ga0451576_0867453 Ga0451576_0867453_114_923 252
225 3300048090 Ga0495615_0068053 Ga0495615_0068053_119_892 252
226 3300048911 Ga0496108_0530247 Ga0496108_0530247_114_887 252
227 3300048917 Ga0496114_0391462 Ga0496114_0391462_403_1188 252
228 3300049568 Ga0501031_0123465 Ga0501031_0123465_395_1180 252
229 3300049569 Ga0501032_0033823 Ga0501032_0033823_1732_2517 252
230 3300049570 Ga0501033_0000565 Ga0501033_0000565_20706_21476 252
231 3300049570 Ga0501033_0015891 Ga0501033_0015891_3184_3969 252
232 3300049570 Ga0501033_0192381 Ga0501033_0192381_600_1385 252
233 3300049570 Ga0501033_0456927 Ga0501033_0456927_75_860 252
234 3300049571 Ga0501034_0001186 Ga0501034_0001186_6161_6931 252
235 3300049571 Ga0501034_0061993 Ga0501034_0061993_2770_3555 252
236 3300049571 Ga0501034_0295214 Ga0501034_0295214_440_1225 252
237 3300049572 Ga0501036_0015572 Ga0501036_0015572_2550_3335 252
238 3300049572 Ga0501036_0164596 Ga0501036_0164596_889_1674 252
239 3300049572 Ga0501036_0300973 Ga0501036_0300973_197_982 252
240 3300049573 Ga0501037_0007563 Ga0501037_0007563_6104_6889 252
241 3300049574 Ga0501038_0026112 Ga0501038_0026112_3775_4560 252
242 3300049574 Ga0501038_0224979 Ga0501038_0224979_515_1300 252
243 3300049575 Ga0501039_0019264 Ga0501039_0019264_2742_3527 252
244 3300049579 Ga0501043_0055049 Ga0501043_0055049_2171_2956 252
245 3300049579 Ga0501043_0108230 Ga0501043_0108230_629_1414 252
246 3300049579 Ga0501043_0351686 Ga0501043_0351686_162_947 252
247 3300049580 Ga0501046_0119402 Ga0501046_0119402_835_1620 252
248 3300049581 Ga0501047_0077449 Ga0501047_0077449_26_811 252
249 3300049583 Ga0501067_0252129 Ga0501067_0252129_22_807 252
250 3300049584 Ga0501068_0008783 Ga0501068_0008783_4657_5442 252
251 3300049584 Ga0501068_0254563 Ga0501068_0254563_136_921 252
252 3300049585 Ga0501069_0053721 Ga0501069_0053721_924_1709 252
253 3300049586 Ga0501070_0049919 Ga0501070_0049919_985_1770 252
254 3300049586 Ga0501070_0266187 Ga0501070_0266187_458_1243 252
255 3300049587 Ga0501071_0151457 Ga0501071_0151457_648_1433 252
256 3300049589 Ga0501073_0031115 Ga0501073_0031115_1731_2516 252
257 3300049589 Ga0501073_0149009 Ga0501073_0149009_570_1355 252
258 3300049590 Ga0501074_0146970 Ga0501074_0146970_493_1278 252
259 3300049742 Ga0501080_0051688 Ga0501080_0051688_2840_3625 252
260 3300049742 Ga0501080_0430244 Ga0501080_0430244_374_1138 252
261 3300049743 Ga0501081_0183210 Ga0501081_0183210_365_1150 252
262 3300049744 Ga0501083_0070248 Ga0501083_0070248_566_1351 252
263 3300049822 Ga0501035_0042356 Ga0501035_0042356_2351_3136 252
264 3300049822 Ga0501035_0053386 Ga0501035_0053386_289_1074 252
265 3300049822 Ga0501035_0260658 Ga0501035_0260658_662_1447 252
266 3300049823 Ga0501044_0118123 Ga0501044_0118123_1199_1984 252
267 3300049823 Ga0501044_0165803 Ga0501044_0165803_629_1414 252
268 3300049823 Ga0501044_0179541 Ga0501044_0179541_1277_2062 252
269 3300049823 Ga0501044_0243286 Ga0501044_0243286_591_1376 252
270 3300050507 nmdc:mga05p37_555197_c1 nmdc:mga05p37_555197_c1_54_830 252
271 3300050508 nmdc:mga09592_333937_c1 nmdc:mga09592_333937_c1_496_1272 252
272 3300050509 nmdc:mga0qj67_3538_c1 nmdc:mga0qj67_3538_c1_2209_2985 252
273 3300050510 nmdc:mga06r32_1358_c1 nmdc:mga06r32_1358_c1_3482_4258 252
274 3300050510 nmdc:mga06r32_415440_c1 nmdc:mga06r32_415440_c1_291_1067 252
275 3300050511 nmdc:mga08y16_21076_c1 nmdc:mga08y16_21076_c1_201_977 252
276 3300053093 Ga0500651_0105507 Ga0500651_0105507_394_1179 252
277 3300053139 Ga0500568_0000457 Ga0500568_0000457_9942_10727 252
278 3300054114 Ga0501084_0039566 Ga0501084_0039566_2297_3082 252
279 3300054114 Ga0501084_0056470 Ga0501084_0056470_2319_3104 252
280 3300060353 Ga0501082_0000792 Ga0501082_0000792_9243_10028 252
281 3300060353 Ga0501082_0225618 Ga0501082_0225618_650_1435 252
282 iso_pu_bacteria 2585427687 2586209968 252
283 iso_pu_bacteria 2738541283 2738755039 252
284 iso_pu_bacteria 2738541284 2738760994 252
285 iso_pu_bacteria 2738541302 2738853212 252
286 iso_pu_bacteria 2738543023 2739301195 252
287 iso_pu_bacteria 2739367651 2739588774 252
288 iso_pu_bacteria 2739367656 2739616033 252
289 iso_pu_bacteria 2739367663 2739645193 252
290 iso_pu_bacteria 2775506987 2776613180 252
291 iso_pu_bacteria 2818991437 2819548762 252
292 iso_pu_bacteria 2842722452 2842726199 252
293 iso_pu_bacteria 2842909656 2842910443 252
294 iso_pu_bacteria 2849281842 2849282263 252
295 iso_pu_bacteria 2852627209 2852631328 252
296 iso_pu_bacteria 2857627736 2857629173 252
297 iso_pu_bacteria 2904445276 2904445596 252
298 iso_pu_bacteria 2919130084 2919130566 252
299 iso_pu_bacteria 2919186247 2919187231 252
300 iso_pu_bacteria 2929195423 2929198430 252
301 iso_pu_bacteria 2939664404 2939665500 252
302 iso_pu_bacteria 2945997725 2946000798 252
303 iso_pu_bacteria 2954016120 2954017668 252
304 3300003203 JGI25406J46586_10010500 JGI25406J46586_100105004 253
305 3300005937 Ga0081455_10000043 Ga0081455_1000004311 253
306 3300005985 Ga0081539_10000046 Ga0081539_100000467 253
307 3300009553 Ga0105249_10026665 Ga0105249_100266655 253
308 3300014969 Ga0157376_10624471 Ga0157376_106244711 253
309 3300028380 Ga0268265_10146017 Ga0268265_101460172 253
310 3300032004 Ga0307414_10001246 Ga0307414_100012461 253
311 3300032004 Ga0307414_10031256 Ga0307414_100312562 253
312 3300032004 Ga0307414_10313940 Ga0307414_103139401 253
313 3300044683 Ga0466965_0121914 Ga0466965_0121914_160_993 253
314 3300044712 Ga0453684_0157621 Ga0453684_0157621_558_1337 253
315 3300046458 Ga0495591_019542 Ga0495591_019542_1003_1794 253
316 3300046539 Ga0495621_0000313 Ga0495621_0000313_3760_4551 253
317 3300046691 Ga0495670_0116873 Ga0495670_0116873_504_1295 253
318 3300047318 Ga0495636_0159765 Ga0495636_0159765_76_861 253
319 3300049581 Ga0501047_0676901 Ga0501047_0676901_51_821 253
320 3300053092 Ga0500583_0070489 Ga0500583_0070489_419_1183 253
321 3300053096 Ga0500641_0037149 Ga0500641_0037149_147_911 253
322 3300053104 Ga0500556_0065218 Ga0500556_0065218_203_967 253
323 3300053124 Ga0500617_012758 Ga0500617_012758_380_1144 253
324 3300053134 Ga0500658_0008694 Ga0500658_0008694_540_1304 253
325 3300053146 Ga0500588_0001244 Ga0500588_0001244_168_932 253
326 3300053153 Ga0500616_0000130 Ga0500616_0000130_51765_52529 253
327 3300053732 Ga0500656_008583 Ga0500656_008583_60_824 253
328 3300005290 Ga0065712_10069113 Ga0065712_100691133 254
329 3300005330 Ga0070690_100037213 Ga0070690_1000372132 254
330 3300005331 Ga0070670_100027911 Ga0070670_1000279112 254
331 3300005331 Ga0070670_100130960 Ga0070670_1001309603 254
332 3300005331 Ga0070670_100179312 Ga0070670_1001793122 254
333 3300005333 Ga0070677_10003138 Ga0070677_100031384 254
334 3300005334 Ga0068869_100086812 Ga0068869_1000868122 254
335 3300005337 Ga0070682_100009288 Ga0070682_1000092883 254
336 3300005337 Ga0070682_100042905 Ga0070682_1000429053 254
337 3300005338 Ga0068868_100181368 Ga0068868_1001813682 254
338 3300005340 Ga0070689_100046123 Ga0070689_1000461233 254
339 3300005340 Ga0070689_100056744 Ga0070689_1000567444 254
340 3300005343 Ga0070687_100009254 Ga0070687_1000092545 254
341 3300005344 Ga0070661_100010630 Ga0070661_1000106301 254
342 3300005344 Ga0070661_100160429 Ga0070661_1001604293 254
343 3300005345 Ga0070692_10050412 Ga0070692_100504122 254
344 3300005347 Ga0070668_100433186 Ga0070668_1004331861 254
345 3300005353 Ga0070669_100022350 Ga0070669_1000223504 254
346 3300005354 Ga0070675_100009725 Ga0070675_1000097253 254
347 3300005354 Ga0070675_100027806 Ga0070675_1000278065 254
348 3300005354 Ga0070675_100064599 Ga0070675_1000645993 254
349 3300005355 Ga0070671_100421029 Ga0070671_1004210292 254
350 3300005356 Ga0070674_100023152 Ga0070674_1000231525 254
351 3300005356 Ga0070674_100185658 Ga0070674_1001856583 254
352 3300005364 Ga0070673_100037601 Ga0070673_1000376012 254
353 3300005364 Ga0070673_100042111 Ga0070673_1000421113 254
354 3300005364 Ga0070673_100109531 Ga0070673_1001095313 254
355 3300005364 Ga0070673_100803477 Ga0070673_1008034771 254
356 3300005365 Ga0070688_100248477 Ga0070688_1002484773 254
357 3300005438 Ga0070701_10014880 Ga0070701_100148803 254
358 3300005441 Ga0070700_100024517 Ga0070700_1000245172 254
359 3300005441 Ga0070700_100127352 Ga0070700_1001273522 254
360 3300005455 Ga0070663_100082003 Ga0070663_1000820033 254
361 3300005456 Ga0070678_100011129 Ga0070678_1000111293 254
362 3300005456 Ga0070678_100031756 Ga0070678_1000317562 254
363 3300005457 Ga0070662_100341085 Ga0070662_1003410852 254
364 3300005459 Ga0068867_100323726 Ga0068867_1003237263 254
365 3300005466 Ga0070685_10046505 Ga0070685_100465051 254
366 3300005466 Ga0070685_10061020 Ga0070685_100610202 254
367 3300005539 Ga0068853_100687862 Ga0068853_1006878621 254
368 3300005543 Ga0070672_100052136 Ga0070672_1000521364 254
369 3300005543 Ga0070672_100053985 Ga0070672_1000539852 254
370 3300005543 Ga0070672_100070859 Ga0070672_1000708593 254
371 3300005543 Ga0070672_100472587 Ga0070672_1004725872 254
372 3300005544 Ga0070686_100024869 Ga0070686_1000248693 254
373 3300005544 Ga0070686_100152854 Ga0070686_1001528542 254
374 3300005546 Ga0070696_100060692 Ga0070696_1000606923 254
375 3300005548 Ga0070665_100002747 Ga0070665_10000274719 254
376 3300005548 Ga0070665_100004552 Ga0070665_1000045522 254
377 3300005549 Ga0070704_100113391 Ga0070704_1001133913 254
378 3300005549 Ga0070704_100593070 Ga0070704_1005930702 254
379 3300005564 Ga0070664_100003153 Ga0070664_1000031531 254
380 3300005564 Ga0070664_100419186 Ga0070664_1004191862 254
381 3300005578 Ga0068854_100470373 Ga0068854_1004703732 254
382 3300005615 Ga0070702_100006739 Ga0070702_1000067394 254
383 3300005615 Ga0070702_100024173 Ga0070702_1000241733 254
384 3300005617 Ga0068859_100014785 Ga0068859_1000147858 254
385 3300005617 Ga0068859_100175963 Ga0068859_1001759633 254
386 3300005617 Ga0068859_100346682 Ga0068859_1003466822 254
387 3300005618 Ga0068864_100002318 Ga0068864_1000023183 254
388 3300005618 Ga0068864_100056667 Ga0068864_1000566674 254
389 3300005618 Ga0068864_100099546 Ga0068864_1000995463 254
390 3300005718 Ga0068866_10053652 Ga0068866_100536522 254
391 3300005719 Ga0068861_100026187 Ga0068861_1000261873 254
392 3300005719 Ga0068861_100026857 Ga0068861_1000268573 254
393 3300005719 Ga0068861_100057256 Ga0068861_1000572562 254
394 3300005719 Ga0068861_100077237 Ga0068861_1000772373 254
395 3300005719 Ga0068861_100095243 Ga0068861_1000952433 254
396 3300005834 Ga0068851_10000471 Ga0068851_100004717 254
397 3300005840 Ga0068870_10006049 Ga0068870_100060494 254
398 3300005840 Ga0068870_10026226 Ga0068870_100262262 254
399 3300005841 Ga0068863_100000669 Ga0068863_1000006693 254
400 3300005841 Ga0068863_100480339 Ga0068863_1004803392 254
401 3300005843 Ga0068860_100040742 Ga0068860_1000407423 254
402 3300005843 Ga0068860_100071566 Ga0068860_1000715663 254
403 3300005844 Ga0068862_100009137 Ga0068862_1000091373 254
404 3300005844 Ga0068862_100012930 Ga0068862_1000129304 254
405 3300005844 Ga0068862_100018285 Ga0068862_1000182854 254
406 3300005844 Ga0068862_100412627 Ga0068862_1004126272 254
407 3300006051 Ga0075364_10187919 Ga0075364_101879192 254
408 3300006237 Ga0097621_100022710 Ga0097621_1000227103 254
409 3300006237 Ga0097621_100085538 Ga0097621_1000855382 254
410 3300006358 Ga0068871_100031521 Ga0068871_1000315213 254
411 3300006844 Ga0075428_100001451 Ga0075428_1000014516 254
412 3300006846 Ga0075430_100073376 Ga0075430_1000733762 254
413 3300006847 Ga0075431_100012402 Ga0075431_1000124026 254
414 3300006852 Ga0075433_10422960 Ga0075433_104229602 254
415 3300006880 Ga0075429_100010555 Ga0075429_1000105556 254
416 3300006881 Ga0068865_100051849 Ga0068865_1000518493 254
417 3300006881 Ga0068865_100090407 Ga0068865_1000904073 254
418 3300006881 Ga0068865_100268803 Ga0068865_1002688032 254
419 3300006931 Ga0097620_100014785 Ga0097620_1000147858 254
420 3300006931 Ga0097620_100175962 Ga0097620_1001759623 254
421 3300006931 Ga0097620_100346657 Ga0097620_1003466572 254
422 3300009094 Ga0111539_10004344 Ga0111539_1000434416 254
423 3300009148 Ga0105243_10104671 Ga0105243_101046711 254
424 3300009148 Ga0105243_10601043 Ga0105243_106010432 254
425 3300009176 Ga0105242_10159491 Ga0105242_101594913 254
426 3300009177 Ga0105248_10001157 Ga0105248_1000115726 254
427 3300009177 Ga0105248_10363459 Ga0105248_103634592 254
428 3300009551 Ga0105238_10382044 Ga0105238_103820442 254
429 3300009553 Ga0105249_10541710 Ga0105249_105417102 254
430 3300013296 Ga0157374_10418984 Ga0157374_104189841 254
431 3300013296 Ga0157374_10594519 Ga0157374_105945191 254
432 3300013297 Ga0157378_10056295 Ga0157378_100562952 254
433 3300013306 Ga0163162_10087883 Ga0163162_100878835 254
434 3300013306 Ga0163162_10211503 Ga0163162_102115033 254
435 3300013308 Ga0157375_10017828 Ga0157375_100178283 254
436 3300013308 Ga0157375_10094562 Ga0157375_100945623 254
437 3300013308 Ga0157375_10335280 Ga0157375_103352803 254
438 3300013308 Ga0157375_10539916 Ga0157375_105399162 254
439 3300014325 Ga0163163_10017551 Ga0163163_100175517 254
440 3300014325 Ga0163163_10024275 Ga0163163_100242754 254
441 3300014326 Ga0157380_10002823 Ga0157380_100028232 254
442 3300014326 Ga0157380_10013438 Ga0157380_100134385 254
443 3300014326 Ga0157380_10335501 Ga0157380_103355012 254
444 3300014745 Ga0157377_10250591 Ga0157377_102505911 254
445 3300014969 Ga0157376_10354312 Ga0157376_103543123 254
446 3300014969 Ga0157376_10485344 Ga0157376_104853441 254
447 3300014969 Ga0157376_10939444 Ga0157376_109394441 254
448 3300017792 Ga0163161_10058043 Ga0163161_100580432 254
449 3300017792 Ga0163161_10067352 Ga0163161_100673523 254
450 3300017792 Ga0163161_10391346 Ga0163161_103913461 254
451 3300025893 Ga0207682_10004828 Ga0207682_100048283 254
452 3300025893 Ga0207682_10006865 Ga0207682_100068654 254
453 3300025898 Ga0207692_10090477 Ga0207692_100904773 254
454 3300025899 Ga0207642_10162314 Ga0207642_101623142 254
455 3300025901 Ga0207688_10048537 Ga0207688_100485372 254
456 3300025907 Ga0207645_10008140 Ga0207645_100081403 254
457 3300025908 Ga0207643_10002859 Ga0207643_100028595 254
458 3300025908 Ga0207643_10261330 Ga0207643_102613301 254
459 3300025916 Ga0207663_10069550 Ga0207663_100695503 254
460 3300025918 Ga0207662_10015156 Ga0207662_100151565 254
461 3300025920 Ga0207649_10132809 Ga0207649_101328092 254
462 3300025923 Ga0207681_10035952 Ga0207681_100359523 254
463 3300025923 Ga0207681_10210126 Ga0207681_102101262 254
464 3300025925 Ga0207650_10143539 Ga0207650_101435393 254
465 3300025925 Ga0207650_10207340 Ga0207650_102073402 254
466 3300025926 Ga0207659_10012387 Ga0207659_100123872 254
467 3300025926 Ga0207659_10030591 Ga0207659_100305912 254
468 3300025926 Ga0207659_10469336 Ga0207659_104693362 254
469 3300025926 Ga0207659_10568502 Ga0207659_105685022 254
470 3300025931 Ga0207644_10124880 Ga0207644_101248802 254
471 3300025933 Ga0207706_10074555 Ga0207706_100745552 254
472 3300025936 Ga0207670_10047124 Ga0207670_100471243 254
473 3300025936 Ga0207670_10220934 Ga0207670_102209341 254
474 3300025937 Ga0207669_10010796 Ga0207669_100107962 254
475 3300025937 Ga0207669_10078323 Ga0207669_100783232 254
476 3300025938 Ga0207704_10141413 Ga0207704_101414133 254
477 3300025938 Ga0207704_10215131 Ga0207704_102151312 254
478 3300025938 Ga0207704_10348264 Ga0207704_103482641 254
479 3300025940 Ga0207691_10013086 Ga0207691_100130864 254
480 3300025940 Ga0207691_10065138 Ga0207691_100651384 254
481 3300025940 Ga0207691_10110205 Ga0207691_101102054 254
482 3300025941 Ga0207711_10006071 Ga0207711_100060712 254
483 3300025942 Ga0207689_10065958 Ga0207689_100659583 254
484 3300025942 Ga0207689_10119636 Ga0207689_101196363 254
485 3300025945 Ga0207679_10001705 Ga0207679_100017053 254
486 3300025960 Ga0207651_10017784 Ga0207651_100177841 254
487 3300025960 Ga0207651_10078569 Ga0207651_100785693 254
488 3300025972 Ga0207668_10523839 Ga0207668_105238391 254
489 3300025986 Ga0207658_10620593 Ga0207658_106205932 254
490 3300026023 Ga0207677_10085585 Ga0207677_100855854 254
491 3300026035 Ga0207703_10237675 Ga0207703_102376752 254
492 3300026041 Ga0207639_10633149 Ga0207639_106331492 254
493 3300026075 Ga0207708_10023307 Ga0207708_100233074 254
494 3300026075 Ga0207708_10045928 Ga0207708_100459283 254
495 3300026075 Ga0207708_10172081 Ga0207708_101720813 254
496 3300026088 Ga0207641_10463971 Ga0207641_104639711 254
497 3300026088 Ga0207641_10813312 Ga0207641_108133121 254
498 3300026089 Ga0207648_10023400 Ga0207648_100234004 254
499 3300026089 Ga0207648_10027409 Ga0207648_100274096 254
500 3300026089 Ga0207648_10308645 Ga0207648_103086452 254
501 3300026089 Ga0207648_10331072 Ga0207648_103310722 254
502 3300026095 Ga0207676_10048097 Ga0207676_100480973 254
503 3300026095 Ga0207676_10537228 Ga0207676_105372282 254
504 3300026118 Ga0207675_100024041 Ga0207675_1000240413 254
505 3300026118 Ga0207675_100042940 Ga0207675_1000429403 254
506 3300026118 Ga0207675_100054162 Ga0207675_1000541621 254
507 3300026118 Ga0207675_100121874 Ga0207675_1001218743 254
508 3300026118 Ga0207675_100138649 Ga0207675_1001386492 254
509 3300026121 Ga0207683_10038587 Ga0207683_100385873 254
510 3300026121 Ga0207683_10053089 Ga0207683_100530893 254
511 3300027252 Ga0209973_1011888 Ga0209973_10118881 254
512 3300027543 Ga0209999_1012934 Ga0209999_10129342 254
513 3300027907 Ga0207428_10034755 Ga0207428_100347552 254
514 3300028379 Ga0268266_10024293 Ga0268266_100242932 254
515 3300028379 Ga0268266_10034734 Ga0268266_100347343 254
516 3300028380 Ga0268265_10004326 Ga0268265_100043263 254
517 3300028380 Ga0268265_10007113 Ga0268265_100071136 254
518 3300028380 Ga0268265_10014927 Ga0268265_100149272 254
519 3300028380 Ga0268265_10167959 Ga0268265_101679592 254
520 3300028380 Ga0268265_10638154 Ga0268265_106381542 254
521 3300028794 Ga0307515_10362363 Ga0307515_103623631 254
522 3300031456 Ga0307513_10007437 Ga0307513_100074373 254
523 3300031456 Ga0307513_10018327 Ga0307513_100183274 254
524 3300031548 Ga0307408_100294398 Ga0307408_1002943981 254
525 3300031824 Ga0307413_10007747 Ga0307413_100077472 254
526 3300031824 Ga0307413_10133035 Ga0307413_101330352 254
527 3300031852 Ga0307410_10033919 Ga0307410_100339192 254
528 3300031901 Ga0307406_10006309 Ga0307406_100063092 254
529 3300031995 Ga0307409_100032279 Ga0307409_1000322794 254
530 3300032002 Ga0307416_100109376 Ga0307416_1001093763 254
531 3300032002 Ga0307416_100219624 Ga0307416_1002196242 254
532 3300032004 Ga0307414_10293009 Ga0307414_102930092 254
533 3300032005 Ga0307411_10040215 Ga0307411_100402152 254
534 3300032126 Ga0307415_100028253 Ga0307415_1000282532 254
535 3300035172 Ga0373955_0148008 Ga0373955_0148008_508_1275 254
536 3300035691 Ga0373931_0161963 Ga0373931_0161963_174_989 254
537 3300041451 Ga0451791_0832387 Ga0451791_0832387_1268_2035 254
538 3300041460 Ga0451802_1227194 Ga0451802_1227194_40_858 254
539 3300041486 Ga0451807_1278395 Ga0451807_1278395_614_1432 254
540 3300046457 Ga0495590_0003508 Ga0495590_0003508_5430_6197 254
541 3300046460 Ga0495638_0046248 Ga0495638_0046248_463_1230 254
542 3300046471 Ga0495650_0011525 Ga0495650_0011525_3045_3863 254
543 3300046471 Ga0495650_0108552 Ga0495650_0108552_59_829 254
544 3300046513 Ga0495616_0001490 Ga0495616_0001490_8494_9261 254
545 3300046615 Ga0495656_0095444 Ga0495656_0095444_237_1004 254
546 3300046660 Ga0495625_0032579 Ga0495625_0032579_2682_3449 254
547 3300046660 Ga0495625_0063084 Ga0495625_0063084_886_1695 254
548 3300046694 Ga0495649_0023307 Ga0495649_0023307_1643_2410 254
549 3300046694 Ga0495649_0063443 Ga0495649_0063443_1047_1814 254
550 3300046694 Ga0495649_0217454 Ga0495649_0217454_74_841 254
551 3300048907 Ga0496104_0289977 Ga0496104_0289977_702_1517 254
552 3300048915 Ga0496112_0073419 Ga0496112_0073419_48_863 254
553 3300049570 Ga0501033_0022293 Ga0501033_0022293_3626_4435 254
554 3300049573 Ga0501037_0206052 Ga0501037_0206052_334_1143 254
555 3300049574 Ga0501038_0014963 Ga0501038_0014963_3606_4415 254
556 3300049579 Ga0501043_0148018 Ga0501043_0148018_573_1382 254
557 3300049584 Ga0501068_0002289 Ga0501068_0002289_2880_3647 254
558 3300049586 Ga0501070_0010032 Ga0501070_0010032_6421_7188 254
559 3300049587 Ga0501071_0006079 Ga0501071_0006079_1525_2292 254
560 3300049588 Ga0501072_0045113 Ga0501072_0045113_45_812 254
561 3300049589 Ga0501073_0031708 Ga0501073_0031708_2989_3756 254
562 3300049590 Ga0501074_0000122 Ga0501074_0000122_4553_5320 254
563 3300049592 Ga0501076_0003260 Ga0501076_0003260_7738_8505 254
564 3300049593 Ga0501077_0012335 Ga0501077_0012335_2328_3095 254
565 3300049742 Ga0501080_0009990 Ga0501080_0009990_5149_5916 254
566 3300049744 Ga0501083_0021903 Ga0501083_0021903_1487_2254 254
567 3300049822 Ga0501035_0070638 Ga0501035_0070638_1042_1851 254
568 3300049823 Ga0501044_0368423 Ga0501044_0368423_419_1228 254
569 3300050508 nmdc:mga09592_3569_c1 nmdc:mga09592_3569_c1_914_1708 254
570 3300050509 nmdc:mga0qj67_306244_c1 nmdc:mga0qj67_306244_c1_373_1167 254
571 3300050510 nmdc:mga06r32_29_c1 nmdc:mga06r32_29_c1_3371_4165 254
572 3300050511 nmdc:mga08y16_1085_c1 nmdc:mga08y16_1085_c1_17345_18139 254
573 3300050511 nmdc:mga08y16_620164_c1 nmdc:mga08y16_620164_c1_62_829 254
574 3300053156 Ga0500622_0002376 Ga0500622_0002376_1693_2544 254
575 3300053156 Ga0500622_0021105 Ga0500622_0021105_1136_1987 254
576 3300054114 Ga0501084_0071684 Ga0501084_0071684_1020_1787 254
577 3300060353 Ga0501082_0006985 Ga0501082_0006985_2627_3394 254
578 3300061734 Ga0530510_0081160 Ga0530510_0081160_218_985 254
579 3300005288 Ga0065714_10072134 Ga0065714_100721342 255
580 3300032004 Ga0307414_10000722 Ga0307414_1000072215 255
581 3300044712 Ga0453684_0339806 Ga0453684_0339806_468_1241 255
582 2162886007 SwRhRL2b_contig_493616 SwRhRL2b_0792.00006030 256
583 3300002773 JGI25152J39213_1000056 JGI25152J39213_100005650 256
584 3300002774 JGI25150J39212_1000009 JGI25150J39212_100000918 256
585 3300003187 JGI25151J46595_10000017 JGI25151J46595_1000001718 256
586 3300003215 JGI25153J46596_10000023 JGI25153J46596_10000023219 256
587 3300003323 rootH1_10197067 rootH1_101970673 256
588 3300003781 Ga0055536_1000030 Ga0055536_1000030106 256
589 3300003791 Ga0055530_10002863 Ga0055530_100028633 256
590 3300005288 Ga0065714_10002192 Ga0065714_1000219232 256
591 3300005288 Ga0065714_10003657 Ga0065714_1000365714 256
592 3300005288 Ga0065714_10008213 Ga0065714_100082133 256
593 3300005288 Ga0065714_10064664 Ga0065714_1006466412 256
594 3300005288 Ga0065714_10064897 Ga0065714_100648976 256
595 3300005289 Ga0065704_10000193 Ga0065704_1000019360 256
596 3300005289 Ga0065704_10088158 Ga0065704_100881582 256
597 3300009036 Ga0105244_10051457 Ga0105244_100514572 256
598 3300009545 Ga0105237_10034815 Ga0105237_100348155 256
599 3300013100 Ga0157373_10000136 Ga0157373_1000013612 256
600 3300013100 Ga0157373_10005081 Ga0157373_100050819 256
601 3300013100 Ga0157373_10016193 Ga0157373_100161938 256
602 3300013100 Ga0157373_10138343 Ga0157373_101383432 256
603 3300013102 Ga0157371_10000034 Ga0157371_1000003416 256
604 3300013102 Ga0157371_10003233 Ga0157371_100032336 256
605 3300013102 Ga0157371_10008786 Ga0157371_100087865 256
606 3300013102 Ga0157371_10017967 Ga0157371_100179675 256
607 3300013104 Ga0157370_10003221 Ga0157370_100032214 256
608 3300013104 Ga0157370_10005022 Ga0157370_100050229 256
609 3300013104 Ga0157370_10008391 Ga0157370_1000839110 256
610 3300013104 Ga0157370_10020179 Ga0157370_100201791 256
611 3300013104 Ga0157370_10053620 Ga0157370_100536204 256
612 3300013104 Ga0157370_10080579 Ga0157370_100805793 256
613 3300013104 Ga0157370_10113186 Ga0157370_101131862 256
614 3300013104 Ga0157370_10265454 Ga0157370_102654542 256
615 3300013104 Ga0157370_10273953 Ga0157370_102739532 256
616 3300013105 Ga0157369_10000002 Ga0157369_10000002275 256
617 3300013105 Ga0157369_10030662 Ga0157369_100306624 256
618 3300013306 Ga0163162_10121857 Ga0163162_101218572 256
619 3300014497 Ga0182008_10000018 Ga0182008_10000018141 256
620 3300014497 Ga0182008_10000524 Ga0182008_100005249 256
621 3300014497 Ga0182008_10001182 Ga0182008_100011826 256
622 3300015261 Ga0182006_1000382 Ga0182006_100038228 256
623 3300015261 Ga0182006_1002866 Ga0182006_10028667 256
624 3300015261 Ga0182006_1007137 Ga0182006_10071374 256
625 3300015262 Ga0182007_10000001 Ga0182007_10000001496 256
626 3300015682 Ga0183373_1010 Ga0183373_1010160 256
627 3300017792 Ga0163161_10000153 Ga0163161_1000015347 256
628 3300017792 Ga0163161_10000211 Ga0163161_1000021142 256
629 3300017792 Ga0163161_10000218 Ga0163161_1000021814 256
630 3300017792 Ga0163161_10001606 Ga0163161_100016066 256
631 3300017792 Ga0163161_10034090 Ga0163161_100340902 256
632 3300017792 Ga0163161_10490799 Ga0163161_104907991 256
633 3300025245 Ga0207425_1000007 Ga0207425_1000007535 256
634 3300025258 Ga0209129_1000006 Ga0209129_1000006535 256
635 3300025292 Ga0209676_1000001 Ga0209676_1000001992 256
636 3300025294 Ga0209025_1000025 Ga0209025_1000025365 256
637 3300025297 Ga0209758_1000016 Ga0209758_1000016535 256
638 3300025298 Ga0209050_1000018 Ga0209050_1000018591 256
639 3300025914 Ga0207671_10020108 Ga0207671_100201082 256
640 3300028794 Ga0307515_10051252 Ga0307515_100512525 256
641 3300030744 Ga0316181_1173906 Ga0316181_11739061 256
642 3300031731 Ga0307405_10000046 Ga0307405_1000004639 256
643 3300031903 Ga0307407_10000090 Ga0307407_1000009026 256
644 3300031911 Ga0307412_10000077 Ga0307412_1000007729 256
645 3300031911 Ga0307412_10550802 Ga0307412_105508021 256
646 3300031995 Ga0307409_100036344 Ga0307409_1000363445 256
647 3300032002 Ga0307416_100000195 Ga0307416_10000019525 256
648 3300032004 Ga0307414_10001142 Ga0307414_100011421 256
649 3300032004 Ga0307414_10006868 Ga0307414_100068684 256
650 3300032004 Ga0307414_10009803 Ga0307414_100098032 256
651 3300046507 Ga0495606_0252855 Ga0495606_0252855_190_960 256
652 3300046512 Ga0495610_0000126 Ga0495610_0000126_67747_68517 256
653 3300046512 Ga0495610_0001202 Ga0495610_0001202_2808_3578 256
654 3300046538 Ga0495609_0012187 Ga0495609_0012187_3163_3933 256
655 3300048925 Ga0496122_0000746 Ga0496122_0000746_2306_3076 256
656 3300048928 Ga0496125_0022164 Ga0496125_0022164_240_1010 256
657 3300049571 Ga0501034_0069399 Ga0501034_0069399_2353_3138 256
658 3300049758 Ga0501241_001635 Ga0501241_001635_993_1763 256
659 3300049758 Ga0501241_010730 Ga0501241_010730_576_1346 256
660 3300053093 Ga0500651_0000127 Ga0500651_0000127_46224_46994 256
661 iso_pu_bacteria 2902048731 2902051780 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02592

Vut_1

Putative vitamin uptake transporter

106

279

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v2c-assembly1.cif.gz_V active state complex i from q10 dataset 0.5098 72 231
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.4903 8 235
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.4837 8 235
6zkb-assembly1.cif.gz_V membrane domain of closed complex i during turnover 0.4675 73 231
7v2c-assembly1.cif.gz_V active state complex i from q10 dataset 0.4604 72 231
ID Description Score Start End Superfamily
af_Q2FYK0_57_218_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.824 59 232 1.10.1760.20
af_Q2FYK0_57_218_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8151 59 232 1.10.1760.20
af_A4HUL3_67_268_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.6764 136 244 1.50.40.10
af_K7N2M1_4_109_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.5377 136 223 1.20.1080.10
af_Q5JJW1_207_373_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5221 128 256 1.50.40.10
ID Description Score Start End GO Terms
AF-A0A829YMQ2-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.9566 4 253 GO:0005886
GO:0022857
GO:1990397
AF-A0A6G7ZU14-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.938 4 256 GO:0005886
GO:0022857
GO:1990397
AF-A0A537KNF1-F1-model_v4 Queuosine precursor transporter 0.929 4 155 GO:0016020
GO:1990397
AF-A0A521WBU0-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.9286 5 253 GO:0005886
GO:0022857
GO:1990397
AF-A0A7X7JWI0-F1-model_v4 Queuosine precursor transporter 0.9265 13 196 GO:0016020
GO:1990397

Feature Viewer

pLDDT pTM Quality
89.52 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map