F473540
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 663 | 254 | 663 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_102068931|Ga0070663_1020689311 |
| Length | 145 |
| Sequence | MHVPASSPPTGRSGPVCKSKGENVPRVKRGTGRRDYRRKTLRLAKGFFLTKSKLNRAAQEAVEKALRYGYVGRRRKKRDFRSLWIVRINAACRTSEISYSKFISGLKRAGIDLNRKVLADIAVNDGPGFQTLVEKAKAAHQAQLQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 101 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 163 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 168 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 170 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 188 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 191 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 194 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 195 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 196 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 222 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.89 |
| Metatranscriptomes | 2.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.36 |
| Rhizosphere | 92.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058861_11975732 | 3300004800 | Bacteria | 1213 |
| 2 | Ga0058862_12552942 | 3300004803 | Bacteria | 734 |
| 3 | Ga0070658_10531955 | 3300005327 | Bacteria | 1016 |
| 4 | Ga0070658_10605987 | 3300005327 | Unclassified | 949 |
| 5 | Ga0070676_10192556 | 3300005328 | Unclassified | 1332 |
| 6 | Ga0070683_100195529 | 3300005329 | Unclassified | 1920 |
| 7 | Ga0070683_100295948 | 3300005329 | Bacteria | 1539 |
| 8 | Ga0070683_100888707 | 3300005329 | Unclassified | 855 |
| 9 | Ga0070683_101342436 | 3300005329 | Bacteria | 687 |
| 10 | Ga0070690_100136936 | 3300005330 | Bacteria | 1659 |
| 11 | Ga0068869_101398968 | 3300005334 | Bacteria | 619 |
| 12 | Ga0070666_10006360 | 3300005335 | Bacteria | 7266 |
| 13 | Ga0070666_11302483 | 3300005335 | Bacteria | 542 |
| 14 | Ga0070680_100018669 | 3300005336 | Bacteria | 5484 |
| 15 | Ga0070680_100192715 | 3300005336 | Bacteria | 1718 |
| 16 | Ga0070680_100347628 | 3300005336 | Bacteria | 1261 |
| 17 | Ga0070680_100467265 | 3300005336 | Unclassified | 1078 |
| 18 | Ga0070680_100789994 | 3300005336 | Unclassified | 818 |
| 19 | Ga0068868_100018643 | 3300005338 | Bacteria | 5193 |
| 20 | Ga0068868_100023331 | 3300005338 | Unclassified | 4681 |
| 21 | Ga0068868_100771077 | 3300005338 | Unclassified | 866 |
| 22 | Ga0068868_100774620 | 3300005338 | Unclassified | 864 |
| 23 | Ga0068868_101288376 | 3300005338 | Bacteria | 678 |
| 24 | Ga0070660_100008288 | 3300005339 | Bacteria | 7264 |
| 25 | Ga0070660_100956126 | 3300005339 | Bacteria | 723 |
| 26 | Ga0070689_100155629 | 3300005340 | Bacteria | 1845 |
| 27 | Ga0070689_100505631 | 3300005340 | Bacteria | 1036 |
| 28 | Ga0070689_100575410 | 3300005340 | Bacteria | 973 |
| 29 | Ga0070689_100773520 | 3300005340 | Bacteria | 843 |
| 30 | Ga0070689_100786052 | 3300005340 | Bacteria | 836 |
| 31 | Ga0070691_10118374 | 3300005341 | Unclassified | 1331 |
| 32 | Ga0070661_100123457 | 3300005344 | Unclassified | 1941 |
| 33 | Ga0070661_100197857 | 3300005344 | Bacteria | 1534 |
| 34 | Ga0070661_100231954 | 3300005344 | Unclassified | 1419 |
| 35 | Ga0070661_100401851 | 3300005344 | Bacteria | 1083 |
| 36 | Ga0070661_100409291 | 3300005344 | Unclassified | 1073 |
| 37 | Ga0070661_100587031 | 3300005344 | Bacteria | 900 |
| 38 | Ga0070692_10215163 | 3300005345 | Bacteria | 1133 |
| 39 | Ga0070675_101291418 | 3300005354 | Bacteria | 672 |
| 40 | Ga0070671_100099394 | 3300005355 | Unclassified | 2441 |
| 41 | Ga0070671_100126574 | 3300005355 | Unclassified | 2151 |
| 42 | Ga0070671_100280752 | 3300005355 | Unclassified | 1416 |
| 43 | Ga0070671_100901345 | 3300005355 | Bacteria | 772 |
| 44 | Ga0070674_100943576 | 3300005356 | Unclassified | 754 |
| 45 | Ga0070673_100601742 | 3300005364 | Bacteria | 1003 |
| 46 | Ga0070673_101709683 | 3300005364 | Bacteria | 595 |
| 47 | Ga0070659_100139029 | 3300005366 | Unclassified | 1977 |
| 48 | Ga0070659_100166462 | 3300005366 | Unclassified | 1804 |
| 49 | Ga0070667_100349338 | 3300005367 | Unclassified | 1339 |
| 50 | Ga0070667_100469659 | 3300005367 | Unclassified | 1151 |
| 51 | Ga0070667_100580878 | 3300005367 | Bacteria | 1031 |
| 52 | Ga0070709_10020709 | 3300005434 | Bacteria | 3822 |
| 53 | Ga0070709_11005761 | 3300005434 | Unclassified | 663 |
| 54 | Ga0070714_100069781 | 3300005435 | Unclassified | 3036 |
| 55 | Ga0070714_100146572 | 3300005435 | Bacteria | 2124 |
| 56 | Ga0070714_100732895 | 3300005435 | Bacteria | 955 |
| 57 | Ga0070713_101540378 | 3300005436 | Unclassified | 645 |
| 58 | Ga0070710_10458279 | 3300005437 | Bacteria | 866 |
| 59 | Ga0070711_100032596 | 3300005439 | Bacteria | 3465 |
| 60 | Ga0070694_100042459 | 3300005444 | Bacteria | 3038 |
| 61 | Ga0070708_100882570 | 3300005445 | Bacteria | 840 |
| 62 | Ga0070663_100080656 | 3300005455 | Unclassified | 2390 |
| 63 | Ga0070663_100476034 | 3300005455 | Bacteria | 1033 |
| 64 | Ga0070663_101882517 | 3300005455 | Bacteria | 537 |
| 65 | Ga0070663_102068931 | 3300005455 | Unclassified | 513 |
| 66 | Ga0070678_100092641 | 3300005456 | Unclassified | 2322 |
| 67 | Ga0070678_101999017 | 3300005456 | Unclassified | 548 |
| 68 | Ga0070662_100025113 | 3300005457 | Unclassified | 4111 |
| 69 | Ga0070662_101618970 | 3300005457 | Unclassified | 559 |
| 70 | Ga0070681_10028097 | 3300005458 | Bacteria | 5655 |
| 71 | Ga0070681_10139831 | 3300005458 | Unclassified | 2351 |
| 72 | Ga0070681_10180010 | 3300005458 | Bacteria | 2035 |
| 73 | Ga0070681_10255979 | 3300005458 | Bacteria | 1663 |
| 74 | Ga0070681_10334353 | 3300005458 | Bacteria | 1424 |
| 75 | Ga0070681_10460474 | 3300005458 | Bacteria | 1184 |
| 76 | Ga0070681_10822276 | 3300005458 | Bacteria | 846 |
| 77 | Ga0068867_100057154 | 3300005459 | Unclassified | 2889 |
| 78 | Ga0068867_100081357 | 3300005459 | Bacteria | 2442 |
| 79 | Ga0068867_101794928 | 3300005459 | Unclassified | 577 |
| 80 | Ga0070685_10734698 | 3300005466 | Bacteria | 722 |
| 81 | Ga0070707_102224400 | 3300005468 | Unclassified | 516 |
| 82 | Ga0070679_100087651 | 3300005530 | Bacteria | 3100 |
| 83 | Ga0070679_102037765 | 3300005530 | Bacteria | 523 |
| 84 | Ga0070684_100014596 | 3300005535 | Bacteria | 6369 |
| 85 | Ga0070684_100173569 | 3300005535 | Unclassified | 1958 |
| 86 | Ga0070684_100517949 | 3300005535 | Unclassified | 1105 |
| 87 | Ga0070684_100739081 | 3300005535 | Bacteria | 918 |
| 88 | Ga0068853_100037198 | 3300005539 | Bacteria | 4141 |
| 89 | Ga0068853_100047771 | 3300005539 | Bacteria | 3674 |
| 90 | Ga0068853_100343677 | 3300005539 | Bacteria | 1387 |
| 91 | Ga0068853_100413171 | 3300005539 | Unclassified | 1264 |
| 92 | Ga0068853_100672288 | 3300005539 | Unclassified | 986 |
| 93 | Ga0070672_100262346 | 3300005543 | Bacteria | 1457 |
| 94 | Ga0070672_100506352 | 3300005543 | Bacteria | 1045 |
| 95 | Ga0070672_101132998 | 3300005543 | Bacteria | 696 |
| 96 | Ga0070686_100212809 | 3300005544 | Bacteria | 1392 |
| 97 | Ga0070695_100016604 | 3300005545 | Bacteria | 4459 |
| 98 | Ga0070696_100497734 | 3300005546 | Unclassified | 969 |
| 99 | Ga0070696_101599923 | 3300005546 | Unclassified | 560 |
| 100 | Ga0070693_100289739 | 3300005547 | Bacteria | 1100 |
| 101 | Ga0070665_100012183 | 3300005548 | Bacteria | 8670 |
| 102 | Ga0070665_100092473 | 3300005548 | Bacteria | 3029 |
| 103 | Ga0070665_100195190 | 3300005548 | Bacteria | 2025 |
| 104 | Ga0070665_100279803 | 3300005548 | Unclassified | 1670 |
| 105 | Ga0070704_100370836 | 3300005549 | Bacteria | 1214 |
| 106 | Ga0070704_101209843 | 3300005549 | Bacteria | 689 |
| 107 | Ga0068855_100010330 | 3300005563 | Bacteria | 11257 |
| 108 | Ga0068855_100049370 | 3300005563 | Bacteria | 4963 |
| 109 | Ga0068855_100115444 | 3300005563 | Unclassified | 3078 |
| 110 | Ga0068855_100211219 | 3300005563 | Bacteria | 2181 |
| 111 | Ga0068855_100213986 | 3300005563 | Bacteria | 2164 |
| 112 | Ga0068855_100568609 | 3300005563 | Bacteria | 1225 |
| 113 | Ga0068855_100605453 | 3300005563 | Bacteria | 1181 |
| 114 | Ga0070664_100042923 | 3300005564 | Bacteria | 3816 |
| 115 | Ga0070664_100155410 | 3300005564 | Unclassified | 2021 |
| 116 | Ga0070664_100242323 | 3300005564 | Bacteria | 1619 |
| 117 | Ga0068857_100001847 | 3300005577 | Bacteria | 17049 |
| 118 | Ga0068857_100058439 | 3300005577 | Unclassified | 3424 |
| 119 | Ga0068857_100065032 | 3300005577 | Unclassified | 3242 |
| 120 | Ga0068857_100499715 | 3300005577 | Unclassified | 1141 |
| 121 | Ga0068857_100670809 | 3300005577 | Unclassified | 983 |
| 122 | Ga0068857_100807219 | 3300005577 | Bacteria | 896 |
| 123 | Ga0068854_100062060 | 3300005578 | Unclassified | 2708 |
| 124 | Ga0068856_100029579 | 3300005614 | Bacteria | 5351 |
| 125 | Ga0068856_100033181 | 3300005614 | Bacteria | 5055 |
| 126 | Ga0068856_100062282 | 3300005614 | Bacteria | 3685 |
| 127 | Ga0068856_100169426 | 3300005614 | Unclassified | 2196 |
| 128 | Ga0068856_100310341 | 3300005614 | Unclassified | 1595 |
| 129 | Ga0068856_100446216 | 3300005614 | Bacteria | 1314 |
| 130 | Ga0068856_101033466 | 3300005614 | Bacteria | 840 |
| 131 | Ga0068856_101452587 | 3300005614 | Bacteria | 700 |
| 132 | Ga0070702_101013441 | 3300005615 | Unclassified | 658 |
| 133 | Ga0068852_100028325 | 3300005616 | Bacteria | 4582 |
| 134 | Ga0068852_100404776 | 3300005616 | Bacteria | 1343 |
| 135 | Ga0068852_101617479 | 3300005616 | Bacteria | 670 |
| 136 | Ga0068859_100046390 | 3300005617 | Bacteria | 4364 |
| 137 | Ga0068859_100130525 | 3300005617 | Bacteria | 2584 |
| 138 | Ga0068859_100240242 | 3300005617 | Unclassified | 1900 |
| 139 | Ga0068859_100284326 | 3300005617 | Bacteria | 1747 |
| 140 | Ga0068859_100285860 | 3300005617 | Bacteria | 1742 |
| 141 | Ga0068859_101281297 | 3300005617 | Bacteria | 808 |
| 142 | Ga0068864_100019910 | 3300005618 | Bacteria | 5609 |
| 143 | Ga0068864_100317252 | 3300005618 | Unclassified | 1463 |
| 144 | Ga0068866_10014578 | 3300005718 | Unclassified | 3475 |
| 145 | Ga0068866_10879860 | 3300005718 | Bacteria | 628 |
| 146 | Ga0068861_100098234 | 3300005719 | Bacteria | 2324 |
| 147 | Ga0068861_101960703 | 3300005719 | Unclassified | 583 |
| 148 | Ga0068863_100009340 | 3300005841 | Bacteria | 9571 |
| 149 | Ga0068863_100066148 | 3300005841 | Bacteria | 3419 |
| 150 | Ga0068863_100137585 | 3300005841 | Bacteria | 2333 |
| 151 | Ga0068863_102355958 | 3300005841 | Unclassified | 542 |
| 152 | Ga0068858_100000755 | 3300005842 | Bacteria | 33931 |
| 153 | Ga0068858_100008800 | 3300005842 | Bacteria | 9680 |
| 154 | Ga0068858_100055115 | 3300005842 | Bacteria | 3675 |
| 155 | Ga0068858_100911467 | 3300005842 | Bacteria | 860 |
| 156 | Ga0068858_100973907 | 3300005842 | Bacteria | 831 |
| 157 | Ga0068860_100001833 | 3300005843 | Bacteria | 22649 |
| 158 | Ga0068860_100021448 | 3300005843 | Bacteria | 6254 |
| 159 | Ga0068860_100047825 | 3300005843 | Unclassified | 4077 |
| 160 | Ga0068860_100542696 | 3300005843 | Bacteria | 1164 |
| 161 | Ga0068860_101757340 | 3300005843 | Bacteria | 642 |
| 162 | Ga0068860_102251113 | 3300005843 | Bacteria | 566 |
| 163 | Ga0081455_10062775 | 3300005937 | Bacteria | 3121 |
| 164 | Ga0070717_10004755 | 3300006028 | Bacteria | 9873 |
| 165 | Ga0070717_10905983 | 3300006028 | Bacteria | 803 |
| 166 | Ga0070716_100454196 | 3300006173 | Unclassified | 935 |
| 167 | Ga0070716_101762491 | 3300006173 | Unclassified | 512 |
| 168 | Ga0070712_100135808 | 3300006175 | Unclassified | 1870 |
| 169 | Ga0097621_100001558 | 3300006237 | Bacteria | 15662 |
| 170 | Ga0097621_100036842 | 3300006237 | Unclassified | 3915 |
| 171 | Ga0097621_100080168 | 3300006237 | Bacteria | 2715 |
| 172 | Ga0097621_100184195 | 3300006237 | Bacteria | 1805 |
| 173 | Ga0097621_100206923 | 3300006237 | Unclassified | 1705 |
| 174 | Ga0097621_100239974 | 3300006237 | Bacteria | 1584 |
| 175 | Ga0097621_100470791 | 3300006237 | Bacteria | 1134 |
| 176 | Ga0068871_100019220 | 3300006358 | Bacteria | 5214 |
| 177 | Ga0068871_100034190 | 3300006358 | Bacteria | 4032 |
| 178 | Ga0068871_100040183 | 3300006358 | Bacteria | 3746 |
| 179 | Ga0068871_100070019 | 3300006358 | Bacteria | 2882 |
| 180 | Ga0068871_100118187 | 3300006358 | Bacteria | 2236 |
| 181 | Ga0068871_100180177 | 3300006358 | Unclassified | 1815 |
| 182 | Ga0068871_100393295 | 3300006358 | Unclassified | 1233 |
| 183 | Ga0068871_101240311 | 3300006358 | Unclassified | 700 |
| 184 | Ga0075428_100355844 | 3300006844 | Unclassified | 1571 |
| 185 | Ga0075430_100019462 | 3300006846 | Bacteria | 5773 |
| 186 | Ga0075430_100039933 | 3300006846 | Bacteria | 3972 |
| 187 | Ga0075431_100144240 | 3300006847 | Unclassified | 2454 |
| 188 | Ga0075431_100317371 | 3300006847 | Bacteria | 1572 |
| 189 | Ga0075429_100155445 | 3300006880 | Unclassified | 2003 |
| 190 | Ga0075429_100369932 | 3300006880 | Bacteria | 1255 |
| 191 | Ga0068865_100030468 | 3300006881 | Unclassified | 3589 |
| 192 | Ga0068865_101370629 | 3300006881 | Bacteria | 631 |
| 193 | Ga0097620_100046390 | 3300006931 | Bacteria | 4364 |
| 194 | Ga0097620_100130522 | 3300006931 | Bacteria | 2584 |
| 195 | Ga0097620_100240225 | 3300006931 | Unclassified | 1900 |
| 196 | Ga0097620_100284327 | 3300006931 | Bacteria | 1747 |
| 197 | Ga0097620_100285852 | 3300006931 | Bacteria | 1742 |
| 198 | Ga0097620_101281309 | 3300006931 | Bacteria | 808 |
| 199 | Ga0099795_10162265 | 3300007788 | Bacteria | 923 |
| 200 | Ga0105240_10002787 | 3300009093 | Bacteria | 27631 |
| 201 | Ga0105240_10090805 | 3300009093 | Bacteria | 3732 |
| 202 | Ga0105240_10499161 | 3300009093 | Bacteria | 1353 |
| 203 | Ga0105240_10619423 | 3300009093 | Bacteria | 1190 |
| 204 | Ga0105240_11016622 | 3300009093 | Unclassified | 886 |
| 205 | Ga0105240_11135487 | 3300009093 | Bacteria | 830 |
| 206 | Ga0105240_11146561 | 3300009093 | Bacteria | 825 |
| 207 | Ga0105240_11688889 | 3300009093 | Bacteria | 661 |
| 208 | Ga0105245_10004913 | 3300009098 | Bacteria | 11763 |
| 209 | Ga0105245_10058904 | 3300009098 | Unclassified | 3458 |
| 210 | Ga0105245_10109467 | 3300009098 | Bacteria | 2567 |
| 211 | Ga0105245_10278380 | 3300009098 | Bacteria | 1634 |
| 212 | Ga0105245_10306157 | 3300009098 | Bacteria | 1561 |
| 213 | Ga0105245_10361442 | 3300009098 | Unclassified | 1441 |
| 214 | Ga0105245_11354416 | 3300009098 | Bacteria | 761 |
| 215 | Ga0105245_11447291 | 3300009098 | Bacteria | 737 |
| 216 | Ga0105247_10275450 | 3300009101 | Bacteria | 1159 |
| 217 | Ga0105243_10188521 | 3300009148 | Bacteria | 1799 |
| 218 | Ga0105243_11395399 | 3300009148 | Unclassified | 721 |
| 219 | Ga0105241_10012575 | 3300009174 | Bacteria | 6210 |
| 220 | Ga0105241_10028194 | 3300009174 | Bacteria | 4183 |
| 221 | Ga0105241_10054670 | 3300009174 | Unclassified | 3057 |
| 222 | Ga0105241_10096179 | 3300009174 | Unclassified | 2346 |
| 223 | Ga0105241_11151255 | 3300009174 | Bacteria | 733 |
| 224 | Ga0105242_10041533 | 3300009176 | Unclassified | 3710 |
| 225 | Ga0105242_10049623 | 3300009176 | Unclassified | 3416 |
| 226 | Ga0105242_10229351 | 3300009176 | Unclassified | 1664 |
| 227 | Ga0105242_10844648 | 3300009176 | Unclassified | 911 |
| 228 | Ga0105242_11322767 | 3300009176 | Bacteria | 745 |
| 229 | Ga0105248_10005725 | 3300009177 | Bacteria | 13642 |
| 230 | Ga0105248_10040530 | 3300009177 | Bacteria | 5221 |
| 231 | Ga0105248_10102838 | 3300009177 | Unclassified | 3220 |
| 232 | Ga0105248_10142004 | 3300009177 | Unclassified | 2709 |
| 233 | Ga0105248_10407494 | 3300009177 | Bacteria | 1531 |
| 234 | Ga0105248_10607861 | 3300009177 | Bacteria | 1233 |
| 235 | Ga0105248_10687180 | 3300009177 | Bacteria | 1154 |
| 236 | Ga0105248_11003796 | 3300009177 | Bacteria | 943 |
| 237 | Ga0105248_11150061 | 3300009177 | Bacteria | 877 |
| 238 | Ga0105237_10004101 | 3300009545 | Bacteria | 16988 |
| 239 | Ga0105237_10162513 | 3300009545 | Unclassified | 2232 |
| 240 | Ga0105237_10188416 | 3300009545 | Bacteria | 2063 |
| 241 | Ga0105237_10426966 | 3300009545 | Unclassified | 1331 |
| 242 | Ga0105237_11026884 | 3300009545 | Bacteria | 831 |
| 243 | Ga0105237_12170977 | 3300009545 | Bacteria | 565 |
| 244 | Ga0105238_10007888 | 3300009551 | Bacteria | 10652 |
| 245 | Ga0105238_10024897 | 3300009551 | Bacteria | 6099 |
| 246 | Ga0105238_10487384 | 3300009551 | Bacteria | 1233 |
| 247 | Ga0105249_10521510 | 3300009553 | Bacteria | 1236 |
| 248 | Ga0105249_12204392 | 3300009553 | Bacteria | 624 |
| 249 | Ga0105239_10034942 | 3300010375 | Bacteria | 5520 |
| 250 | Ga0105239_10085123 | 3300010375 | Bacteria | 3484 |
| 251 | Ga0105239_10266158 | 3300010375 | Bacteria | 1927 |
| 252 | Ga0105239_10405486 | 3300010375 | Unclassified | 1543 |
| 253 | Ga0105239_10801982 | 3300010375 | Bacteria | 1079 |
| 254 | Ga0105239_10921552 | 3300010375 | Unclassified | 1003 |
| 255 | Ga0105246_10102195 | 3300011119 | Bacteria | 2089 |
| 256 | Ga0105246_10169109 | 3300011119 | Bacteria | 1672 |
| 257 | Ga0105246_10344843 | 3300011119 | Bacteria | 1218 |
| 258 | Ga0105246_11048947 | 3300011119 | Unclassified | 741 |
| 259 | Ga0157373_10082321 | 3300013100 | Bacteria | 2269 |
| 260 | Ga0157373_10222800 | 3300013100 | Bacteria | 1331 |
| 261 | Ga0157373_10286718 | 3300013100 | Bacteria | 1168 |
| 262 | Ga0157371_10933366 | 3300013102 | Bacteria | 659 |
| 263 | Ga0157370_10002147 | 3300013104 | Bacteria | 24104 |
| 264 | Ga0157370_10023389 | 3300013104 | Bacteria | 6134 |
| 265 | Ga0157370_10295224 | 3300013104 | Bacteria | 1497 |
| 266 | Ga0157370_10317500 | 3300013104 | Bacteria | 1437 |
| 267 | Ga0157370_10328247 | 3300013104 | Bacteria | 1411 |
| 268 | Ga0157370_10329604 | 3300013104 | Bacteria | 1408 |
| 269 | Ga0157369_10013033 | 3300013105 | Bacteria | 9418 |
| 270 | Ga0157369_10043143 | 3300013105 | Unclassified | 4917 |
| 271 | Ga0157369_10104855 | 3300013105 | Unclassified | 3010 |
| 272 | Ga0157369_10216259 | 3300013105 | Bacteria | 2007 |
| 273 | Ga0157369_10235210 | 3300013105 | Bacteria | 1915 |
| 274 | Ga0157369_10677113 | 3300013105 | Bacteria | 1063 |
| 275 | Ga0157374_10048728 | 3300013296 | Unclassified | 3932 |
| 276 | Ga0157374_10052188 | 3300013296 | Unclassified | 3807 |
| 277 | Ga0157374_10172683 | 3300013296 | Bacteria | 2109 |
| 278 | Ga0157374_11225069 | 3300013296 | Bacteria | 772 |
| 279 | Ga0157374_12543211 | 3300013296 | Unclassified | 539 |
| 280 | Ga0157378_10013083 | 3300013297 | Bacteria | 7259 |
| 281 | Ga0157378_10059883 | 3300013297 | Bacteria | 3398 |
| 282 | Ga0157378_10587194 | 3300013297 | Unclassified | 1124 |
| 283 | Ga0157378_10604789 | 3300013297 | Unclassified | 1108 |
| 284 | Ga0157378_11240793 | 3300013297 | Bacteria | 786 |
| 285 | Ga0163162_10082249 | 3300013306 | Bacteria | 3292 |
| 286 | Ga0163162_10090556 | 3300013306 | Bacteria | 3140 |
| 287 | Ga0163162_10688685 | 3300013306 | Bacteria | 1144 |
| 288 | Ga0163162_11029248 | 3300013306 | Unclassified | 932 |
| 289 | Ga0163162_11946601 | 3300013306 | Unclassified | 673 |
| 290 | Ga0157372_10140298 | 3300013307 | Unclassified | 2784 |
| 291 | Ga0157372_10366688 | 3300013307 | Unclassified | 1678 |
| 292 | Ga0157372_10371822 | 3300013307 | Bacteria | 1666 |
| 293 | Ga0157372_10697203 | 3300013307 | Unclassified | 1182 |
| 294 | Ga0157372_11645972 | 3300013307 | Unclassified | 739 |
| 295 | Ga0157372_11902025 | 3300013307 | Bacteria | 684 |
| 296 | Ga0157375_10342448 | 3300013308 | Unclassified | 1660 |
| 297 | Ga0157375_10490049 | 3300013308 | Bacteria | 1394 |
| 298 | Ga0157375_11081270 | 3300013308 | Unclassified | 938 |
| 299 | Ga0157375_11866060 | 3300013308 | Bacteria | 713 |
| 300 | Ga0163163_10019654 | 3300014325 | Bacteria | 6346 |
| 301 | Ga0163163_10022881 | 3300014325 | Bacteria | 5924 |
| 302 | Ga0163163_10028159 | 3300014325 | Bacteria | 5391 |
| 303 | Ga0163163_11051503 | 3300014325 | Unclassified | 877 |
| 304 | Ga0157380_10258651 | 3300014326 | Bacteria | 1580 |
| 305 | Ga0157380_10336802 | 3300014326 | Bacteria | 1405 |
| 306 | Ga0157379_10011068 | 3300014968 | Bacteria | 7863 |
| 307 | Ga0157379_10049938 | 3300014968 | Bacteria | 3734 |
| 308 | Ga0157379_11318236 | 3300014968 | Bacteria | 698 |
| 309 | Ga0157376_10054769 | 3300014969 | Unclassified | 3326 |
| 310 | Ga0157376_10635313 | 3300014969 | Bacteria | 1066 |
| 311 | Ga0157376_10722186 | 3300014969 | Bacteria | 1003 |
| 312 | Ga0163161_10110939 | 3300017792 | Bacteria | 2050 |
| 313 | Ga0197907_10478193 | 3300020069 | Unclassified | 1214 |
| 314 | Ga0206355_1016973 | 3300020076 | Unclassified | 1204 |
| 315 | Ga0206355_1181757 | 3300020076 | Unclassified | 1210 |
| 316 | Ga0206355_1610152 | 3300020076 | Bacteria | 1429 |
| 317 | Ga0206350_10782737 | 3300020080 | Bacteria | 1111 |
| 318 | Ga0206354_10271648 | 3300020081 | Unclassified | 1042 |
| 319 | Ga0154015_1076892 | 3300020610 | Unclassified | 1002 |
| 320 | Ga0213872_10019520 | 3300021361 | Bacteria | 3121 |
| 321 | Ga0213876_10002108 | 3300021384 | Bacteria | 11767 |
| 322 | Ga0213876_10159913 | 3300021384 | Bacteria | 1198 |
| 323 | Ga0213876_10628131 | 3300021384 | Unclassified | 572 |
| 324 | Ga0213875_10000005 | 3300021388 | Bacteria | 595146 |
| 325 | Ga0213875_10000032 | 3300021388 | Bacteria | 172918 |
| 326 | Ga0213875_10004701 | 3300021388 | Bacteria | 7433 |
| 327 | Ga0213875_10052390 | 3300021388 | Bacteria | 1911 |
| 328 | Ga0213875_10083560 | 3300021388 | Bacteria | 1490 |
| 329 | Ga0213875_10116236 | 3300021388 | Bacteria | 1249 |
| 330 | Ga0213875_10119406 | 3300021388 | Bacteria | 1232 |
| 331 | Ga0213875_10493512 | 3300021388 | Unclassified | 588 |
| 332 | Ga0207682_10266773 | 3300025893 | Bacteria | 799 |
| 333 | Ga0207642_10013851 | 3300025899 | Unclassified | 2956 |
| 334 | Ga0207680_10138723 | 3300025903 | Unclassified | 1610 |
| 335 | Ga0207645_10553628 | 3300025907 | Bacteria | 780 |
| 336 | Ga0207705_10694328 | 3300025909 | Unclassified | 791 |
| 337 | Ga0207654_10023665 | 3300025911 | Unclassified | 3293 |
| 338 | Ga0207654_10053839 | 3300025911 | Bacteria | 2324 |
| 339 | Ga0207654_10157132 | 3300025911 | Bacteria | 1465 |
| 340 | Ga0207654_10838129 | 3300025911 | Bacteria | 665 |
| 341 | Ga0207707_10019197 | 3300025912 | Bacteria | 5965 |
| 342 | Ga0207707_10083251 | 3300025912 | Bacteria | 2793 |
| 343 | Ga0207707_10124928 | 3300025912 | Unclassified | 2250 |
| 344 | Ga0207707_10273765 | 3300025912 | Bacteria | 1463 |
| 345 | Ga0207707_10682426 | 3300025912 | Bacteria | 864 |
| 346 | Ga0207707_11088897 | 3300025912 | Bacteria | 652 |
| 347 | Ga0207695_10028817 | 3300025913 | Bacteria | 6147 |
| 348 | Ga0207695_10053575 | 3300025913 | Unclassified | 4219 |
| 349 | Ga0207695_10075817 | 3300025913 | Bacteria | 3421 |
| 350 | Ga0207695_10099638 | 3300025913 | Bacteria | 2903 |
| 351 | Ga0207695_10179309 | 3300025913 | Unclassified | 2040 |
| 352 | Ga0207695_10758795 | 3300025913 | Bacteria | 850 |
| 353 | Ga0207695_11306626 | 3300025913 | Bacteria | 606 |
| 354 | Ga0207671_10083639 | 3300025914 | Bacteria | 2396 |
| 355 | Ga0207671_10110645 | 3300025914 | Bacteria | 2090 |
| 356 | Ga0207671_10150100 | 3300025914 | Bacteria | 1800 |
| 357 | Ga0207671_10583272 | 3300025914 | Unclassified | 891 |
| 358 | Ga0207693_10377755 | 3300025915 | Bacteria | 1108 |
| 359 | Ga0207663_10034577 | 3300025916 | Bacteria | 3024 |
| 360 | Ga0207663_10713728 | 3300025916 | Unclassified | 794 |
| 361 | Ga0207660_10040808 | 3300025917 | Unclassified | 3251 |
| 362 | Ga0207660_10908621 | 3300025917 | Unclassified | 718 |
| 363 | Ga0207662_10727961 | 3300025918 | Bacteria | 696 |
| 364 | Ga0207657_10002498 | 3300025919 | Bacteria | 19885 |
| 365 | Ga0207657_10784366 | 3300025919 | Bacteria | 737 |
| 366 | Ga0207649_10198100 | 3300025920 | Unclassified | 1417 |
| 367 | Ga0207649_10270259 | 3300025920 | Unclassified | 1232 |
| 368 | Ga0207649_10310410 | 3300025920 | Unclassified | 1156 |
| 369 | Ga0207649_10489663 | 3300025920 | Bacteria | 934 |
| 370 | Ga0207652_10030242 | 3300025921 | Unclassified | 4533 |
| 371 | Ga0207652_10073269 | 3300025921 | Bacteria | 2979 |
| 372 | Ga0207652_10118993 | 3300025921 | Bacteria | 2349 |
| 373 | Ga0207652_10205254 | 3300025921 | Bacteria | 1774 |
| 374 | Ga0207694_10002164 | 3300025924 | Bacteria | 16156 |
| 375 | Ga0207694_10028823 | 3300025924 | Unclassified | 4234 |
| 376 | Ga0207694_10195055 | 3300025924 | Unclassified | 1646 |
| 377 | Ga0207694_10407300 | 3300025924 | Bacteria | 1131 |
| 378 | Ga0207659_11762725 | 3300025926 | Bacteria | 526 |
| 379 | Ga0207687_10003031 | 3300025927 | Bacteria | 11386 |
| 380 | Ga0207687_10010241 | 3300025927 | Bacteria | 6125 |
| 381 | Ga0207687_10038732 | 3300025927 | Bacteria | 3259 |
| 382 | Ga0207687_10075778 | 3300025927 | Bacteria | 2415 |
| 383 | Ga0207687_10210522 | 3300025927 | Bacteria | 1525 |
| 384 | Ga0207700_10051542 | 3300025928 | Bacteria | 3072 |
| 385 | Ga0207700_10483900 | 3300025928 | Bacteria | 1094 |
| 386 | Ga0207700_10722293 | 3300025928 | Unclassified | 890 |
| 387 | Ga0207700_11971657 | 3300025928 | Unclassified | 510 |
| 388 | Ga0207664_10586411 | 3300025929 | Bacteria | 1001 |
| 389 | Ga0207664_10834828 | 3300025929 | Unclassified | 828 |
| 390 | Ga0207644_10383002 | 3300025931 | Unclassified | 1147 |
| 391 | Ga0207644_10530635 | 3300025931 | Bacteria | 973 |
| 392 | Ga0207690_10017593 | 3300025932 | Bacteria | 4369 |
| 393 | Ga0207690_10069287 | 3300025932 | Bacteria | 2427 |
| 394 | Ga0207706_10040860 | 3300025933 | Unclassified | 4111 |
| 395 | Ga0207706_10142484 | 3300025933 | Bacteria | 2108 |
| 396 | Ga0207686_10005602 | 3300025934 | Bacteria | 6732 |
| 397 | Ga0207686_10080074 | 3300025934 | Unclassified | 2129 |
| 398 | Ga0207686_10160931 | 3300025934 | Unclassified | 1573 |
| 399 | Ga0207686_10227632 | 3300025934 | Unclassified | 1350 |
| 400 | Ga0207686_10362700 | 3300025934 | Unclassified | 1094 |
| 401 | Ga0207686_10439724 | 3300025934 | Unclassified | 1001 |
| 402 | Ga0207670_10602090 | 3300025936 | Bacteria | 902 |
| 403 | Ga0207670_10663442 | 3300025936 | Bacteria | 861 |
| 404 | Ga0207669_11236223 | 3300025937 | Unclassified | 633 |
| 405 | Ga0207704_10019841 | 3300025938 | Unclassified | 3542 |
| 406 | Ga0207665_10956034 | 3300025939 | Bacteria | 681 |
| 407 | Ga0207691_10465359 | 3300025940 | Bacteria | 1075 |
| 408 | Ga0207711_10003764 | 3300025941 | Bacteria | 13059 |
| 409 | Ga0207711_10006942 | 3300025941 | Bacteria | 9504 |
| 410 | Ga0207711_10073098 | 3300025941 | Unclassified | 2980 |
| 411 | Ga0207711_10328734 | 3300025941 | Bacteria | 1414 |
| 412 | Ga0207711_10414139 | 3300025941 | Bacteria | 1253 |
| 413 | Ga0207711_10644232 | 3300025941 | Unclassified | 988 |
| 414 | Ga0207711_10784266 | 3300025941 | Bacteria | 888 |
| 415 | Ga0207711_11800448 | 3300025941 | Unclassified | 555 |
| 416 | Ga0207689_10048271 | 3300025942 | Bacteria | 3511 |
| 417 | Ga0207689_10270410 | 3300025942 | Bacteria | 1407 |
| 418 | Ga0207689_11518930 | 3300025942 | Bacteria | 559 |
| 419 | Ga0207661_10141149 | 3300025944 | Unclassified | 2073 |
| 420 | Ga0207661_10703845 | 3300025944 | Bacteria | 929 |
| 421 | Ga0207661_11132106 | 3300025944 | Unclassified | 720 |
| 422 | Ga0207661_11617812 | 3300025944 | Bacteria | 592 |
| 423 | Ga0207679_10033266 | 3300025945 | Bacteria | 3627 |
| 424 | Ga0207679_10055482 | 3300025945 | Unclassified | 2921 |
| 425 | Ga0207679_10205424 | 3300025945 | Unclassified | 1648 |
| 426 | Ga0207679_10893046 | 3300025945 | Bacteria | 813 |
| 427 | Ga0207667_10009718 | 3300025949 | Bacteria | 11309 |
| 428 | Ga0207667_10019381 | 3300025949 | Bacteria | 7596 |
| 429 | Ga0207667_10088668 | 3300025949 | Unclassified | 3198 |
| 430 | Ga0207667_10093738 | 3300025949 | Unclassified | 3101 |
| 431 | Ga0207667_10740614 | 3300025949 | Bacteria | 983 |
| 432 | Ga0207712_10853714 | 3300025961 | Bacteria | 803 |
| 433 | Ga0207640_10091314 | 3300025981 | Unclassified | 2109 |
| 434 | Ga0207640_10723355 | 3300025981 | Bacteria | 856 |
| 435 | Ga0207658_10125245 | 3300025986 | Bacteria | 2055 |
| 436 | Ga0207658_10765694 | 3300025986 | Bacteria | 875 |
| 437 | Ga0207658_10821324 | 3300025986 | Unclassified | 844 |
| 438 | Ga0207677_10017429 | 3300026023 | Unclassified | 4282 |
| 439 | Ga0207677_10166802 | 3300026023 | Unclassified | 1717 |
| 440 | Ga0207677_10405488 | 3300026023 | Unclassified | 1157 |
| 441 | Ga0207677_10529900 | 3300026023 | Unclassified | 1023 |
| 442 | Ga0207677_11058774 | 3300026023 | Bacteria | 738 |
| 443 | Ga0207677_11736116 | 3300026023 | Unclassified | 579 |
| 444 | Ga0207703_10010386 | 3300026035 | Bacteria | 7283 |
| 445 | Ga0207703_10018464 | 3300026035 | Bacteria | 5446 |
| 446 | Ga0207703_10061783 | 3300026035 | Bacteria | 3068 |
| 447 | Ga0207703_10208527 | 3300026035 | Unclassified | 1741 |
| 448 | Ga0207703_10213558 | 3300026035 | Unclassified | 1721 |
| 449 | Ga0207703_11137370 | 3300026035 | Bacteria | 750 |
| 450 | Ga0207639_10017212 | 3300026041 | Bacteria | 5124 |
| 451 | Ga0207639_10227214 | 3300026041 | Unclassified | 1615 |
| 452 | Ga0207639_10246617 | 3300026041 | Bacteria | 1556 |
| 453 | Ga0207639_10971520 | 3300026041 | Unclassified | 795 |
| 454 | Ga0207678_10015939 | 3300026067 | Bacteria | 6600 |
| 455 | Ga0207678_10234034 | 3300026067 | Bacteria | 1573 |
| 456 | Ga0207678_10429065 | 3300026067 | Bacteria | 1147 |
| 457 | Ga0207708_10219495 | 3300026075 | Bacteria | 1523 |
| 458 | Ga0207708_11181892 | 3300026075 | Bacteria | 668 |
| 459 | Ga0207702_10011018 | 3300026078 | Bacteria | 7544 |
| 460 | Ga0207702_10096877 | 3300026078 | Bacteria | 2595 |
| 461 | Ga0207702_10301747 | 3300026078 | Unclassified | 1520 |
| 462 | Ga0207702_10324265 | 3300026078 | Unclassified | 1467 |
| 463 | Ga0207702_10362220 | 3300026078 | Bacteria | 1390 |
| 464 | Ga0207702_10522921 | 3300026078 | Bacteria | 1158 |
| 465 | Ga0207702_11375678 | 3300026078 | Bacteria | 700 |
| 466 | Ga0207702_12004937 | 3300026078 | Bacteria | 569 |
| 467 | Ga0207641_10040482 | 3300026088 | Bacteria | 3903 |
| 468 | Ga0207641_10837064 | 3300026088 | Bacteria | 911 |
| 469 | Ga0207641_11376057 | 3300026088 | Bacteria | 707 |
| 470 | Ga0207648_10023853 | 3300026089 | Bacteria | 5471 |
| 471 | Ga0207648_10143823 | 3300026089 | Unclassified | 2103 |
| 472 | Ga0207648_10917814 | 3300026089 | Unclassified | 818 |
| 473 | Ga0207676_10005545 | 3300026095 | Bacteria | 8930 |
| 474 | Ga0207674_10020184 | 3300026116 | Bacteria | 7205 |
| 475 | Ga0207674_10024159 | 3300026116 | Bacteria | 6498 |
| 476 | Ga0207674_10103476 | 3300026116 | Bacteria | 2826 |
| 477 | Ga0207674_10225552 | 3300026116 | Bacteria | 1822 |
| 478 | Ga0207674_10822491 | 3300026116 | Bacteria | 896 |
| 479 | Ga0207674_10987657 | 3300026116 | Unclassified | 811 |
| 480 | Ga0207675_100473752 | 3300026118 | Bacteria | 1243 |
| 481 | Ga0207683_10033921 | 3300026121 | Unclassified | 4435 |
| 482 | Ga0207698_10076766 | 3300026142 | Bacteria | 2675 |
| 483 | Ga0207698_10168201 | 3300026142 | Unclassified | 1927 |
| 484 | Ga0207698_10307540 | 3300026142 | Bacteria | 1478 |
| 485 | Ga0207698_10930288 | 3300026142 | Bacteria | 878 |
| 486 | Ga0207698_11070582 | 3300026142 | Unclassified | 818 |
| 487 | Ga0207698_11616383 | 3300026142 | Bacteria | 663 |
| 488 | Ga0268266_10014693 | 3300028379 | Bacteria | 6726 |
| 489 | Ga0268266_10178037 | 3300028379 | Bacteria | 1934 |
| 490 | Ga0268266_10231470 | 3300028379 | Bacteria | 1702 |
| 491 | Ga0268266_10791949 | 3300028379 | Bacteria | 915 |
| 492 | Ga0268264_10008523 | 3300028381 | Bacteria | 8521 |
| 493 | Ga0268264_10239051 | 3300028381 | Bacteria | 1681 |
| 494 | Ga0265338_10048468 | 3300028800 | Bacteria | 3864 |
| 495 | Ga0265338_10238385 | 3300028800 | Bacteria | 1349 |
| 496 | Ga0265338_10428257 | 3300028800 | Unclassified | 939 |
| 497 | Ga0265760_10097150 | 3300031090 | Bacteria | 928 |
| 498 | Ga0265329_10305119 | 3300031242 | Bacteria | 539 |
| 499 | Ga0265339_10304183 | 3300031249 | Unclassified | 760 |
| 500 | Ga0265316_10143128 | 3300031344 | Bacteria | 1795 |
| 501 | Ga0265314_10041508 | 3300031711 | Bacteria | 3292 |
| 502 | Ga0265342_10305998 | 3300031712 | Unclassified | 836 |
| 503 | Ga0373926_0098381 | 3300035083 | Bacteria | 1092 |
| 504 | Ga0373926_0130013 | 3300035083 | Bacteria | 953 |
| 505 | Ga0373944_0103158 | 3300035089 | Bacteria | 966 |
| 506 | Ga0373936_0047851 | 3300035113 | Unclassified | 1726 |
| 507 | Ga0373941_0295819 | 3300035115 | Bacteria | 645 |
| 508 | Ga0373945_0047705 | 3300035116 | Bacteria | 1567 |
| 509 | Ga0373945_0345719 | 3300035116 | Bacteria | 644 |
| 510 | Ga0373953_0291206 | 3300035117 | Unclassified | 712 |
| 511 | Ga0373946_0191892 | 3300035171 | Bacteria | 974 |
| 512 | Ga0373955_0601032 | 3300035172 | Bacteria | 674 |
| 513 | Ga0373961_0086987 | 3300035241 | Bacteria | 992 |
| 514 | Ga0373931_0163320 | 3300035691 | Bacteria | 1307 |
| 515 | Ga0373931_0491434 | 3300035691 | Bacteria | 790 |
| 516 | Ga0373931_1292139 | 3300035691 | Unclassified | 502 |
| 517 | Ga0373935_0012503 | 3300035692 | Bacteria | 5105 |
| 518 | Ga0373935_0643690 | 3300035692 | Bacteria | 777 |
| 519 | Ga0373935_1476696 | 3300035692 | Unclassified | 509 |
| 520 | Ga0373927_0009950 | 3300035695 | Bacteria | 6372 |
| 521 | Ga0373927_0057982 | 3300035695 | Unclassified | 2504 |
| 522 | Ga0373933_0243962 | 3300035724 | Unclassified | 1156 |
| 523 | Ga0373933_0343558 | 3300035724 | Bacteria | 969 |
| 524 | Ga0373947_0019057 | 3300035725 | Bacteria | 3954 |
| 525 | Ga0373947_0057530 | 3300035725 | Unclassified | 2353 |
| 526 | Ga0373937_0138085 | 3300036401 | Bacteria | 2280 |
| 527 | Ga0373937_0301627 | 3300036401 | Bacteria | 1514 |
| 528 | Ga0373937_1096293 | 3300036401 | Bacteria | 745 |
| 529 | Ga0373925_0000401 | 3300037068 | Bacteria | 44253 |
| 530 | Ga0373925_0174285 | 3300037068 | Bacteria | 1699 |
| 531 | Ga0373925_0200879 | 3300037068 | Bacteria | 1585 |
| 532 | Ga0373925_0338538 | 3300037068 | Bacteria | 1220 |
| 533 | Ga0395900_0191212 | 3300037418 | Unclassified | 2076 |
| 534 | Ga0395898_0106005 | 3300037466 | Bacteria | 2696 |
| 535 | Ga0436364_0010332 | 3300037853 | Unclassified | 1237 |
| 536 | Ga0436364_0031051 | 3300037853 | Unclassified | 2775 |
| 537 | Ga0436364_0132953 | 3300037853 | Bacteria | 5490 |
| 538 | Ga0436364_0157811 | 3300037853 | Bacteria | 430293 |
| 539 | Ga0436364_0202263 | 3300037853 | Bacteria | 63132 |
| 540 | Ga0436364_0282990 | 3300037853 | Unclassified | 658 |
| 541 | Ga0436364_0457930 | 3300037853 | Bacteria | 8284 |
| 542 | Ga0436364_0483108 | 3300037853 | Unclassified | 1978 |
| 543 | Ga0436364_0520948 | 3300037853 | Bacteria | 5148 |
| 544 | Ga0436364_0647542 | 3300037853 | Bacteria | 2209 |
| 545 | Ga0436364_0715739 | 3300037853 | Bacteria | 8187 |
| 546 | Ga0436364_0833005 | 3300037853 | Bacteria | 8565 |
| 547 | Ga0436364_1074294 | 3300037853 | Bacteria | 1178 |
| 548 | Ga0436364_1108687 | 3300037853 | Bacteria | 3734 |
| 549 | Ga0436364_1294932 | 3300037853 | Bacteria | 3877 |
| 550 | Ga0436364_1299641 | 3300037853 | Bacteria | 554 |
| 551 | Ga0436364_1369623 | 3300037853 | Bacteria | 9686 |
| 552 | Ga0436364_1443683 | 3300037853 | Unclassified | 514 |
| 553 | Ga0436364_1500628 | 3300037853 | Unclassified | 2562 |
| 554 | Ga0436364_1561923 | 3300037853 | Bacteria | 827 |
| 555 | Ga0436365_0068008 | 3300039437 | Bacteria | 17073 |
| 556 | Ga0436365_0205552 | 3300039437 | Bacteria | 2276 |
| 557 | Ga0436365_0279355 | 3300039437 | Bacteria | 853 |
| 558 | Ga0436365_0693032 | 3300039437 | Bacteria | 3674 |
| 559 | Ga0436365_0837841 | 3300039437 | Bacteria | 1465 |
| 560 | Ga0436365_0892357 | 3300039437 | Bacteria | 6885 |
| 561 | Ga0436365_1336592 | 3300039437 | Bacteria | 1073 |
| 562 | Ga0436360_1116020 | 3300039438 | Unclassified | 1071 |
| 563 | Ga0436361_0377638 | 3300039447 | Bacteria | 39633 |
| 564 | Ga0436363_0094956 | 3300039450 | Bacteria | 1708 |
| 565 | Ga0436363_0612539 | 3300039450 | Bacteria | 1036 |
| 566 | Ga0436363_1512130 | 3300039450 | Bacteria | 3856 |
| 567 | Ga0436362_0280648 | 3300039453 | Bacteria | 1059 |
| 568 | Ga0436362_0647631 | 3300039453 | Unclassified | 1581 |
| 569 | Ga0436362_1121200 | 3300039453 | Unclassified | 526 |
| 570 | Ga0451577_0208311 | 3300042876 | Bacteria | 1766 |
| 571 | Ga0466963_0120787 | 3300044694 | Bacteria | 1803 |
| 572 | Ga0466963_0512189 | 3300044694 | Unclassified | 847 |
| 573 | Ga0466959_1089089 | 3300045049 | Bacteria | 531 |
| 574 | Ga0451576_0309752 | 3300045051 | Bacteria | 1652 |
| 575 | Ga0466958_0080423 | 3300045836 | Bacteria | 2005 |
| 576 | Ga0495629_0000002 | 3300046459 | Bacteria | 686975 |
| 577 | Ga0495629_0471025 | 3300046459 | Bacteria | 849 |
| 578 | Ga0495580_0045958 | 3300046472 | Bacteria | 3100 |
| 579 | Ga0495580_0102942 | 3300046472 | Bacteria | 1985 |
| 580 | Ga0495580_0115221 | 3300046472 | Unclassified | 1867 |
| 581 | Ga0495580_0292998 | 3300046472 | Bacteria | 1109 |
| 582 | Ga0495580_0379179 | 3300046472 | Bacteria | 955 |
| 583 | Ga0495580_0894996 | 3300046472 | Bacteria | 571 |
| 584 | Ga0495582_0024647 | 3300046473 | Bacteria | 3292 |
| 585 | Ga0495582_0125144 | 3300046473 | Bacteria | 1450 |
| 586 | Ga0495582_0479886 | 3300046473 | Bacteria | 718 |
| 587 | Ga0495639_0000783 | 3300046475 | Bacteria | 14476 |
| 588 | Ga0495639_0175534 | 3300046475 | Bacteria | 1041 |
| 589 | Ga0495594_0061097 | 3300046499 | Bacteria | 2085 |
| 590 | Ga0495618_0164506 | 3300046514 | Bacteria | 1413 |
| 591 | Ga0495628_0604900 | 3300046516 | Unclassified | 783 |
| 592 | Ga0495630_0956005 | 3300046517 | Bacteria | 652 |
| 593 | Ga0495630_1262684 | 3300046517 | Bacteria | 557 |
| 594 | Ga0495666_0000292 | 3300046526 | Bacteria | 21920 |
| 595 | Ga0495666_0102408 | 3300046526 | Unclassified | 1349 |
| 596 | Ga0495665_0090028 | 3300046531 | Bacteria | 1612 |
| 597 | Ga0495665_0282441 | 3300046531 | Bacteria | 851 |
| 598 | Ga0495586_0001764 | 3300046535 | Bacteria | 11827 |
| 599 | Ga0495586_0130578 | 3300046535 | Bacteria | 1406 |
| 600 | Ga0495586_0207613 | 3300046535 | Unclassified | 1111 |
| 601 | Ga0495586_0432905 | 3300046535 | Bacteria | 758 |
| 602 | Ga0495586_0439914 | 3300046535 | Bacteria | 751 |
| 603 | Ga0495645_0370944 | 3300046543 | Unclassified | 918 |
| 604 | Ga0495622_0049059 | 3300046557 | Bacteria | 1960 |
| 605 | Ga0495635_0000082 | 3300046663 | Bacteria | 58319 |
| 606 | Ga0495599_0540955 | 3300046678 | Bacteria | 683 |
| 607 | Ga0495647_0024372 | 3300046681 | Bacteria | 2202 |
| 608 | Ga0495658_0020610 | 3300046683 | Bacteria | 3463 |
| 609 | Ga0495658_0124981 | 3300046683 | Bacteria | 1560 |
| 610 | Ga0495613_0390737 | 3300046689 | Bacteria | 950 |
| 611 | Ga0495600_0024148 | 3300046809 | Bacteria | 3912 |
| 612 | Ga0495581_0002055 | 3300047315 | Bacteria | 11326 |
| 613 | Ga0495674_0137270 | 3300047319 | Bacteria | 2057 |
| 614 | Ga0495674_0341773 | 3300047319 | Bacteria | 1216 |
| 615 | Ga0495676_0025057 | 3300047321 | Bacteria | 5154 |
| 616 | Ga0495680_0000053 | 3300047322 | Bacteria | 94237 |
| 617 | Ga0495680_0181699 | 3300047322 | Bacteria | 1518 |
| 618 | Ga0495684_0185026 | 3300047471 | Unclassified | 1543 |
| 619 | Ga0495684_0445081 | 3300047471 | Bacteria | 901 |
| 620 | Ga0495684_0600517 | 3300047471 | Bacteria | 743 |
| 621 | Ga0495602_0499955 | 3300048088 | Bacteria | 850 |
| 622 | Ga0496102_0909161 | 3300048905 | Bacteria | 802 |
| 623 | Ga0496105_0199801 | 3300048908 | Bacteria | 1632 |
| 624 | Ga0496106_1128089 | 3300048909 | Bacteria | 614 |
| 625 | Ga0496107_0547493 | 3300048910 | Unclassified | 857 |
| 626 | Ga0496109_1284206 | 3300048912 | Bacteria | 668 |
| 627 | Ga0496112_0353425 | 3300048915 | Unclassified | 1412 |
| 628 | Ga0496112_0468036 | 3300048915 | Bacteria | 1198 |
| 629 | Ga0496114_1313702 | 3300048917 | Bacteria | 610 |
| 630 | Ga0496115_0098693 | 3300048918 | Unclassified | 2392 |
| 631 | Ga0501032_0358148 | 3300049569 | Unclassified | 939 |
| 632 | Ga0501034_0083100 | 3300049571 | Unclassified | 3204 |
| 633 | Ga0501034_0609268 | 3300049571 | Unclassified | 997 |
| 634 | Ga0501037_0056145 | 3300049573 | Unclassified | 2877 |
| 635 | Ga0501037_0169131 | 3300049573 | Bacteria | 1555 |
| 636 | Ga0501038_0243224 | 3300049574 | Unclassified | 1428 |
| 637 | Ga0501043_0170832 | 3300049579 | Unclassified | 1696 |
| 638 | Ga0501046_0287212 | 3300049580 | Bacteria | 1204 |
| 639 | Ga0501047_0063330 | 3300049581 | Bacteria | 3567 |
| 640 | Ga0501047_0086128 | 3300049581 | Bacteria | 3019 |
| 641 | Ga0501048_0097911 | 3300049582 | Unclassified | 2070 |
| 642 | Ga0501069_0206694 | 3300049585 | Unclassified | 1139 |
| 643 | Ga0501070_0084428 | 3300049586 | Unclassified | 2629 |
| 644 | Ga0501073_0327214 | 3300049589 | Unclassified | 1058 |
| 645 | Ga0501074_0252918 | 3300049590 | Unclassified | 1253 |
| 646 | Ga0501035_0002323 | 3300049822 | Bacteria | 18745 |
| 647 | Ga0501044_0001094 | 3300049823 | Bacteria | 32272 |
| 648 | Ga0501044_0001731 | 3300049823 | Bacteria | 25525 |
| 649 | Ga0501044_0961468 | 3300049823 | Bacteria | 727 |
| 650 | Ga0501045_0253202 | 3300049824 | Bacteria | 1311 |
| 651 | nmdc:mga09592_259501_c1 | 3300050508 | Unclassified | 1507 |
| 652 | nmdc:mga0qj67_29596_c1 | 3300050509 | Bacteria | 4254 |
| 653 | nmdc:mga0qj67_50798_c1 | 3300050509 | Bacteria | 3279 |
| 654 | nmdc:mga06r32_213454_c1 | 3300050510 | Unclassified | 1918 |
| 655 | nmdc:mga06r32_310712_c1 | 3300050510 | Bacteria | 1562 |
| 656 | nmdc:mga08x19_614515_c1 | 3300050514 | Unclassified | 770 |
| 657 | Ga0495601_0100599 | 3300053077 | Bacteria | 1867 |
| 658 | Ga0587128_052210 | 3300059630 | Bacteria | 749 |
| 659 | Ga0587067_046716 | 3300059640 | Bacteria | 862 |
| 660 | Ga0587079_199730 | 3300059647 | Bacteria | 545 |
| 661 | Ga0587114_044098 | 3300059655 | Bacteria | 733 |
| 662 | Ga0501082_0419864 | 3300060353 | Unclassified | 1168 |
| 663 | Ga0466962_0406631 | 3300061719 | Bacteria | 682 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10531955 | Ga0070658_105319553 | 116 |
| 2 | 3300005339 | Ga0070660_100008288 | Ga0070660_1000082886 | 116 |
| 3 | 3300005435 | Ga0070714_100732895 | Ga0070714_1007328952 | 116 |
| 4 | 3300009093 | Ga0105240_11135487 | Ga0105240_111354871 | 116 |
| 5 | 3300009093 | Ga0105240_11146561 | Ga0105240_111465612 | 116 |
| 6 | 3300013104 | Ga0157370_10317500 | Ga0157370_103175004 | 116 |
| 7 | 3300013105 | Ga0157369_10043143 | Ga0157369_100431436 | 116 |
| 8 | 3300013307 | Ga0157372_10371822 | Ga0157372_103718222 | 116 |
| 9 | 3300005334 | Ga0068869_101398968 | Ga0068869_1013989681 | 117 |
| 10 | 3300005335 | Ga0070666_11302483 | Ga0070666_113024831 | 117 |
| 11 | 3300005338 | Ga0068868_101288376 | Ga0068868_1012883761 | 117 |
| 12 | 3300005340 | Ga0070689_100786052 | Ga0070689_1007860522 | 117 |
| 13 | 3300005543 | Ga0070672_101132998 | Ga0070672_1011329982 | 117 |
| 14 | 3300005618 | Ga0068864_100317252 | Ga0068864_1003172524 | 117 |
| 15 | 3300007788 | Ga0099795_10162265 | Ga0099795_101622653 | 117 |
| 16 | 3300009098 | Ga0105245_10361442 | Ga0105245_103614422 | 117 |
| 17 | 3300009177 | Ga0105248_10142004 | Ga0105248_101420042 | 117 |
| 18 | 3300009177 | Ga0105248_10407494 | Ga0105248_104074944 | 117 |
| 19 | 3300009177 | Ga0105248_11003796 | Ga0105248_110037962 | 117 |
| 20 | 3300013306 | Ga0163162_10688685 | Ga0163162_106886851 | 117 |
| 21 | 3300025941 | Ga0207711_10784266 | Ga0207711_107842662 | 117 |
| 22 | 3300025942 | Ga0207689_11518930 | Ga0207689_115189302 | 117 |
| 23 | 3300026023 | Ga0207677_11058774 | Ga0207677_110587741 | 117 |
| 24 | 3300026035 | Ga0207703_11137370 | Ga0207703_111373702 | 117 |
| 25 | 3300042876 | Ga0451577_0208311 | Ga0451577_0208311_760_1116 | 117 |
| 26 | 3300046472 | Ga0495580_0894996 | Ga0495580_0894996_201_557 | 117 |
| 27 | 3300046517 | Ga0495630_0956005 | Ga0495630_0956005_78_437 | 117 |
| 28 | 3300046535 | Ga0495586_0432905 | Ga0495586_0432905_158_517 | 117 |
| 29 | 3300048909 | Ga0496106_1128089 | Ga0496106_1128089_125_481 | 117 |
| 30 | 3300048910 | Ga0496107_0547493 | Ga0496107_0547493_159_512 | 117 |
| 31 | 3300048912 | Ga0496109_1284206 | Ga0496109_1284206_255_611 | 117 |
| 32 | 3300048917 | Ga0496114_1313702 | Ga0496114_1313702_212_568 | 117 |
| 33 | 3300005340 | Ga0070689_100155629 | Ga0070689_1001556293 | 118 |
| 34 | 3300005354 | Ga0070675_101291418 | Ga0070675_1012914182 | 118 |
| 35 | 3300005444 | Ga0070694_100042459 | Ga0070694_1000424594 | 118 |
| 36 | 3300005459 | Ga0068867_100057154 | Ga0068867_1000571545 | 118 |
| 37 | 3300005466 | Ga0070685_10734698 | Ga0070685_107346982 | 118 |
| 38 | 3300005543 | Ga0070672_100262346 | Ga0070672_1002623462 | 118 |
| 39 | 3300005545 | Ga0070695_100016604 | Ga0070695_1000166043 | 118 |
| 40 | 3300005615 | Ga0070702_101013441 | Ga0070702_1010134411 | 118 |
| 41 | 3300005617 | Ga0068859_100285860 | Ga0068859_1002858603 | 118 |
| 42 | 3300005719 | Ga0068861_100098234 | Ga0068861_1000982344 | 118 |
| 43 | 3300005843 | Ga0068860_100047825 | Ga0068860_1000478253 | 118 |
| 44 | 3300006237 | Ga0097621_100239974 | Ga0097621_1002399741 | 118 |
| 45 | 3300006358 | Ga0068871_100040183 | Ga0068871_1000401836 | 118 |
| 46 | 3300006846 | Ga0075430_100019462 | Ga0075430_1000194623 | 118 |
| 47 | 3300006847 | Ga0075431_100317371 | Ga0075431_1003173713 | 118 |
| 48 | 3300006880 | Ga0075429_100369932 | Ga0075429_1003699323 | 118 |
| 49 | 3300006931 | Ga0097620_100285852 | Ga0097620_1002858523 | 118 |
| 50 | 3300009098 | Ga0105245_11447291 | Ga0105245_114472912 | 118 |
| 51 | 3300009176 | Ga0105242_10049623 | Ga0105242_100496237 | 118 |
| 52 | 3300011119 | Ga0105246_10169109 | Ga0105246_101691093 | 118 |
| 53 | 3300014326 | Ga0157380_10258651 | Ga0157380_102586513 | 118 |
| 54 | 3300017792 | Ga0163161_10110939 | Ga0163161_101109393 | 118 |
| 55 | 3300025926 | Ga0207659_11762725 | Ga0207659_117627252 | 118 |
| 56 | 3300025934 | Ga0207686_10080074 | Ga0207686_100800741 | 118 |
| 57 | 3300026088 | Ga0207641_11376057 | Ga0207641_113760572 | 118 |
| 58 | 3300028381 | Ga0268264_10239051 | Ga0268264_102390513 | 118 |
| 59 | 3300031344 | Ga0265316_10143128 | Ga0265316_101431282 | 118 |
| 60 | 3300035083 | Ga0373926_0130013 | Ga0373926_0130013_506_865 | 118 |
| 61 | 3300035116 | Ga0373945_0047705 | Ga0373945_0047705_573_932 | 118 |
| 62 | 3300035171 | Ga0373946_0191892 | Ga0373946_0191892_314_673 | 118 |
| 63 | 3300035725 | Ga0373947_0019057 | Ga0373947_0019057_369_728 | 118 |
| 64 | 3300036401 | Ga0373937_0138085 | Ga0373937_0138085_776_1135 | 118 |
| 65 | 3300037068 | Ga0373925_0000401 | Ga0373925_0000401_19298_19657 | 118 |
| 66 | 3300037068 | Ga0373925_0338538 | Ga0373925_0338538_777_1136 | 118 |
| 67 | 3300046459 | Ga0495629_0000002 | Ga0495629_0000002_231387_231746 | 118 |
| 68 | 3300046472 | Ga0495580_0379179 | Ga0495580_0379179_87_446 | 118 |
| 69 | 3300046473 | Ga0495582_0125144 | Ga0495582_0125144_20_379 | 118 |
| 70 | 3300046475 | Ga0495639_0000783 | Ga0495639_0000783_6202_6561 | 118 |
| 71 | 3300046499 | Ga0495594_0061097 | Ga0495594_0061097_1650_2009 | 118 |
| 72 | 3300046514 | Ga0495618_0164506 | Ga0495618_0164506_370_729 | 118 |
| 73 | 3300046517 | Ga0495630_1262684 | Ga0495630_1262684_29_388 | 118 |
| 74 | 3300046526 | Ga0495666_0000292 | Ga0495666_0000292_14974_15333 | 118 |
| 75 | 3300046531 | Ga0495665_0090028 | Ga0495665_0090028_1034_1393 | 118 |
| 76 | 3300046535 | Ga0495586_0001764 | Ga0495586_0001764_4643_5002 | 118 |
| 77 | 3300046535 | Ga0495586_0439914 | Ga0495586_0439914_141_500 | 118 |
| 78 | 3300046557 | Ga0495622_0049059 | Ga0495622_0049059_917_1276 | 118 |
| 79 | 3300046663 | Ga0495635_0000082 | Ga0495635_0000082_37816_38175 | 118 |
| 80 | 3300046681 | Ga0495647_0024372 | Ga0495647_0024372_1822_2181 | 118 |
| 81 | 3300046683 | Ga0495658_0020610 | Ga0495658_0020610_1377_1736 | 118 |
| 82 | 3300046689 | Ga0495613_0390737 | Ga0495613_0390737_33_392 | 118 |
| 83 | 3300046809 | Ga0495600_0024148 | Ga0495600_0024148_321_680 | 118 |
| 84 | 3300047315 | Ga0495581_0002055 | Ga0495581_0002055_6074_6433 | 118 |
| 85 | 3300047321 | Ga0495676_0025057 | Ga0495676_0025057_859_1218 | 118 |
| 86 | 3300047322 | Ga0495680_0000053 | Ga0495680_0000053_12184_12543 | 118 |
| 87 | 3300047471 | Ga0495684_0445081 | Ga0495684_0445081_150_509 | 118 |
| 88 | 3300050509 | nmdc:mga0qj67_50798_c1 | nmdc:mga0qj67_50798_c1_2781_3140 | 118 |
| 89 | 3300050510 | nmdc:mga06r32_310712_c1 | nmdc:mga06r32_310712_c1_609_968 | 118 |
| 90 | 3300005328 | Ga0070676_10192556 | Ga0070676_101925561 | 119 |
| 91 | 3300005329 | Ga0070683_100295948 | Ga0070683_1002959482 | 119 |
| 92 | 3300005338 | Ga0068868_100771077 | Ga0068868_1007710771 | 119 |
| 93 | 3300005340 | Ga0070689_100505631 | Ga0070689_1005056311 | 119 |
| 94 | 3300005340 | Ga0070689_100773520 | Ga0070689_1007735201 | 119 |
| 95 | 3300005341 | Ga0070691_10118374 | Ga0070691_101183743 | 119 |
| 96 | 3300005344 | Ga0070661_100231954 | Ga0070661_1002319543 | 119 |
| 97 | 3300005355 | Ga0070671_100126574 | Ga0070671_1001265742 | 119 |
| 98 | 3300005364 | Ga0070673_100601742 | Ga0070673_1006017422 | 119 |
| 99 | 3300005366 | Ga0070659_100139029 | Ga0070659_1001390293 | 119 |
| 100 | 3300005367 | Ga0070667_100469659 | Ga0070667_1004696591 | 119 |
| 101 | 3300005445 | Ga0070708_100882570 | Ga0070708_1008825702 | 119 |
| 102 | 3300005455 | Ga0070663_101882517 | Ga0070663_1018825171 | 119 |
| 103 | 3300005457 | Ga0070662_100025113 | Ga0070662_1000251132 | 119 |
| 104 | 3300005458 | Ga0070681_10460474 | Ga0070681_104604743 | 119 |
| 105 | 3300005535 | Ga0070684_100173569 | Ga0070684_1001735693 | 119 |
| 106 | 3300005539 | Ga0068853_100672288 | Ga0068853_1006722882 | 119 |
| 107 | 3300005543 | Ga0070672_100506352 | Ga0070672_1005063522 | 119 |
| 108 | 3300005544 | Ga0070686_100212809 | Ga0070686_1002128092 | 119 |
| 109 | 3300005546 | Ga0070696_100497734 | Ga0070696_1004977341 | 119 |
| 110 | 3300005549 | Ga0070704_101209843 | Ga0070704_1012098432 | 119 |
| 111 | 3300005563 | Ga0068855_100049370 | Ga0068855_1000493704 | 119 |
| 112 | 3300005564 | Ga0070664_100042923 | Ga0070664_1000429234 | 119 |
| 113 | 3300005577 | Ga0068857_100065032 | Ga0068857_1000650321 | 119 |
| 114 | 3300005578 | Ga0068854_100062060 | Ga0068854_1000620604 | 119 |
| 115 | 3300005614 | Ga0068856_100169426 | Ga0068856_1001694263 | 119 |
| 116 | 3300005617 | Ga0068859_100130525 | Ga0068859_1001305253 | 119 |
| 117 | 3300005617 | Ga0068859_101281297 | Ga0068859_1012812972 | 119 |
| 118 | 3300005718 | Ga0068866_10879860 | Ga0068866_108798601 | 119 |
| 119 | 3300005841 | Ga0068863_100137585 | Ga0068863_1001375855 | 119 |
| 120 | 3300005842 | Ga0068858_100055115 | Ga0068858_1000551153 | 119 |
| 121 | 3300005842 | Ga0068858_100911467 | Ga0068858_1009114672 | 119 |
| 122 | 3300005843 | Ga0068860_100021448 | Ga0068860_1000214484 | 119 |
| 123 | 3300005843 | Ga0068860_100542696 | Ga0068860_1005426962 | 119 |
| 124 | 3300006173 | Ga0070716_101762491 | Ga0070716_1017624911 | 119 |
| 125 | 3300006237 | Ga0097621_100080168 | Ga0097621_1000801683 | 119 |
| 126 | 3300006237 | Ga0097621_100206923 | Ga0097621_1002069232 | 119 |
| 127 | 3300006358 | Ga0068871_100118187 | Ga0068871_1001181873 | 119 |
| 128 | 3300006844 | Ga0075428_100355844 | Ga0075428_1003558442 | 119 |
| 129 | 3300006846 | Ga0075430_100039933 | Ga0075430_1000399334 | 119 |
| 130 | 3300006847 | Ga0075431_100144240 | Ga0075431_1001442404 | 119 |
| 131 | 3300006880 | Ga0075429_100155445 | Ga0075429_1001554452 | 119 |
| 132 | 3300006881 | Ga0068865_101370629 | Ga0068865_1013706292 | 119 |
| 133 | 3300006931 | Ga0097620_100130522 | Ga0097620_1001305223 | 119 |
| 134 | 3300006931 | Ga0097620_101281309 | Ga0097620_1012813092 | 119 |
| 135 | 3300009093 | Ga0105240_10499161 | Ga0105240_104991613 | 119 |
| 136 | 3300009093 | Ga0105240_11688889 | Ga0105240_116888892 | 119 |
| 137 | 3300009098 | Ga0105245_10058904 | Ga0105245_100589047 | 119 |
| 138 | 3300009098 | Ga0105245_10306157 | Ga0105245_103061573 | 119 |
| 139 | 3300009148 | Ga0105243_10188521 | Ga0105243_101885211 | 119 |
| 140 | 3300009174 | Ga0105241_10096179 | Ga0105241_100961793 | 119 |
| 141 | 3300009174 | Ga0105241_11151255 | Ga0105241_111512551 | 119 |
| 142 | 3300009176 | Ga0105242_11322767 | Ga0105242_113227672 | 119 |
| 143 | 3300009177 | Ga0105248_10040530 | Ga0105248_100405305 | 119 |
| 144 | 3300009545 | Ga0105237_10426966 | Ga0105237_104269663 | 119 |
| 145 | 3300009551 | Ga0105238_10007888 | Ga0105238_100078882 | 119 |
| 146 | 3300010375 | Ga0105239_10085123 | Ga0105239_100851232 | 119 |
| 147 | 3300011119 | Ga0105246_10102195 | Ga0105246_101021951 | 119 |
| 148 | 3300013102 | Ga0157371_10933366 | Ga0157371_109333662 | 119 |
| 149 | 3300013296 | Ga0157374_10172683 | Ga0157374_101726832 | 119 |
| 150 | 3300013296 | Ga0157374_11225069 | Ga0157374_112250691 | 119 |
| 151 | 3300013297 | Ga0157378_10013083 | Ga0157378_100130834 | 119 |
| 152 | 3300013306 | Ga0163162_11946601 | Ga0163162_119466011 | 119 |
| 153 | 3300013307 | Ga0157372_10366688 | Ga0157372_103666884 | 119 |
| 154 | 3300013308 | Ga0157375_11866060 | Ga0157375_118660601 | 119 |
| 155 | 3300014325 | Ga0163163_11051503 | Ga0163163_110515033 | 119 |
| 156 | 3300014969 | Ga0157376_10722186 | Ga0157376_107221863 | 119 |
| 157 | 3300025893 | Ga0207682_10266773 | Ga0207682_102667733 | 119 |
| 158 | 3300025907 | Ga0207645_10553628 | Ga0207645_105536282 | 119 |
| 159 | 3300025911 | Ga0207654_10023665 | Ga0207654_100236653 | 119 |
| 160 | 3300025913 | Ga0207695_10075817 | Ga0207695_100758173 | 119 |
| 161 | 3300025918 | Ga0207662_10727961 | Ga0207662_107279612 | 119 |
| 162 | 3300025924 | Ga0207694_10195055 | Ga0207694_101950553 | 119 |
| 163 | 3300025927 | Ga0207687_10003031 | Ga0207687_100030314 | 119 |
| 164 | 3300025927 | Ga0207687_10210522 | Ga0207687_102105223 | 119 |
| 165 | 3300025928 | Ga0207700_10051542 | Ga0207700_100515424 | 119 |
| 166 | 3300025929 | Ga0207664_10586411 | Ga0207664_105864113 | 119 |
| 167 | 3300025931 | Ga0207644_10530635 | Ga0207644_105306353 | 119 |
| 168 | 3300025932 | Ga0207690_10069287 | Ga0207690_100692872 | 119 |
| 169 | 3300025933 | Ga0207706_10040860 | Ga0207706_100408602 | 119 |
| 170 | 3300025934 | Ga0207686_10160931 | Ga0207686_101609313 | 119 |
| 171 | 3300025936 | Ga0207670_10602090 | Ga0207670_106020903 | 119 |
| 172 | 3300025936 | Ga0207670_10663442 | Ga0207670_106634422 | 119 |
| 173 | 3300025940 | Ga0207691_10465359 | Ga0207691_104653593 | 119 |
| 174 | 3300025941 | Ga0207711_10073098 | Ga0207711_100730983 | 119 |
| 175 | 3300025941 | Ga0207711_10328734 | Ga0207711_103287343 | 119 |
| 176 | 3300025942 | Ga0207689_10048271 | Ga0207689_100482715 | 119 |
| 177 | 3300025944 | Ga0207661_10141149 | Ga0207661_101411493 | 119 |
| 178 | 3300025944 | Ga0207661_11617812 | Ga0207661_116178121 | 119 |
| 179 | 3300025945 | Ga0207679_10205424 | Ga0207679_102054242 | 119 |
| 180 | 3300025949 | Ga0207667_10088668 | Ga0207667_100886682 | 119 |
| 181 | 3300025949 | Ga0207667_10740614 | Ga0207667_107406141 | 119 |
| 182 | 3300025981 | Ga0207640_10091314 | Ga0207640_100913143 | 119 |
| 183 | 3300025986 | Ga0207658_10765694 | Ga0207658_107656943 | 119 |
| 184 | 3300026023 | Ga0207677_10529900 | Ga0207677_105299003 | 119 |
| 185 | 3300026035 | Ga0207703_10061783 | Ga0207703_100617834 | 119 |
| 186 | 3300026035 | Ga0207703_10213558 | Ga0207703_102135581 | 119 |
| 187 | 3300026041 | Ga0207639_10227214 | Ga0207639_102272143 | 119 |
| 188 | 3300026075 | Ga0207708_11181892 | Ga0207708_111818921 | 119 |
| 189 | 3300026078 | Ga0207702_10301747 | Ga0207702_103017473 | 119 |
| 190 | 3300026078 | Ga0207702_10362220 | Ga0207702_103622201 | 119 |
| 191 | 3300026088 | Ga0207641_10040482 | Ga0207641_100404827 | 119 |
| 192 | 3300026089 | Ga0207648_10143823 | Ga0207648_101438233 | 119 |
| 193 | 3300026116 | Ga0207674_10024159 | Ga0207674_100241594 | 119 |
| 194 | 3300026118 | Ga0207675_100473752 | Ga0207675_1004737523 | 119 |
| 195 | 3300026121 | Ga0207683_10033921 | Ga0207683_100339213 | 119 |
| 196 | 3300026142 | Ga0207698_10168201 | Ga0207698_101682013 | 119 |
| 197 | 3300028800 | Ga0265338_10238385 | Ga0265338_102383851 | 119 |
| 198 | 3300035089 | Ga0373944_0103158 | Ga0373944_0103158_302_664 | 119 |
| 199 | 3300035115 | Ga0373941_0295819 | Ga0373941_0295819_214_576 | 119 |
| 200 | 3300035117 | Ga0373953_0291206 | Ga0373953_0291206_260_622 | 119 |
| 201 | 3300035724 | Ga0373933_0243962 | Ga0373933_0243962_365_727 | 119 |
| 202 | 3300035724 | Ga0373933_0343558 | Ga0373933_0343558_120_482 | 119 |
| 203 | 3300045051 | Ga0451576_0309752 | Ga0451576_0309752_237_602 | 119 |
| 204 | 3300046459 | Ga0495629_0471025 | Ga0495629_0471025_451_813 | 119 |
| 205 | 3300046473 | Ga0495582_0024647 | Ga0495582_0024647_2009_2371 | 119 |
| 206 | 3300046475 | Ga0495639_0175534 | Ga0495639_0175534_527_889 | 119 |
| 207 | 3300046531 | Ga0495665_0282441 | Ga0495665_0282441_239_601 | 119 |
| 208 | 3300046535 | Ga0495586_0130578 | Ga0495586_0130578_744_1106 | 119 |
| 209 | 3300046535 | Ga0495586_0207613 | Ga0495586_0207613_640_1002 | 119 |
| 210 | 3300046543 | Ga0495645_0370944 | Ga0495645_0370944_271_633 | 119 |
| 211 | 3300046683 | Ga0495658_0124981 | Ga0495658_0124981_363_725 | 119 |
| 212 | 3300047319 | Ga0495674_0137270 | Ga0495674_0137270_1056_1418 | 119 |
| 213 | 3300047471 | Ga0495684_0185026 | Ga0495684_0185026_734_1096 | 119 |
| 214 | 3300048905 | Ga0496102_0909161 | Ga0496102_0909161_58_420 | 119 |
| 215 | 3300048915 | Ga0496112_0353425 | Ga0496112_0353425_369_731 | 119 |
| 216 | 3300050508 | nmdc:mga09592_259501_c1 | nmdc:mga09592_259501_c1_745_1107 | 119 |
| 217 | 3300050509 | nmdc:mga0qj67_29596_c1 | nmdc:mga0qj67_29596_c1_2071_2433 | 119 |
| 218 | 3300050510 | nmdc:mga06r32_213454_c1 | nmdc:mga06r32_213454_c1_320_682 | 119 |
| 219 | 3300050514 | nmdc:mga08x19_614515_c1 | nmdc:mga08x19_614515_c1_110_472 | 119 |
| 220 | 3300005329 | Ga0070683_101342436 | Ga0070683_1013424361 | 120 |
| 221 | 3300005340 | Ga0070689_100575410 | Ga0070689_1005754102 | 120 |
| 222 | 3300005458 | Ga0070681_10334353 | Ga0070681_103343533 | 120 |
| 223 | 3300005530 | Ga0070679_102037765 | Ga0070679_1020377651 | 120 |
| 224 | 3300005535 | Ga0070684_100739081 | Ga0070684_1007390811 | 120 |
| 225 | 3300005549 | Ga0070704_100370836 | Ga0070704_1003708362 | 120 |
| 226 | 3300005577 | Ga0068857_100807219 | Ga0068857_1008072192 | 120 |
| 227 | 3300005617 | Ga0068859_100284326 | Ga0068859_1002843262 | 120 |
| 228 | 3300005719 | Ga0068861_101960703 | Ga0068861_1019607031 | 120 |
| 229 | 3300005843 | Ga0068860_101757340 | Ga0068860_1017573402 | 120 |
| 230 | 3300006358 | Ga0068871_101240311 | Ga0068871_1012403111 | 120 |
| 231 | 3300006931 | Ga0097620_100284327 | Ga0097620_1002843272 | 120 |
| 232 | 3300009093 | Ga0105240_10002787 | Ga0105240_1000278730 | 120 |
| 233 | 3300009093 | Ga0105240_10619423 | Ga0105240_106194233 | 120 |
| 234 | 3300009545 | Ga0105237_10004101 | Ga0105237_1000410113 | 120 |
| 235 | 3300013297 | Ga0157378_10604789 | Ga0157378_106047893 | 120 |
| 236 | 3300014326 | Ga0157380_10336802 | Ga0157380_103368021 | 120 |
| 237 | 3300014968 | Ga0157379_11318236 | Ga0157379_113182362 | 120 |
| 238 | 3300025912 | Ga0207707_10273765 | Ga0207707_102737652 | 120 |
| 239 | 3300025913 | Ga0207695_10028817 | Ga0207695_100288176 | 120 |
| 240 | 3300025913 | Ga0207695_10099638 | Ga0207695_100996384 | 120 |
| 241 | 3300025913 | Ga0207695_11306626 | Ga0207695_113066262 | 120 |
| 242 | 3300025914 | Ga0207671_10083639 | Ga0207671_100836394 | 120 |
| 243 | 3300025919 | Ga0207657_10002498 | Ga0207657_1000249815 | 120 |
| 244 | 3300025949 | Ga0207667_10019381 | Ga0207667_100193816 | 120 |
| 245 | 3300026075 | Ga0207708_10219495 | Ga0207708_102194952 | 120 |
| 246 | 3300026116 | Ga0207674_10822491 | Ga0207674_108224912 | 120 |
| 247 | 3300028800 | Ga0265338_10048468 | Ga0265338_100484683 | 120 |
| 248 | 3300031242 | Ga0265329_10305119 | Ga0265329_103051191 | 120 |
| 249 | 3300031711 | Ga0265314_10041508 | Ga0265314_100415083 | 120 |
| 250 | 3300035083 | Ga0373926_0098381 | Ga0373926_0098381_266_631 | 120 |
| 251 | 3300035692 | Ga0373935_0643690 | Ga0373935_0643690_385_750 | 120 |
| 252 | 3300035695 | Ga0373927_0009950 | Ga0373927_0009950_3807_4172 | 120 |
| 253 | 3300046472 | Ga0495580_0102942 | Ga0495580_0102942_456_821 | 120 |
| 254 | 3300049824 | Ga0501045_0253202 | Ga0501045_0253202_717_1082 | 120 |
| 255 | 3300060353 | Ga0501082_0419864 | Ga0501082_0419864_396_761 | 120 |
| 256 | 3300005329 | Ga0070683_100888707 | Ga0070683_1008887071 | 121 |
| 257 | 3300005330 | Ga0070690_100136936 | Ga0070690_1001369362 | 121 |
| 258 | 3300005335 | Ga0070666_10006360 | Ga0070666_100063607 | 121 |
| 259 | 3300005336 | Ga0070680_100192715 | Ga0070680_1001927154 | 121 |
| 260 | 3300005338 | Ga0068868_100023331 | Ga0068868_1000233316 | 121 |
| 261 | 3300005338 | Ga0068868_100774620 | Ga0068868_1007746201 | 121 |
| 262 | 3300005344 | Ga0070661_100123457 | Ga0070661_1001234572 | 121 |
| 263 | 3300005344 | Ga0070661_100587031 | Ga0070661_1005870313 | 121 |
| 264 | 3300005355 | Ga0070671_100280752 | Ga0070671_1002807524 | 121 |
| 265 | 3300005356 | Ga0070674_100943576 | Ga0070674_1009435762 | 121 |
| 266 | 3300005367 | Ga0070667_100349338 | Ga0070667_1003493383 | 121 |
| 267 | 3300005434 | Ga0070709_10020709 | Ga0070709_100207092 | 121 |
| 268 | 3300005437 | Ga0070710_10458279 | Ga0070710_104582792 | 121 |
| 269 | 3300005458 | Ga0070681_10028097 | Ga0070681_100280975 | 121 |
| 270 | 3300005459 | Ga0068867_100081357 | Ga0068867_1000813574 | 121 |
| 271 | 3300005468 | Ga0070707_102224400 | Ga0070707_1022244002 | 121 |
| 272 | 3300005535 | Ga0070684_100014596 | Ga0070684_1000145962 | 121 |
| 273 | 3300005539 | Ga0068853_100047771 | Ga0068853_1000477714 | 121 |
| 274 | 3300005547 | Ga0070693_100289739 | Ga0070693_1002897393 | 121 |
| 275 | 3300005548 | Ga0070665_100092473 | Ga0070665_1000924735 | 121 |
| 276 | 3300005563 | Ga0068855_100010330 | Ga0068855_10001033013 | 121 |
| 277 | 3300005563 | Ga0068855_100213986 | Ga0068855_1002139864 | 121 |
| 278 | 3300005563 | Ga0068855_100568609 | Ga0068855_1005686091 | 121 |
| 279 | 3300005564 | Ga0070664_100242323 | Ga0070664_1002423232 | 121 |
| 280 | 3300005577 | Ga0068857_100058439 | Ga0068857_1000584395 | 121 |
| 281 | 3300005614 | Ga0068856_100446216 | Ga0068856_1004462162 | 121 |
| 282 | 3300005616 | Ga0068852_100404776 | Ga0068852_1004047762 | 121 |
| 283 | 3300005617 | Ga0068859_100046390 | Ga0068859_1000463907 | 121 |
| 284 | 3300005718 | Ga0068866_10014578 | Ga0068866_100145784 | 121 |
| 285 | 3300005841 | Ga0068863_100066148 | Ga0068863_1000661484 | 121 |
| 286 | 3300005842 | Ga0068858_100000755 | Ga0068858_10000075520 | 121 |
| 287 | 3300005843 | Ga0068860_100001833 | Ga0068860_10000183313 | 121 |
| 288 | 3300006173 | Ga0070716_100454196 | Ga0070716_1004541962 | 121 |
| 289 | 3300006237 | Ga0097621_100001558 | Ga0097621_1000015581 | 121 |
| 290 | 3300006237 | Ga0097621_100184195 | Ga0097621_1001841954 | 121 |
| 291 | 3300006358 | Ga0068871_100019220 | Ga0068871_1000192201 | 121 |
| 292 | 3300006358 | Ga0068871_100070019 | Ga0068871_1000700195 | 121 |
| 293 | 3300006881 | Ga0068865_100030468 | Ga0068865_1000304684 | 121 |
| 294 | 3300006931 | Ga0097620_100046390 | Ga0097620_1000463903 | 121 |
| 295 | 3300009093 | Ga0105240_10090805 | Ga0105240_100908055 | 121 |
| 296 | 3300009093 | Ga0105240_11016622 | Ga0105240_110166222 | 121 |
| 297 | 3300009098 | Ga0105245_10004913 | Ga0105245_100049135 | 121 |
| 298 | 3300009098 | Ga0105245_10109467 | Ga0105245_101094675 | 121 |
| 299 | 3300009176 | Ga0105242_10041533 | Ga0105242_100415335 | 121 |
| 300 | 3300009176 | Ga0105242_10844648 | Ga0105242_108446482 | 121 |
| 301 | 3300009177 | Ga0105248_10005725 | Ga0105248_100057251 | 121 |
| 302 | 3300009177 | Ga0105248_10607861 | Ga0105248_106078612 | 121 |
| 303 | 3300009177 | Ga0105248_10687180 | Ga0105248_106871801 | 121 |
| 304 | 3300009545 | Ga0105237_10188416 | Ga0105237_101884164 | 121 |
| 305 | 3300009545 | Ga0105237_12170977 | Ga0105237_121709771 | 121 |
| 306 | 3300009553 | Ga0105249_10521510 | Ga0105249_105215102 | 121 |
| 307 | 3300010375 | Ga0105239_10034942 | Ga0105239_100349427 | 121 |
| 308 | 3300010375 | Ga0105239_10921552 | Ga0105239_109215522 | 121 |
| 309 | 3300011119 | Ga0105246_10344843 | Ga0105246_103448433 | 121 |
| 310 | 3300013104 | Ga0157370_10002147 | Ga0157370_1000214715 | 121 |
| 311 | 3300013104 | Ga0157370_10328247 | Ga0157370_103282471 | 121 |
| 312 | 3300013105 | Ga0157369_10104855 | Ga0157369_101048556 | 121 |
| 313 | 3300013296 | Ga0157374_10048728 | Ga0157374_100487283 | 121 |
| 314 | 3300013297 | Ga0157378_10059883 | Ga0157378_100598832 | 121 |
| 315 | 3300013297 | Ga0157378_10587194 | Ga0157378_105871942 | 121 |
| 316 | 3300013306 | Ga0163162_10090556 | Ga0163162_100905561 | 121 |
| 317 | 3300013306 | Ga0163162_11029248 | Ga0163162_110292481 | 121 |
| 318 | 3300013308 | Ga0157375_10342448 | Ga0157375_103424482 | 121 |
| 319 | 3300013308 | Ga0157375_10490049 | Ga0157375_104900494 | 121 |
| 320 | 3300014325 | Ga0163163_10028159 | Ga0163163_100281597 | 121 |
| 321 | 3300014968 | Ga0157379_10049938 | Ga0157379_100499384 | 121 |
| 322 | 3300014969 | Ga0157376_10054769 | Ga0157376_100547693 | 121 |
| 323 | 3300025899 | Ga0207642_10013851 | Ga0207642_100138513 | 121 |
| 324 | 3300025903 | Ga0207680_10138723 | Ga0207680_101387233 | 121 |
| 325 | 3300025911 | Ga0207654_10157132 | Ga0207654_101571321 | 121 |
| 326 | 3300025912 | Ga0207707_10019197 | Ga0207707_100191977 | 121 |
| 327 | 3300025913 | Ga0207695_10053575 | Ga0207695_100535755 | 121 |
| 328 | 3300025913 | Ga0207695_10179309 | Ga0207695_101793092 | 121 |
| 329 | 3300025914 | Ga0207671_10150100 | Ga0207671_101501004 | 121 |
| 330 | 3300025916 | Ga0207663_10713728 | Ga0207663_107137282 | 121 |
| 331 | 3300025920 | Ga0207649_10270259 | Ga0207649_102702592 | 121 |
| 332 | 3300025920 | Ga0207649_10489663 | Ga0207649_104896633 | 121 |
| 333 | 3300025921 | Ga0207652_10118993 | Ga0207652_101189931 | 121 |
| 334 | 3300025924 | Ga0207694_10002164 | Ga0207694_1000216414 | 121 |
| 335 | 3300025927 | Ga0207687_10010241 | Ga0207687_100102415 | 121 |
| 336 | 3300025927 | Ga0207687_10075778 | Ga0207687_100757781 | 121 |
| 337 | 3300025934 | Ga0207686_10005602 | Ga0207686_100056027 | 121 |
| 338 | 3300025934 | Ga0207686_10362700 | Ga0207686_103627001 | 121 |
| 339 | 3300025934 | Ga0207686_10439724 | Ga0207686_104397242 | 121 |
| 340 | 3300025937 | Ga0207669_11236223 | Ga0207669_112362232 | 121 |
| 341 | 3300025938 | Ga0207704_10019841 | Ga0207704_100198413 | 121 |
| 342 | 3300025939 | Ga0207665_10956034 | Ga0207665_109560341 | 121 |
| 343 | 3300025941 | Ga0207711_10003764 | Ga0207711_100037645 | 121 |
| 344 | 3300025941 | Ga0207711_10414139 | Ga0207711_104141392 | 121 |
| 345 | 3300025944 | Ga0207661_11132106 | Ga0207661_111321062 | 121 |
| 346 | 3300025945 | Ga0207679_10055482 | Ga0207679_100554825 | 121 |
| 347 | 3300025949 | Ga0207667_10009718 | Ga0207667_1000971812 | 121 |
| 348 | 3300025961 | Ga0207712_10853714 | Ga0207712_108537142 | 121 |
| 349 | 3300025986 | Ga0207658_10821324 | Ga0207658_108213242 | 121 |
| 350 | 3300026023 | Ga0207677_10017429 | Ga0207677_100174295 | 121 |
| 351 | 3300026023 | Ga0207677_10166802 | Ga0207677_101668021 | 121 |
| 352 | 3300026023 | Ga0207677_11736116 | Ga0207677_117361161 | 121 |
| 353 | 3300026035 | Ga0207703_10010386 | Ga0207703_100103867 | 121 |
| 354 | 3300026041 | Ga0207639_10246617 | Ga0207639_102466172 | 121 |
| 355 | 3300026078 | Ga0207702_10522921 | Ga0207702_105229213 | 121 |
| 356 | 3300026078 | Ga0207702_11375678 | Ga0207702_113756782 | 121 |
| 357 | 3300026089 | Ga0207648_10023853 | Ga0207648_100238538 | 121 |
| 358 | 3300026116 | Ga0207674_10020184 | Ga0207674_100201844 | 121 |
| 359 | 3300026116 | Ga0207674_10225552 | Ga0207674_102255521 | 121 |
| 360 | 3300026142 | Ga0207698_10307540 | Ga0207698_103075404 | 121 |
| 361 | 3300026142 | Ga0207698_11070582 | Ga0207698_110705823 | 121 |
| 362 | 3300028379 | Ga0268266_10231470 | Ga0268266_102314704 | 121 |
| 363 | 3300028381 | Ga0268264_10008523 | Ga0268264_100085238 | 121 |
| 364 | 3300028800 | Ga0265338_10428257 | Ga0265338_104282571 | 121 |
| 365 | 3300031249 | Ga0265339_10304183 | Ga0265339_103041832 | 121 |
| 366 | 3300031712 | Ga0265342_10305998 | Ga0265342_103059983 | 121 |
| 367 | 3300035113 | Ga0373936_0047851 | Ga0373936_0047851_1195_1563 | 121 |
| 368 | 3300035116 | Ga0373945_0345719 | Ga0373945_0345719_194_562 | 121 |
| 369 | 3300035691 | Ga0373931_1292139 | Ga0373931_1292139_85_453 | 121 |
| 370 | 3300035692 | Ga0373935_1476696 | Ga0373935_1476696_14_385 | 121 |
| 371 | 3300035695 | Ga0373927_0057982 | Ga0373927_0057982_1457_1825 | 121 |
| 372 | 3300035725 | Ga0373947_0057530 | Ga0373947_0057530_1727_2095 | 121 |
| 373 | 3300036401 | Ga0373937_1096293 | Ga0373937_1096293_274_642 | 121 |
| 374 | 3300037068 | Ga0373925_0174285 | Ga0373925_0174285_990_1358 | 121 |
| 375 | 3300037068 | Ga0373925_0200879 | Ga0373925_0200879_543_911 | 121 |
| 376 | 3300046472 | Ga0495580_0115221 | Ga0495580_0115221_527_895 | 121 |
| 377 | 3300046473 | Ga0495582_0479886 | Ga0495582_0479886_340_708 | 121 |
| 378 | 3300046516 | Ga0495628_0604900 | Ga0495628_0604900_396_764 | 121 |
| 379 | 3300046526 | Ga0495666_0102408 | Ga0495666_0102408_520_888 | 121 |
| 380 | 3300047319 | Ga0495674_0341773 | Ga0495674_0341773_11_379 | 121 |
| 381 | 3300047471 | Ga0495684_0600517 | Ga0495684_0600517_266_634 | 121 |
| 382 | 3300004803 | Ga0058862_12552942 | Ga0058862_125529421 | 122 |
| 383 | 3300005327 | Ga0070658_10605987 | Ga0070658_106059872 | 122 |
| 384 | 3300005329 | Ga0070683_100195529 | Ga0070683_1001955293 | 122 |
| 385 | 3300005336 | Ga0070680_100018669 | Ga0070680_1000186694 | 122 |
| 386 | 3300005336 | Ga0070680_100347628 | Ga0070680_1003476283 | 122 |
| 387 | 3300005336 | Ga0070680_100467265 | Ga0070680_1004672652 | 122 |
| 388 | 3300005336 | Ga0070680_100789994 | Ga0070680_1007899942 | 122 |
| 389 | 3300005338 | Ga0068868_100018643 | Ga0068868_1000186432 | 122 |
| 390 | 3300005339 | Ga0070660_100956126 | Ga0070660_1009561262 | 122 |
| 391 | 3300005344 | Ga0070661_100197857 | Ga0070661_1001978573 | 122 |
| 392 | 3300005344 | Ga0070661_100401851 | Ga0070661_1004018511 | 122 |
| 393 | 3300005344 | Ga0070661_100409291 | Ga0070661_1004092912 | 122 |
| 394 | 3300005345 | Ga0070692_10215163 | Ga0070692_102151632 | 122 |
| 395 | 3300005355 | Ga0070671_100099394 | Ga0070671_1000993944 | 122 |
| 396 | 3300005355 | Ga0070671_100901345 | Ga0070671_1009013452 | 122 |
| 397 | 3300005364 | Ga0070673_101709683 | Ga0070673_1017096832 | 122 |
| 398 | 3300005366 | Ga0070659_100166462 | Ga0070659_1001664623 | 122 |
| 399 | 3300005367 | Ga0070667_100580878 | Ga0070667_1005808782 | 122 |
| 400 | 3300005434 | Ga0070709_11005761 | Ga0070709_110057611 | 122 |
| 401 | 3300005435 | Ga0070714_100069781 | Ga0070714_1000697814 | 122 |
| 402 | 3300005435 | Ga0070714_100146572 | Ga0070714_1001465724 | 122 |
| 403 | 3300005436 | Ga0070713_101540378 | Ga0070713_1015403781 | 122 |
| 404 | 3300005439 | Ga0070711_100032596 | Ga0070711_1000325964 | 122 |
| 405 | 3300005455 | Ga0070663_100080656 | Ga0070663_1000806564 | 122 |
| 406 | 3300005455 | Ga0070663_100476034 | Ga0070663_1004760342 | 122 |
| 407 | 3300005456 | Ga0070678_100092641 | Ga0070678_1000926411 | 122 |
| 408 | 3300005456 | Ga0070678_101999017 | Ga0070678_1019990171 | 122 |
| 409 | 3300005457 | Ga0070662_101618970 | Ga0070662_1016189701 | 122 |
| 410 | 3300005458 | Ga0070681_10139831 | Ga0070681_101398314 | 122 |
| 411 | 3300005458 | Ga0070681_10180010 | Ga0070681_101800104 | 122 |
| 412 | 3300005458 | Ga0070681_10255979 | Ga0070681_102559794 | 122 |
| 413 | 3300005458 | Ga0070681_10822276 | Ga0070681_108222762 | 122 |
| 414 | 3300005459 | Ga0068867_101794928 | Ga0068867_1017949281 | 122 |
| 415 | 3300005530 | Ga0070679_100087651 | Ga0070679_1000876514 | 122 |
| 416 | 3300005535 | Ga0070684_100517949 | Ga0070684_1005179491 | 122 |
| 417 | 3300005539 | Ga0068853_100037198 | Ga0068853_1000371985 | 122 |
| 418 | 3300005539 | Ga0068853_100343677 | Ga0068853_1003436773 | 122 |
| 419 | 3300005539 | Ga0068853_100413171 | Ga0068853_1004131712 | 122 |
| 420 | 3300005546 | Ga0070696_101599923 | Ga0070696_1015999231 | 122 |
| 421 | 3300005548 | Ga0070665_100012183 | Ga0070665_1000121835 | 122 |
| 422 | 3300005548 | Ga0070665_100195190 | Ga0070665_1001951904 | 122 |
| 423 | 3300005548 | Ga0070665_100279803 | Ga0070665_1002798034 | 122 |
| 424 | 3300005563 | Ga0068855_100115444 | Ga0068855_1001154442 | 122 |
| 425 | 3300005563 | Ga0068855_100211219 | Ga0068855_1002112193 | 122 |
| 426 | 3300005563 | Ga0068855_100605453 | Ga0068855_1006054531 | 122 |
| 427 | 3300005564 | Ga0070664_100155410 | Ga0070664_1001554103 | 122 |
| 428 | 3300005577 | Ga0068857_100001847 | Ga0068857_10000184711 | 122 |
| 429 | 3300005577 | Ga0068857_100499715 | Ga0068857_1004997152 | 122 |
| 430 | 3300005577 | Ga0068857_100670809 | Ga0068857_1006708092 | 122 |
| 431 | 3300005614 | Ga0068856_100029579 | Ga0068856_1000295791 | 122 |
| 432 | 3300005614 | Ga0068856_100033181 | Ga0068856_1000331814 | 122 |
| 433 | 3300005614 | Ga0068856_100062282 | Ga0068856_1000622821 | 122 |
| 434 | 3300005614 | Ga0068856_100310341 | Ga0068856_1003103413 | 122 |
| 435 | 3300005614 | Ga0068856_101033466 | Ga0068856_1010334662 | 122 |
| 436 | 3300005614 | Ga0068856_101452587 | Ga0068856_1014525871 | 122 |
| 437 | 3300005616 | Ga0068852_100028325 | Ga0068852_1000283252 | 122 |
| 438 | 3300005616 | Ga0068852_101617479 | Ga0068852_1016174791 | 122 |
| 439 | 3300005617 | Ga0068859_100240242 | Ga0068859_1002402422 | 122 |
| 440 | 3300005618 | Ga0068864_100019910 | Ga0068864_1000199102 | 122 |
| 441 | 3300005841 | Ga0068863_100009340 | Ga0068863_1000093407 | 122 |
| 442 | 3300005841 | Ga0068863_102355958 | Ga0068863_1023559581 | 122 |
| 443 | 3300005842 | Ga0068858_100008800 | Ga0068858_1000088007 | 122 |
| 444 | 3300005842 | Ga0068858_100973907 | Ga0068858_1009739071 | 122 |
| 445 | 3300005843 | Ga0068860_102251113 | Ga0068860_1022511131 | 122 |
| 446 | 3300005937 | Ga0081455_10062775 | Ga0081455_100627753 | 122 |
| 447 | 3300006028 | Ga0070717_10004755 | Ga0070717_100047554 | 122 |
| 448 | 3300006028 | Ga0070717_10905983 | Ga0070717_109059831 | 122 |
| 449 | 3300006175 | Ga0070712_100135808 | Ga0070712_1001358082 | 122 |
| 450 | 3300006237 | Ga0097621_100036842 | Ga0097621_1000368421 | 122 |
| 451 | 3300006237 | Ga0097621_100470791 | Ga0097621_1004707912 | 122 |
| 452 | 3300006358 | Ga0068871_100034190 | Ga0068871_1000341905 | 122 |
| 453 | 3300006358 | Ga0068871_100180177 | Ga0068871_1001801772 | 122 |
| 454 | 3300006358 | Ga0068871_100393295 | Ga0068871_1003932951 | 122 |
| 455 | 3300006931 | Ga0097620_100240225 | Ga0097620_1002402254 | 122 |
| 456 | 3300009098 | Ga0105245_10278380 | Ga0105245_102783804 | 122 |
| 457 | 3300009098 | Ga0105245_11354416 | Ga0105245_113544162 | 122 |
| 458 | 3300009101 | Ga0105247_10275450 | Ga0105247_102754503 | 122 |
| 459 | 3300009148 | Ga0105243_11395399 | Ga0105243_113953992 | 122 |
| 460 | 3300009174 | Ga0105241_10012575 | Ga0105241_100125758 | 122 |
| 461 | 3300009174 | Ga0105241_10028194 | Ga0105241_100281944 | 122 |
| 462 | 3300009174 | Ga0105241_10054670 | Ga0105241_100546705 | 122 |
| 463 | 3300009176 | Ga0105242_10229351 | Ga0105242_102293514 | 122 |
| 464 | 3300009177 | Ga0105248_10102838 | Ga0105248_101028385 | 122 |
| 465 | 3300009177 | Ga0105248_11150061 | Ga0105248_111500612 | 122 |
| 466 | 3300009545 | Ga0105237_10162513 | Ga0105237_101625135 | 122 |
| 467 | 3300009545 | Ga0105237_11026884 | Ga0105237_110268842 | 122 |
| 468 | 3300009551 | Ga0105238_10024897 | Ga0105238_100248977 | 122 |
| 469 | 3300009551 | Ga0105238_10487384 | Ga0105238_104873841 | 122 |
| 470 | 3300009553 | Ga0105249_12204392 | Ga0105249_122043921 | 122 |
| 471 | 3300010375 | Ga0105239_10266158 | Ga0105239_102661584 | 122 |
| 472 | 3300010375 | Ga0105239_10405486 | Ga0105239_104054863 | 122 |
| 473 | 3300010375 | Ga0105239_10801982 | Ga0105239_108019823 | 122 |
| 474 | 3300011119 | Ga0105246_11048947 | Ga0105246_110489472 | 122 |
| 475 | 3300013100 | Ga0157373_10082321 | Ga0157373_100823212 | 122 |
| 476 | 3300013100 | Ga0157373_10222800 | Ga0157373_102228002 | 122 |
| 477 | 3300013100 | Ga0157373_10286718 | Ga0157373_102867183 | 122 |
| 478 | 3300013104 | Ga0157370_10023389 | Ga0157370_100233893 | 122 |
| 479 | 3300013104 | Ga0157370_10295224 | Ga0157370_102952242 | 122 |
| 480 | 3300013104 | Ga0157370_10329604 | Ga0157370_103296043 | 122 |
| 481 | 3300013105 | Ga0157369_10013033 | Ga0157369_1001303310 | 122 |
| 482 | 3300013105 | Ga0157369_10216259 | Ga0157369_102162594 | 122 |
| 483 | 3300013105 | Ga0157369_10235210 | Ga0157369_102352102 | 122 |
| 484 | 3300013105 | Ga0157369_10677113 | Ga0157369_106771131 | 122 |
| 485 | 3300013296 | Ga0157374_10052188 | Ga0157374_100521884 | 122 |
| 486 | 3300013296 | Ga0157374_12543211 | Ga0157374_125432111 | 122 |
| 487 | 3300013297 | Ga0157378_11240793 | Ga0157378_112407932 | 122 |
| 488 | 3300013306 | Ga0163162_10082249 | Ga0163162_100822495 | 122 |
| 489 | 3300013307 | Ga0157372_10140298 | Ga0157372_101402984 | 122 |
| 490 | 3300013307 | Ga0157372_10697203 | Ga0157372_106972033 | 122 |
| 491 | 3300013307 | Ga0157372_11645972 | Ga0157372_116459722 | 122 |
| 492 | 3300013307 | Ga0157372_11902025 | Ga0157372_119020251 | 122 |
| 493 | 3300013308 | Ga0157375_11081270 | Ga0157375_110812702 | 122 |
| 494 | 3300014325 | Ga0163163_10019654 | Ga0163163_100196546 | 122 |
| 495 | 3300014325 | Ga0163163_10022881 | Ga0163163_100228817 | 122 |
| 496 | 3300014968 | Ga0157379_10011068 | Ga0157379_100110686 | 122 |
| 497 | 3300014969 | Ga0157376_10635313 | Ga0157376_106353131 | 122 |
| 498 | 3300020069 | Ga0197907_10478193 | Ga0197907_104781933 | 122 |
| 499 | 3300020076 | Ga0206355_1016973 | Ga0206355_10169732 | 122 |
| 500 | 3300020076 | Ga0206355_1181757 | Ga0206355_11817573 | 122 |
| 501 | 3300020076 | Ga0206355_1610152 | Ga0206355_16101523 | 122 |
| 502 | 3300020080 | Ga0206350_10782737 | Ga0206350_107827372 | 122 |
| 503 | 3300020081 | Ga0206354_10271648 | Ga0206354_102716482 | 122 |
| 504 | 3300020610 | Ga0154015_1076892 | Ga0154015_10768922 | 122 |
| 505 | 3300021361 | Ga0213872_10019520 | Ga0213872_100195204 | 122 |
| 506 | 3300021384 | Ga0213876_10002108 | Ga0213876_100021088 | 122 |
| 507 | 3300021384 | Ga0213876_10159913 | Ga0213876_101599133 | 122 |
| 508 | 3300021384 | Ga0213876_10628131 | Ga0213876_106281312 | 122 |
| 509 | 3300021388 | Ga0213875_10000005 | Ga0213875_10000005372 | 122 |
| 510 | 3300021388 | Ga0213875_10000032 | Ga0213875_1000003271 | 122 |
| 511 | 3300021388 | Ga0213875_10004701 | Ga0213875_100047013 | 122 |
| 512 | 3300021388 | Ga0213875_10052390 | Ga0213875_100523903 | 122 |
| 513 | 3300021388 | Ga0213875_10083560 | Ga0213875_100835603 | 122 |
| 514 | 3300021388 | Ga0213875_10116236 | Ga0213875_101162364 | 122 |
| 515 | 3300021388 | Ga0213875_10119406 | Ga0213875_101194062 | 122 |
| 516 | 3300021388 | Ga0213875_10493512 | Ga0213875_104935122 | 122 |
| 517 | 3300025909 | Ga0207705_10694328 | Ga0207705_106943281 | 122 |
| 518 | 3300025911 | Ga0207654_10053839 | Ga0207654_100538394 | 122 |
| 519 | 3300025911 | Ga0207654_10838129 | Ga0207654_108381292 | 122 |
| 520 | 3300025912 | Ga0207707_10083251 | Ga0207707_100832514 | 122 |
| 521 | 3300025912 | Ga0207707_10124928 | Ga0207707_101249281 | 122 |
| 522 | 3300025912 | Ga0207707_10682426 | Ga0207707_106824262 | 122 |
| 523 | 3300025912 | Ga0207707_11088897 | Ga0207707_110888971 | 122 |
| 524 | 3300025913 | Ga0207695_10758795 | Ga0207695_107587952 | 122 |
| 525 | 3300025914 | Ga0207671_10110645 | Ga0207671_101106452 | 122 |
| 526 | 3300025914 | Ga0207671_10583272 | Ga0207671_105832722 | 122 |
| 527 | 3300025915 | Ga0207693_10377755 | Ga0207693_103777552 | 122 |
| 528 | 3300025916 | Ga0207663_10034577 | Ga0207663_100345774 | 122 |
| 529 | 3300025917 | Ga0207660_10040808 | Ga0207660_100408084 | 122 |
| 530 | 3300025917 | Ga0207660_10908621 | Ga0207660_109086211 | 122 |
| 531 | 3300025919 | Ga0207657_10784366 | Ga0207657_107843662 | 122 |
| 532 | 3300025920 | Ga0207649_10198100 | Ga0207649_101981003 | 122 |
| 533 | 3300025920 | Ga0207649_10310410 | Ga0207649_103104103 | 122 |
| 534 | 3300025921 | Ga0207652_10030242 | Ga0207652_100302425 | 122 |
| 535 | 3300025921 | Ga0207652_10073269 | Ga0207652_100732694 | 122 |
| 536 | 3300025921 | Ga0207652_10205254 | Ga0207652_102052543 | 122 |
| 537 | 3300025924 | Ga0207694_10028823 | Ga0207694_100288236 | 122 |
| 538 | 3300025924 | Ga0207694_10407300 | Ga0207694_104073003 | 122 |
| 539 | 3300025927 | Ga0207687_10038732 | Ga0207687_100387324 | 122 |
| 540 | 3300025928 | Ga0207700_10483900 | Ga0207700_104839003 | 122 |
| 541 | 3300025928 | Ga0207700_10722293 | Ga0207700_107222931 | 122 |
| 542 | 3300025928 | Ga0207700_11971657 | Ga0207700_119716571 | 122 |
| 543 | 3300025929 | Ga0207664_10834828 | Ga0207664_108348281 | 122 |
| 544 | 3300025931 | Ga0207644_10383002 | Ga0207644_103830023 | 122 |
| 545 | 3300025932 | Ga0207690_10017593 | Ga0207690_100175933 | 122 |
| 546 | 3300025933 | Ga0207706_10142484 | Ga0207706_101424843 | 122 |
| 547 | 3300025934 | Ga0207686_10227632 | Ga0207686_102276322 | 122 |
| 548 | 3300025941 | Ga0207711_10006942 | Ga0207711_100069425 | 122 |
| 549 | 3300025941 | Ga0207711_10644232 | Ga0207711_106442322 | 122 |
| 550 | 3300025941 | Ga0207711_11800448 | Ga0207711_118004482 | 122 |
| 551 | 3300025942 | Ga0207689_10270410 | Ga0207689_102704102 | 122 |
| 552 | 3300025944 | Ga0207661_10703845 | Ga0207661_107038453 | 122 |
| 553 | 3300025945 | Ga0207679_10033266 | Ga0207679_100332663 | 122 |
| 554 | 3300025945 | Ga0207679_10893046 | Ga0207679_108930462 | 122 |
| 555 | 3300025949 | Ga0207667_10093738 | Ga0207667_100937382 | 122 |
| 556 | 3300025981 | Ga0207640_10723355 | Ga0207640_107233553 | 122 |
| 557 | 3300025986 | Ga0207658_10125245 | Ga0207658_101252454 | 122 |
| 558 | 3300026023 | Ga0207677_10405488 | Ga0207677_104054882 | 122 |
| 559 | 3300026035 | Ga0207703_10018464 | Ga0207703_100184647 | 122 |
| 560 | 3300026035 | Ga0207703_10208527 | Ga0207703_102085274 | 122 |
| 561 | 3300026041 | Ga0207639_10017212 | Ga0207639_100172125 | 122 |
| 562 | 3300026041 | Ga0207639_10971520 | Ga0207639_109715202 | 122 |
| 563 | 3300026067 | Ga0207678_10015939 | Ga0207678_100159398 | 122 |
| 564 | 3300026067 | Ga0207678_10234034 | Ga0207678_102340343 | 122 |
| 565 | 3300026067 | Ga0207678_10429065 | Ga0207678_104290652 | 122 |
| 566 | 3300026078 | Ga0207702_10011018 | Ga0207702_100110181 | 122 |
| 567 | 3300026078 | Ga0207702_10096877 | Ga0207702_100968773 | 122 |
| 568 | 3300026078 | Ga0207702_10324265 | Ga0207702_103242652 | 122 |
| 569 | 3300026078 | Ga0207702_12004937 | Ga0207702_120049371 | 122 |
| 570 | 3300026088 | Ga0207641_10837064 | Ga0207641_108370641 | 122 |
| 571 | 3300026089 | Ga0207648_10917814 | Ga0207648_109178142 | 122 |
| 572 | 3300026095 | Ga0207676_10005545 | Ga0207676_1000554511 | 122 |
| 573 | 3300026116 | Ga0207674_10103476 | Ga0207674_101034765 | 122 |
| 574 | 3300026116 | Ga0207674_10987657 | Ga0207674_109876572 | 122 |
| 575 | 3300026142 | Ga0207698_10076766 | Ga0207698_100767665 | 122 |
| 576 | 3300026142 | Ga0207698_10930288 | Ga0207698_109302883 | 122 |
| 577 | 3300026142 | Ga0207698_11616383 | Ga0207698_116163831 | 122 |
| 578 | 3300028379 | Ga0268266_10014693 | Ga0268266_100146937 | 122 |
| 579 | 3300028379 | Ga0268266_10178037 | Ga0268266_101780374 | 122 |
| 580 | 3300028379 | Ga0268266_10791949 | Ga0268266_107919492 | 122 |
| 581 | 3300031090 | Ga0265760_10097150 | Ga0265760_100971502 | 122 |
| 582 | 3300035172 | Ga0373955_0601032 | Ga0373955_0601032_252_635 | 122 |
| 583 | 3300035241 | Ga0373961_0086987 | Ga0373961_0086987_165_545 | 122 |
| 584 | 3300035691 | Ga0373931_0163320 | Ga0373931_0163320_197_577 | 122 |
| 585 | 3300035691 | Ga0373931_0491434 | Ga0373931_0491434_194_577 | 122 |
| 586 | 3300035692 | Ga0373935_0012503 | Ga0373935_0012503_4084_4452 | 122 |
| 587 | 3300036401 | Ga0373937_0301627 | Ga0373937_0301627_899_1282 | 122 |
| 588 | 3300037418 | Ga0395900_0191212 | Ga0395900_0191212_1325_1693 | 122 |
| 589 | 3300037466 | Ga0395898_0106005 | Ga0395898_0106005_1139_1507 | 122 |
| 590 | 3300037853 | Ga0436364_0010332 | Ga0436364_0010332_411_779 | 122 |
| 591 | 3300037853 | Ga0436364_0031051 | Ga0436364_0031051_378_746 | 122 |
| 592 | 3300037853 | Ga0436364_0132953 | Ga0436364_0132953_5030_5398 | 122 |
| 593 | 3300037853 | Ga0436364_0157811 | Ga0436364_0157811_155159_155527 | 122 |
| 594 | 3300037853 | Ga0436364_0202263 | Ga0436364_0202263_14504_14872 | 122 |
| 595 | 3300037853 | Ga0436364_0282990 | Ga0436364_0282990_201_569 | 122 |
| 596 | 3300037853 | Ga0436364_0457930 | Ga0436364_0457930_4734_5102 | 122 |
| 597 | 3300037853 | Ga0436364_0483108 | Ga0436364_0483108_1182_1550 | 122 |
| 598 | 3300037853 | Ga0436364_0520948 | Ga0436364_0520948_2783_3151 | 122 |
| 599 | 3300037853 | Ga0436364_0647542 | Ga0436364_0647542_722_1090 | 122 |
| 600 | 3300037853 | Ga0436364_0715739 | Ga0436364_0715739_7706_8074 | 122 |
| 601 | 3300037853 | Ga0436364_0833005 | Ga0436364_0833005_681_1049 | 122 |
| 602 | 3300037853 | Ga0436364_1074294 | Ga0436364_1074294_703_1074 | 122 |
| 603 | 3300037853 | Ga0436364_1108687 | Ga0436364_1108687_2042_2410 | 122 |
| 604 | 3300037853 | Ga0436364_1294932 | Ga0436364_1294932_913_1281 | 122 |
| 605 | 3300037853 | Ga0436364_1299641 | Ga0436364_1299641_157_525 | 122 |
| 606 | 3300037853 | Ga0436364_1369623 | Ga0436364_1369623_8058_8426 | 122 |
| 607 | 3300037853 | Ga0436364_1443683 | Ga0436364_1443683_130_498 | 122 |
| 608 | 3300037853 | Ga0436364_1500628 | Ga0436364_1500628_1602_1970 | 122 |
| 609 | 3300037853 | Ga0436364_1561923 | Ga0436364_1561923_418_786 | 122 |
| 610 | 3300039437 | Ga0436365_0068008 | Ga0436365_0068008_4284_4652 | 122 |
| 611 | 3300039437 | Ga0436365_0205552 | Ga0436365_0205552_693_1061 | 122 |
| 612 | 3300039437 | Ga0436365_0279355 | Ga0436365_0279355_140_508 | 122 |
| 613 | 3300039437 | Ga0436365_0693032 | Ga0436365_0693032_574_942 | 122 |
| 614 | 3300039437 | Ga0436365_0837841 | Ga0436365_0837841_343_711 | 122 |
| 615 | 3300039437 | Ga0436365_0892357 | Ga0436365_0892357_4771_5139 | 122 |
| 616 | 3300039437 | Ga0436365_1336592 | Ga0436365_1336592_141_509 | 122 |
| 617 | 3300039438 | Ga0436360_1116020 | Ga0436360_1116020_101_469 | 122 |
| 618 | 3300039447 | Ga0436361_0377638 | Ga0436361_0377638_781_1149 | 122 |
| 619 | 3300039450 | Ga0436363_0094956 | Ga0436363_0094956_31_399 | 122 |
| 620 | 3300039450 | Ga0436363_0612539 | Ga0436363_0612539_553_921 | 122 |
| 621 | 3300039450 | Ga0436363_1512130 | Ga0436363_1512130_2715_3083 | 122 |
| 622 | 3300039453 | Ga0436362_0280648 | Ga0436362_0280648_473_841 | 122 |
| 623 | 3300039453 | Ga0436362_0647631 | Ga0436362_0647631_516_884 | 122 |
| 624 | 3300039453 | Ga0436362_1121200 | Ga0436362_1121200_147_515 | 122 |
| 625 | 3300044694 | Ga0466963_0120787 | Ga0466963_0120787_713_1081 | 122 |
| 626 | 3300044694 | Ga0466963_0512189 | Ga0466963_0512189_264_632 | 122 |
| 627 | 3300045049 | Ga0466959_1089089 | Ga0466959_1089089_49_417 | 122 |
| 628 | 3300045836 | Ga0466958_0080423 | Ga0466958_0080423_277_645 | 122 |
| 629 | 3300046472 | Ga0495580_0045958 | Ga0495580_0045958_515_898 | 122 |
| 630 | 3300046472 | Ga0495580_0292998 | Ga0495580_0292998_18_386 | 122 |
| 631 | 3300046678 | Ga0495599_0540955 | Ga0495599_0540955_137_520 | 122 |
| 632 | 3300047322 | Ga0495680_0181699 | Ga0495680_0181699_755_1132 | 122 |
| 633 | 3300048088 | Ga0495602_0499955 | Ga0495602_0499955_377_760 | 122 |
| 634 | 3300048908 | Ga0496105_0199801 | Ga0496105_0199801_1230_1598 | 122 |
| 635 | 3300048915 | Ga0496112_0468036 | Ga0496112_0468036_446_826 | 122 |
| 636 | 3300048918 | Ga0496115_0098693 | Ga0496115_0098693_825_1193 | 122 |
| 637 | 3300049569 | Ga0501032_0358148 | Ga0501032_0358148_456_824 | 122 |
| 638 | 3300049571 | Ga0501034_0083100 | Ga0501034_0083100_1160_1528 | 122 |
| 639 | 3300049571 | Ga0501034_0609268 | Ga0501034_0609268_168_536 | 122 |
| 640 | 3300049573 | Ga0501037_0056145 | Ga0501037_0056145_1504_1872 | 122 |
| 641 | 3300049573 | Ga0501037_0169131 | Ga0501037_0169131_305_673 | 122 |
| 642 | 3300049574 | Ga0501038_0243224 | Ga0501038_0243224_828_1196 | 122 |
| 643 | 3300049579 | Ga0501043_0170832 | Ga0501043_0170832_224_592 | 122 |
| 644 | 3300049580 | Ga0501046_0287212 | Ga0501046_0287212_348_716 | 122 |
| 645 | 3300049581 | Ga0501047_0063330 | Ga0501047_0063330_842_1210 | 122 |
| 646 | 3300049581 | Ga0501047_0086128 | Ga0501047_0086128_1666_2034 | 122 |
| 647 | 3300049582 | Ga0501048_0097911 | Ga0501048_0097911_1014_1382 | 122 |
| 648 | 3300049585 | Ga0501069_0206694 | Ga0501069_0206694_149_517 | 122 |
| 649 | 3300049586 | Ga0501070_0084428 | Ga0501070_0084428_1148_1516 | 122 |
| 650 | 3300049589 | Ga0501073_0327214 | Ga0501073_0327214_245_613 | 122 |
| 651 | 3300049590 | Ga0501074_0252918 | Ga0501074_0252918_287_655 | 122 |
| 652 | 3300049822 | Ga0501035_0002323 | Ga0501035_0002323_2358_2726 | 122 |
| 653 | 3300049823 | Ga0501044_0001094 | Ga0501044_0001094_1127_1495 | 122 |
| 654 | 3300049823 | Ga0501044_0001731 | Ga0501044_0001731_2347_2715 | 122 |
| 655 | 3300049823 | Ga0501044_0961468 | Ga0501044_0961468_41_409 | 122 |
| 656 | 3300053077 | Ga0495601_0100599 | Ga0495601_0100599_228_596 | 122 |
| 657 | 3300059630 | Ga0587128_052210 | Ga0587128_052210_332_700 | 122 |
| 658 | 3300059640 | Ga0587067_046716 | Ga0587067_046716_329_697 | 122 |
| 659 | 3300059647 | Ga0587079_199730 | Ga0587079_199730_149_517 | 122 |
| 660 | 3300059655 | Ga0587114_044098 | Ga0587114_044098_38_406 | 122 |
| 661 | 3300061719 | Ga0466962_0406631 | Ga0466962_0406631_96_464 | 122 |
| 662 | 3300005455 | Ga0070663_102068931 | Ga0070663_1020689311 | 124 |
| 663 | 3300004800 | Ga0058861_11975732 | Ga0058861_119757321 | 145 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar