F473540

General Info

Members Datasets Scaffolds Average Seq Length
663 254 663 122

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_102068931|Ga0070663_1020689311
Length 145
Sequence MHVPASSPPTGRSGPVCKSKGENVPRVKRGTGRRDYRRKTLRLAKGFFLTKSKLNRAAQEAVEKALRYGYVGRRRKKRDFRSLWIVRINAACRTSEISYSKFISGLKRAGIDLNRKVLADIAVNDGPGFQTLVEKAKAAHQAQLQ

Samples

Sample ID Description Type Environment
1 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
101 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 2.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.36
Rhizosphere 92.46
Stem 0
Stem Tuber 0
Unclassified 6.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058861_11975732 3300004800 Bacteria 1213
2 Ga0058862_12552942 3300004803 Bacteria 734
3 Ga0070658_10531955 3300005327 Bacteria 1016
4 Ga0070658_10605987 3300005327 Unclassified 949
5 Ga0070676_10192556 3300005328 Unclassified 1332
6 Ga0070683_100195529 3300005329 Unclassified 1920
7 Ga0070683_100295948 3300005329 Bacteria 1539
8 Ga0070683_100888707 3300005329 Unclassified 855
9 Ga0070683_101342436 3300005329 Bacteria 687
10 Ga0070690_100136936 3300005330 Bacteria 1659
11 Ga0068869_101398968 3300005334 Bacteria 619
12 Ga0070666_10006360 3300005335 Bacteria 7266
13 Ga0070666_11302483 3300005335 Bacteria 542
14 Ga0070680_100018669 3300005336 Bacteria 5484
15 Ga0070680_100192715 3300005336 Bacteria 1718
16 Ga0070680_100347628 3300005336 Bacteria 1261
17 Ga0070680_100467265 3300005336 Unclassified 1078
18 Ga0070680_100789994 3300005336 Unclassified 818
19 Ga0068868_100018643 3300005338 Bacteria 5193
20 Ga0068868_100023331 3300005338 Unclassified 4681
21 Ga0068868_100771077 3300005338 Unclassified 866
22 Ga0068868_100774620 3300005338 Unclassified 864
23 Ga0068868_101288376 3300005338 Bacteria 678
24 Ga0070660_100008288 3300005339 Bacteria 7264
25 Ga0070660_100956126 3300005339 Bacteria 723
26 Ga0070689_100155629 3300005340 Bacteria 1845
27 Ga0070689_100505631 3300005340 Bacteria 1036
28 Ga0070689_100575410 3300005340 Bacteria 973
29 Ga0070689_100773520 3300005340 Bacteria 843
30 Ga0070689_100786052 3300005340 Bacteria 836
31 Ga0070691_10118374 3300005341 Unclassified 1331
32 Ga0070661_100123457 3300005344 Unclassified 1941
33 Ga0070661_100197857 3300005344 Bacteria 1534
34 Ga0070661_100231954 3300005344 Unclassified 1419
35 Ga0070661_100401851 3300005344 Bacteria 1083
36 Ga0070661_100409291 3300005344 Unclassified 1073
37 Ga0070661_100587031 3300005344 Bacteria 900
38 Ga0070692_10215163 3300005345 Bacteria 1133
39 Ga0070675_101291418 3300005354 Bacteria 672
40 Ga0070671_100099394 3300005355 Unclassified 2441
41 Ga0070671_100126574 3300005355 Unclassified 2151
42 Ga0070671_100280752 3300005355 Unclassified 1416
43 Ga0070671_100901345 3300005355 Bacteria 772
44 Ga0070674_100943576 3300005356 Unclassified 754
45 Ga0070673_100601742 3300005364 Bacteria 1003
46 Ga0070673_101709683 3300005364 Bacteria 595
47 Ga0070659_100139029 3300005366 Unclassified 1977
48 Ga0070659_100166462 3300005366 Unclassified 1804
49 Ga0070667_100349338 3300005367 Unclassified 1339
50 Ga0070667_100469659 3300005367 Unclassified 1151
51 Ga0070667_100580878 3300005367 Bacteria 1031
52 Ga0070709_10020709 3300005434 Bacteria 3822
53 Ga0070709_11005761 3300005434 Unclassified 663
54 Ga0070714_100069781 3300005435 Unclassified 3036
55 Ga0070714_100146572 3300005435 Bacteria 2124
56 Ga0070714_100732895 3300005435 Bacteria 955
57 Ga0070713_101540378 3300005436 Unclassified 645
58 Ga0070710_10458279 3300005437 Bacteria 866
59 Ga0070711_100032596 3300005439 Bacteria 3465
60 Ga0070694_100042459 3300005444 Bacteria 3038
61 Ga0070708_100882570 3300005445 Bacteria 840
62 Ga0070663_100080656 3300005455 Unclassified 2390
63 Ga0070663_100476034 3300005455 Bacteria 1033
64 Ga0070663_101882517 3300005455 Bacteria 537
65 Ga0070663_102068931 3300005455 Unclassified 513
66 Ga0070678_100092641 3300005456 Unclassified 2322
67 Ga0070678_101999017 3300005456 Unclassified 548
68 Ga0070662_100025113 3300005457 Unclassified 4111
69 Ga0070662_101618970 3300005457 Unclassified 559
70 Ga0070681_10028097 3300005458 Bacteria 5655
71 Ga0070681_10139831 3300005458 Unclassified 2351
72 Ga0070681_10180010 3300005458 Bacteria 2035
73 Ga0070681_10255979 3300005458 Bacteria 1663
74 Ga0070681_10334353 3300005458 Bacteria 1424
75 Ga0070681_10460474 3300005458 Bacteria 1184
76 Ga0070681_10822276 3300005458 Bacteria 846
77 Ga0068867_100057154 3300005459 Unclassified 2889
78 Ga0068867_100081357 3300005459 Bacteria 2442
79 Ga0068867_101794928 3300005459 Unclassified 577
80 Ga0070685_10734698 3300005466 Bacteria 722
81 Ga0070707_102224400 3300005468 Unclassified 516
82 Ga0070679_100087651 3300005530 Bacteria 3100
83 Ga0070679_102037765 3300005530 Bacteria 523
84 Ga0070684_100014596 3300005535 Bacteria 6369
85 Ga0070684_100173569 3300005535 Unclassified 1958
86 Ga0070684_100517949 3300005535 Unclassified 1105
87 Ga0070684_100739081 3300005535 Bacteria 918
88 Ga0068853_100037198 3300005539 Bacteria 4141
89 Ga0068853_100047771 3300005539 Bacteria 3674
90 Ga0068853_100343677 3300005539 Bacteria 1387
91 Ga0068853_100413171 3300005539 Unclassified 1264
92 Ga0068853_100672288 3300005539 Unclassified 986
93 Ga0070672_100262346 3300005543 Bacteria 1457
94 Ga0070672_100506352 3300005543 Bacteria 1045
95 Ga0070672_101132998 3300005543 Bacteria 696
96 Ga0070686_100212809 3300005544 Bacteria 1392
97 Ga0070695_100016604 3300005545 Bacteria 4459
98 Ga0070696_100497734 3300005546 Unclassified 969
99 Ga0070696_101599923 3300005546 Unclassified 560
100 Ga0070693_100289739 3300005547 Bacteria 1100
101 Ga0070665_100012183 3300005548 Bacteria 8670
102 Ga0070665_100092473 3300005548 Bacteria 3029
103 Ga0070665_100195190 3300005548 Bacteria 2025
104 Ga0070665_100279803 3300005548 Unclassified 1670
105 Ga0070704_100370836 3300005549 Bacteria 1214
106 Ga0070704_101209843 3300005549 Bacteria 689
107 Ga0068855_100010330 3300005563 Bacteria 11257
108 Ga0068855_100049370 3300005563 Bacteria 4963
109 Ga0068855_100115444 3300005563 Unclassified 3078
110 Ga0068855_100211219 3300005563 Bacteria 2181
111 Ga0068855_100213986 3300005563 Bacteria 2164
112 Ga0068855_100568609 3300005563 Bacteria 1225
113 Ga0068855_100605453 3300005563 Bacteria 1181
114 Ga0070664_100042923 3300005564 Bacteria 3816
115 Ga0070664_100155410 3300005564 Unclassified 2021
116 Ga0070664_100242323 3300005564 Bacteria 1619
117 Ga0068857_100001847 3300005577 Bacteria 17049
118 Ga0068857_100058439 3300005577 Unclassified 3424
119 Ga0068857_100065032 3300005577 Unclassified 3242
120 Ga0068857_100499715 3300005577 Unclassified 1141
121 Ga0068857_100670809 3300005577 Unclassified 983
122 Ga0068857_100807219 3300005577 Bacteria 896
123 Ga0068854_100062060 3300005578 Unclassified 2708
124 Ga0068856_100029579 3300005614 Bacteria 5351
125 Ga0068856_100033181 3300005614 Bacteria 5055
126 Ga0068856_100062282 3300005614 Bacteria 3685
127 Ga0068856_100169426 3300005614 Unclassified 2196
128 Ga0068856_100310341 3300005614 Unclassified 1595
129 Ga0068856_100446216 3300005614 Bacteria 1314
130 Ga0068856_101033466 3300005614 Bacteria 840
131 Ga0068856_101452587 3300005614 Bacteria 700
132 Ga0070702_101013441 3300005615 Unclassified 658
133 Ga0068852_100028325 3300005616 Bacteria 4582
134 Ga0068852_100404776 3300005616 Bacteria 1343
135 Ga0068852_101617479 3300005616 Bacteria 670
136 Ga0068859_100046390 3300005617 Bacteria 4364
137 Ga0068859_100130525 3300005617 Bacteria 2584
138 Ga0068859_100240242 3300005617 Unclassified 1900
139 Ga0068859_100284326 3300005617 Bacteria 1747
140 Ga0068859_100285860 3300005617 Bacteria 1742
141 Ga0068859_101281297 3300005617 Bacteria 808
142 Ga0068864_100019910 3300005618 Bacteria 5609
143 Ga0068864_100317252 3300005618 Unclassified 1463
144 Ga0068866_10014578 3300005718 Unclassified 3475
145 Ga0068866_10879860 3300005718 Bacteria 628
146 Ga0068861_100098234 3300005719 Bacteria 2324
147 Ga0068861_101960703 3300005719 Unclassified 583
148 Ga0068863_100009340 3300005841 Bacteria 9571
149 Ga0068863_100066148 3300005841 Bacteria 3419
150 Ga0068863_100137585 3300005841 Bacteria 2333
151 Ga0068863_102355958 3300005841 Unclassified 542
152 Ga0068858_100000755 3300005842 Bacteria 33931
153 Ga0068858_100008800 3300005842 Bacteria 9680
154 Ga0068858_100055115 3300005842 Bacteria 3675
155 Ga0068858_100911467 3300005842 Bacteria 860
156 Ga0068858_100973907 3300005842 Bacteria 831
157 Ga0068860_100001833 3300005843 Bacteria 22649
158 Ga0068860_100021448 3300005843 Bacteria 6254
159 Ga0068860_100047825 3300005843 Unclassified 4077
160 Ga0068860_100542696 3300005843 Bacteria 1164
161 Ga0068860_101757340 3300005843 Bacteria 642
162 Ga0068860_102251113 3300005843 Bacteria 566
163 Ga0081455_10062775 3300005937 Bacteria 3121
164 Ga0070717_10004755 3300006028 Bacteria 9873
165 Ga0070717_10905983 3300006028 Bacteria 803
166 Ga0070716_100454196 3300006173 Unclassified 935
167 Ga0070716_101762491 3300006173 Unclassified 512
168 Ga0070712_100135808 3300006175 Unclassified 1870
169 Ga0097621_100001558 3300006237 Bacteria 15662
170 Ga0097621_100036842 3300006237 Unclassified 3915
171 Ga0097621_100080168 3300006237 Bacteria 2715
172 Ga0097621_100184195 3300006237 Bacteria 1805
173 Ga0097621_100206923 3300006237 Unclassified 1705
174 Ga0097621_100239974 3300006237 Bacteria 1584
175 Ga0097621_100470791 3300006237 Bacteria 1134
176 Ga0068871_100019220 3300006358 Bacteria 5214
177 Ga0068871_100034190 3300006358 Bacteria 4032
178 Ga0068871_100040183 3300006358 Bacteria 3746
179 Ga0068871_100070019 3300006358 Bacteria 2882
180 Ga0068871_100118187 3300006358 Bacteria 2236
181 Ga0068871_100180177 3300006358 Unclassified 1815
182 Ga0068871_100393295 3300006358 Unclassified 1233
183 Ga0068871_101240311 3300006358 Unclassified 700
184 Ga0075428_100355844 3300006844 Unclassified 1571
185 Ga0075430_100019462 3300006846 Bacteria 5773
186 Ga0075430_100039933 3300006846 Bacteria 3972
187 Ga0075431_100144240 3300006847 Unclassified 2454
188 Ga0075431_100317371 3300006847 Bacteria 1572
189 Ga0075429_100155445 3300006880 Unclassified 2003
190 Ga0075429_100369932 3300006880 Bacteria 1255
191 Ga0068865_100030468 3300006881 Unclassified 3589
192 Ga0068865_101370629 3300006881 Bacteria 631
193 Ga0097620_100046390 3300006931 Bacteria 4364
194 Ga0097620_100130522 3300006931 Bacteria 2584
195 Ga0097620_100240225 3300006931 Unclassified 1900
196 Ga0097620_100284327 3300006931 Bacteria 1747
197 Ga0097620_100285852 3300006931 Bacteria 1742
198 Ga0097620_101281309 3300006931 Bacteria 808
199 Ga0099795_10162265 3300007788 Bacteria 923
200 Ga0105240_10002787 3300009093 Bacteria 27631
201 Ga0105240_10090805 3300009093 Bacteria 3732
202 Ga0105240_10499161 3300009093 Bacteria 1353
203 Ga0105240_10619423 3300009093 Bacteria 1190
204 Ga0105240_11016622 3300009093 Unclassified 886
205 Ga0105240_11135487 3300009093 Bacteria 830
206 Ga0105240_11146561 3300009093 Bacteria 825
207 Ga0105240_11688889 3300009093 Bacteria 661
208 Ga0105245_10004913 3300009098 Bacteria 11763
209 Ga0105245_10058904 3300009098 Unclassified 3458
210 Ga0105245_10109467 3300009098 Bacteria 2567
211 Ga0105245_10278380 3300009098 Bacteria 1634
212 Ga0105245_10306157 3300009098 Bacteria 1561
213 Ga0105245_10361442 3300009098 Unclassified 1441
214 Ga0105245_11354416 3300009098 Bacteria 761
215 Ga0105245_11447291 3300009098 Bacteria 737
216 Ga0105247_10275450 3300009101 Bacteria 1159
217 Ga0105243_10188521 3300009148 Bacteria 1799
218 Ga0105243_11395399 3300009148 Unclassified 721
219 Ga0105241_10012575 3300009174 Bacteria 6210
220 Ga0105241_10028194 3300009174 Bacteria 4183
221 Ga0105241_10054670 3300009174 Unclassified 3057
222 Ga0105241_10096179 3300009174 Unclassified 2346
223 Ga0105241_11151255 3300009174 Bacteria 733
224 Ga0105242_10041533 3300009176 Unclassified 3710
225 Ga0105242_10049623 3300009176 Unclassified 3416
226 Ga0105242_10229351 3300009176 Unclassified 1664
227 Ga0105242_10844648 3300009176 Unclassified 911
228 Ga0105242_11322767 3300009176 Bacteria 745
229 Ga0105248_10005725 3300009177 Bacteria 13642
230 Ga0105248_10040530 3300009177 Bacteria 5221
231 Ga0105248_10102838 3300009177 Unclassified 3220
232 Ga0105248_10142004 3300009177 Unclassified 2709
233 Ga0105248_10407494 3300009177 Bacteria 1531
234 Ga0105248_10607861 3300009177 Bacteria 1233
235 Ga0105248_10687180 3300009177 Bacteria 1154
236 Ga0105248_11003796 3300009177 Bacteria 943
237 Ga0105248_11150061 3300009177 Bacteria 877
238 Ga0105237_10004101 3300009545 Bacteria 16988
239 Ga0105237_10162513 3300009545 Unclassified 2232
240 Ga0105237_10188416 3300009545 Bacteria 2063
241 Ga0105237_10426966 3300009545 Unclassified 1331
242 Ga0105237_11026884 3300009545 Bacteria 831
243 Ga0105237_12170977 3300009545 Bacteria 565
244 Ga0105238_10007888 3300009551 Bacteria 10652
245 Ga0105238_10024897 3300009551 Bacteria 6099
246 Ga0105238_10487384 3300009551 Bacteria 1233
247 Ga0105249_10521510 3300009553 Bacteria 1236
248 Ga0105249_12204392 3300009553 Bacteria 624
249 Ga0105239_10034942 3300010375 Bacteria 5520
250 Ga0105239_10085123 3300010375 Bacteria 3484
251 Ga0105239_10266158 3300010375 Bacteria 1927
252 Ga0105239_10405486 3300010375 Unclassified 1543
253 Ga0105239_10801982 3300010375 Bacteria 1079
254 Ga0105239_10921552 3300010375 Unclassified 1003
255 Ga0105246_10102195 3300011119 Bacteria 2089
256 Ga0105246_10169109 3300011119 Bacteria 1672
257 Ga0105246_10344843 3300011119 Bacteria 1218
258 Ga0105246_11048947 3300011119 Unclassified 741
259 Ga0157373_10082321 3300013100 Bacteria 2269
260 Ga0157373_10222800 3300013100 Bacteria 1331
261 Ga0157373_10286718 3300013100 Bacteria 1168
262 Ga0157371_10933366 3300013102 Bacteria 659
263 Ga0157370_10002147 3300013104 Bacteria 24104
264 Ga0157370_10023389 3300013104 Bacteria 6134
265 Ga0157370_10295224 3300013104 Bacteria 1497
266 Ga0157370_10317500 3300013104 Bacteria 1437
267 Ga0157370_10328247 3300013104 Bacteria 1411
268 Ga0157370_10329604 3300013104 Bacteria 1408
269 Ga0157369_10013033 3300013105 Bacteria 9418
270 Ga0157369_10043143 3300013105 Unclassified 4917
271 Ga0157369_10104855 3300013105 Unclassified 3010
272 Ga0157369_10216259 3300013105 Bacteria 2007
273 Ga0157369_10235210 3300013105 Bacteria 1915
274 Ga0157369_10677113 3300013105 Bacteria 1063
275 Ga0157374_10048728 3300013296 Unclassified 3932
276 Ga0157374_10052188 3300013296 Unclassified 3807
277 Ga0157374_10172683 3300013296 Bacteria 2109
278 Ga0157374_11225069 3300013296 Bacteria 772
279 Ga0157374_12543211 3300013296 Unclassified 539
280 Ga0157378_10013083 3300013297 Bacteria 7259
281 Ga0157378_10059883 3300013297 Bacteria 3398
282 Ga0157378_10587194 3300013297 Unclassified 1124
283 Ga0157378_10604789 3300013297 Unclassified 1108
284 Ga0157378_11240793 3300013297 Bacteria 786
285 Ga0163162_10082249 3300013306 Bacteria 3292
286 Ga0163162_10090556 3300013306 Bacteria 3140
287 Ga0163162_10688685 3300013306 Bacteria 1144
288 Ga0163162_11029248 3300013306 Unclassified 932
289 Ga0163162_11946601 3300013306 Unclassified 673
290 Ga0157372_10140298 3300013307 Unclassified 2784
291 Ga0157372_10366688 3300013307 Unclassified 1678
292 Ga0157372_10371822 3300013307 Bacteria 1666
293 Ga0157372_10697203 3300013307 Unclassified 1182
294 Ga0157372_11645972 3300013307 Unclassified 739
295 Ga0157372_11902025 3300013307 Bacteria 684
296 Ga0157375_10342448 3300013308 Unclassified 1660
297 Ga0157375_10490049 3300013308 Bacteria 1394
298 Ga0157375_11081270 3300013308 Unclassified 938
299 Ga0157375_11866060 3300013308 Bacteria 713
300 Ga0163163_10019654 3300014325 Bacteria 6346
301 Ga0163163_10022881 3300014325 Bacteria 5924
302 Ga0163163_10028159 3300014325 Bacteria 5391
303 Ga0163163_11051503 3300014325 Unclassified 877
304 Ga0157380_10258651 3300014326 Bacteria 1580
305 Ga0157380_10336802 3300014326 Bacteria 1405
306 Ga0157379_10011068 3300014968 Bacteria 7863
307 Ga0157379_10049938 3300014968 Bacteria 3734
308 Ga0157379_11318236 3300014968 Bacteria 698
309 Ga0157376_10054769 3300014969 Unclassified 3326
310 Ga0157376_10635313 3300014969 Bacteria 1066
311 Ga0157376_10722186 3300014969 Bacteria 1003
312 Ga0163161_10110939 3300017792 Bacteria 2050
313 Ga0197907_10478193 3300020069 Unclassified 1214
314 Ga0206355_1016973 3300020076 Unclassified 1204
315 Ga0206355_1181757 3300020076 Unclassified 1210
316 Ga0206355_1610152 3300020076 Bacteria 1429
317 Ga0206350_10782737 3300020080 Bacteria 1111
318 Ga0206354_10271648 3300020081 Unclassified 1042
319 Ga0154015_1076892 3300020610 Unclassified 1002
320 Ga0213872_10019520 3300021361 Bacteria 3121
321 Ga0213876_10002108 3300021384 Bacteria 11767
322 Ga0213876_10159913 3300021384 Bacteria 1198
323 Ga0213876_10628131 3300021384 Unclassified 572
324 Ga0213875_10000005 3300021388 Bacteria 595146
325 Ga0213875_10000032 3300021388 Bacteria 172918
326 Ga0213875_10004701 3300021388 Bacteria 7433
327 Ga0213875_10052390 3300021388 Bacteria 1911
328 Ga0213875_10083560 3300021388 Bacteria 1490
329 Ga0213875_10116236 3300021388 Bacteria 1249
330 Ga0213875_10119406 3300021388 Bacteria 1232
331 Ga0213875_10493512 3300021388 Unclassified 588
332 Ga0207682_10266773 3300025893 Bacteria 799
333 Ga0207642_10013851 3300025899 Unclassified 2956
334 Ga0207680_10138723 3300025903 Unclassified 1610
335 Ga0207645_10553628 3300025907 Bacteria 780
336 Ga0207705_10694328 3300025909 Unclassified 791
337 Ga0207654_10023665 3300025911 Unclassified 3293
338 Ga0207654_10053839 3300025911 Bacteria 2324
339 Ga0207654_10157132 3300025911 Bacteria 1465
340 Ga0207654_10838129 3300025911 Bacteria 665
341 Ga0207707_10019197 3300025912 Bacteria 5965
342 Ga0207707_10083251 3300025912 Bacteria 2793
343 Ga0207707_10124928 3300025912 Unclassified 2250
344 Ga0207707_10273765 3300025912 Bacteria 1463
345 Ga0207707_10682426 3300025912 Bacteria 864
346 Ga0207707_11088897 3300025912 Bacteria 652
347 Ga0207695_10028817 3300025913 Bacteria 6147
348 Ga0207695_10053575 3300025913 Unclassified 4219
349 Ga0207695_10075817 3300025913 Bacteria 3421
350 Ga0207695_10099638 3300025913 Bacteria 2903
351 Ga0207695_10179309 3300025913 Unclassified 2040
352 Ga0207695_10758795 3300025913 Bacteria 850
353 Ga0207695_11306626 3300025913 Bacteria 606
354 Ga0207671_10083639 3300025914 Bacteria 2396
355 Ga0207671_10110645 3300025914 Bacteria 2090
356 Ga0207671_10150100 3300025914 Bacteria 1800
357 Ga0207671_10583272 3300025914 Unclassified 891
358 Ga0207693_10377755 3300025915 Bacteria 1108
359 Ga0207663_10034577 3300025916 Bacteria 3024
360 Ga0207663_10713728 3300025916 Unclassified 794
361 Ga0207660_10040808 3300025917 Unclassified 3251
362 Ga0207660_10908621 3300025917 Unclassified 718
363 Ga0207662_10727961 3300025918 Bacteria 696
364 Ga0207657_10002498 3300025919 Bacteria 19885
365 Ga0207657_10784366 3300025919 Bacteria 737
366 Ga0207649_10198100 3300025920 Unclassified 1417
367 Ga0207649_10270259 3300025920 Unclassified 1232
368 Ga0207649_10310410 3300025920 Unclassified 1156
369 Ga0207649_10489663 3300025920 Bacteria 934
370 Ga0207652_10030242 3300025921 Unclassified 4533
371 Ga0207652_10073269 3300025921 Bacteria 2979
372 Ga0207652_10118993 3300025921 Bacteria 2349
373 Ga0207652_10205254 3300025921 Bacteria 1774
374 Ga0207694_10002164 3300025924 Bacteria 16156
375 Ga0207694_10028823 3300025924 Unclassified 4234
376 Ga0207694_10195055 3300025924 Unclassified 1646
377 Ga0207694_10407300 3300025924 Bacteria 1131
378 Ga0207659_11762725 3300025926 Bacteria 526
379 Ga0207687_10003031 3300025927 Bacteria 11386
380 Ga0207687_10010241 3300025927 Bacteria 6125
381 Ga0207687_10038732 3300025927 Bacteria 3259
382 Ga0207687_10075778 3300025927 Bacteria 2415
383 Ga0207687_10210522 3300025927 Bacteria 1525
384 Ga0207700_10051542 3300025928 Bacteria 3072
385 Ga0207700_10483900 3300025928 Bacteria 1094
386 Ga0207700_10722293 3300025928 Unclassified 890
387 Ga0207700_11971657 3300025928 Unclassified 510
388 Ga0207664_10586411 3300025929 Bacteria 1001
389 Ga0207664_10834828 3300025929 Unclassified 828
390 Ga0207644_10383002 3300025931 Unclassified 1147
391 Ga0207644_10530635 3300025931 Bacteria 973
392 Ga0207690_10017593 3300025932 Bacteria 4369
393 Ga0207690_10069287 3300025932 Bacteria 2427
394 Ga0207706_10040860 3300025933 Unclassified 4111
395 Ga0207706_10142484 3300025933 Bacteria 2108
396 Ga0207686_10005602 3300025934 Bacteria 6732
397 Ga0207686_10080074 3300025934 Unclassified 2129
398 Ga0207686_10160931 3300025934 Unclassified 1573
399 Ga0207686_10227632 3300025934 Unclassified 1350
400 Ga0207686_10362700 3300025934 Unclassified 1094
401 Ga0207686_10439724 3300025934 Unclassified 1001
402 Ga0207670_10602090 3300025936 Bacteria 902
403 Ga0207670_10663442 3300025936 Bacteria 861
404 Ga0207669_11236223 3300025937 Unclassified 633
405 Ga0207704_10019841 3300025938 Unclassified 3542
406 Ga0207665_10956034 3300025939 Bacteria 681
407 Ga0207691_10465359 3300025940 Bacteria 1075
408 Ga0207711_10003764 3300025941 Bacteria 13059
409 Ga0207711_10006942 3300025941 Bacteria 9504
410 Ga0207711_10073098 3300025941 Unclassified 2980
411 Ga0207711_10328734 3300025941 Bacteria 1414
412 Ga0207711_10414139 3300025941 Bacteria 1253
413 Ga0207711_10644232 3300025941 Unclassified 988
414 Ga0207711_10784266 3300025941 Bacteria 888
415 Ga0207711_11800448 3300025941 Unclassified 555
416 Ga0207689_10048271 3300025942 Bacteria 3511
417 Ga0207689_10270410 3300025942 Bacteria 1407
418 Ga0207689_11518930 3300025942 Bacteria 559
419 Ga0207661_10141149 3300025944 Unclassified 2073
420 Ga0207661_10703845 3300025944 Bacteria 929
421 Ga0207661_11132106 3300025944 Unclassified 720
422 Ga0207661_11617812 3300025944 Bacteria 592
423 Ga0207679_10033266 3300025945 Bacteria 3627
424 Ga0207679_10055482 3300025945 Unclassified 2921
425 Ga0207679_10205424 3300025945 Unclassified 1648
426 Ga0207679_10893046 3300025945 Bacteria 813
427 Ga0207667_10009718 3300025949 Bacteria 11309
428 Ga0207667_10019381 3300025949 Bacteria 7596
429 Ga0207667_10088668 3300025949 Unclassified 3198
430 Ga0207667_10093738 3300025949 Unclassified 3101
431 Ga0207667_10740614 3300025949 Bacteria 983
432 Ga0207712_10853714 3300025961 Bacteria 803
433 Ga0207640_10091314 3300025981 Unclassified 2109
434 Ga0207640_10723355 3300025981 Bacteria 856
435 Ga0207658_10125245 3300025986 Bacteria 2055
436 Ga0207658_10765694 3300025986 Bacteria 875
437 Ga0207658_10821324 3300025986 Unclassified 844
438 Ga0207677_10017429 3300026023 Unclassified 4282
439 Ga0207677_10166802 3300026023 Unclassified 1717
440 Ga0207677_10405488 3300026023 Unclassified 1157
441 Ga0207677_10529900 3300026023 Unclassified 1023
442 Ga0207677_11058774 3300026023 Bacteria 738
443 Ga0207677_11736116 3300026023 Unclassified 579
444 Ga0207703_10010386 3300026035 Bacteria 7283
445 Ga0207703_10018464 3300026035 Bacteria 5446
446 Ga0207703_10061783 3300026035 Bacteria 3068
447 Ga0207703_10208527 3300026035 Unclassified 1741
448 Ga0207703_10213558 3300026035 Unclassified 1721
449 Ga0207703_11137370 3300026035 Bacteria 750
450 Ga0207639_10017212 3300026041 Bacteria 5124
451 Ga0207639_10227214 3300026041 Unclassified 1615
452 Ga0207639_10246617 3300026041 Bacteria 1556
453 Ga0207639_10971520 3300026041 Unclassified 795
454 Ga0207678_10015939 3300026067 Bacteria 6600
455 Ga0207678_10234034 3300026067 Bacteria 1573
456 Ga0207678_10429065 3300026067 Bacteria 1147
457 Ga0207708_10219495 3300026075 Bacteria 1523
458 Ga0207708_11181892 3300026075 Bacteria 668
459 Ga0207702_10011018 3300026078 Bacteria 7544
460 Ga0207702_10096877 3300026078 Bacteria 2595
461 Ga0207702_10301747 3300026078 Unclassified 1520
462 Ga0207702_10324265 3300026078 Unclassified 1467
463 Ga0207702_10362220 3300026078 Bacteria 1390
464 Ga0207702_10522921 3300026078 Bacteria 1158
465 Ga0207702_11375678 3300026078 Bacteria 700
466 Ga0207702_12004937 3300026078 Bacteria 569
467 Ga0207641_10040482 3300026088 Bacteria 3903
468 Ga0207641_10837064 3300026088 Bacteria 911
469 Ga0207641_11376057 3300026088 Bacteria 707
470 Ga0207648_10023853 3300026089 Bacteria 5471
471 Ga0207648_10143823 3300026089 Unclassified 2103
472 Ga0207648_10917814 3300026089 Unclassified 818
473 Ga0207676_10005545 3300026095 Bacteria 8930
474 Ga0207674_10020184 3300026116 Bacteria 7205
475 Ga0207674_10024159 3300026116 Bacteria 6498
476 Ga0207674_10103476 3300026116 Bacteria 2826
477 Ga0207674_10225552 3300026116 Bacteria 1822
478 Ga0207674_10822491 3300026116 Bacteria 896
479 Ga0207674_10987657 3300026116 Unclassified 811
480 Ga0207675_100473752 3300026118 Bacteria 1243
481 Ga0207683_10033921 3300026121 Unclassified 4435
482 Ga0207698_10076766 3300026142 Bacteria 2675
483 Ga0207698_10168201 3300026142 Unclassified 1927
484 Ga0207698_10307540 3300026142 Bacteria 1478
485 Ga0207698_10930288 3300026142 Bacteria 878
486 Ga0207698_11070582 3300026142 Unclassified 818
487 Ga0207698_11616383 3300026142 Bacteria 663
488 Ga0268266_10014693 3300028379 Bacteria 6726
489 Ga0268266_10178037 3300028379 Bacteria 1934
490 Ga0268266_10231470 3300028379 Bacteria 1702
491 Ga0268266_10791949 3300028379 Bacteria 915
492 Ga0268264_10008523 3300028381 Bacteria 8521
493 Ga0268264_10239051 3300028381 Bacteria 1681
494 Ga0265338_10048468 3300028800 Bacteria 3864
495 Ga0265338_10238385 3300028800 Bacteria 1349
496 Ga0265338_10428257 3300028800 Unclassified 939
497 Ga0265760_10097150 3300031090 Bacteria 928
498 Ga0265329_10305119 3300031242 Bacteria 539
499 Ga0265339_10304183 3300031249 Unclassified 760
500 Ga0265316_10143128 3300031344 Bacteria 1795
501 Ga0265314_10041508 3300031711 Bacteria 3292
502 Ga0265342_10305998 3300031712 Unclassified 836
503 Ga0373926_0098381 3300035083 Bacteria 1092
504 Ga0373926_0130013 3300035083 Bacteria 953
505 Ga0373944_0103158 3300035089 Bacteria 966
506 Ga0373936_0047851 3300035113 Unclassified 1726
507 Ga0373941_0295819 3300035115 Bacteria 645
508 Ga0373945_0047705 3300035116 Bacteria 1567
509 Ga0373945_0345719 3300035116 Bacteria 644
510 Ga0373953_0291206 3300035117 Unclassified 712
511 Ga0373946_0191892 3300035171 Bacteria 974
512 Ga0373955_0601032 3300035172 Bacteria 674
513 Ga0373961_0086987 3300035241 Bacteria 992
514 Ga0373931_0163320 3300035691 Bacteria 1307
515 Ga0373931_0491434 3300035691 Bacteria 790
516 Ga0373931_1292139 3300035691 Unclassified 502
517 Ga0373935_0012503 3300035692 Bacteria 5105
518 Ga0373935_0643690 3300035692 Bacteria 777
519 Ga0373935_1476696 3300035692 Unclassified 509
520 Ga0373927_0009950 3300035695 Bacteria 6372
521 Ga0373927_0057982 3300035695 Unclassified 2504
522 Ga0373933_0243962 3300035724 Unclassified 1156
523 Ga0373933_0343558 3300035724 Bacteria 969
524 Ga0373947_0019057 3300035725 Bacteria 3954
525 Ga0373947_0057530 3300035725 Unclassified 2353
526 Ga0373937_0138085 3300036401 Bacteria 2280
527 Ga0373937_0301627 3300036401 Bacteria 1514
528 Ga0373937_1096293 3300036401 Bacteria 745
529 Ga0373925_0000401 3300037068 Bacteria 44253
530 Ga0373925_0174285 3300037068 Bacteria 1699
531 Ga0373925_0200879 3300037068 Bacteria 1585
532 Ga0373925_0338538 3300037068 Bacteria 1220
533 Ga0395900_0191212 3300037418 Unclassified 2076
534 Ga0395898_0106005 3300037466 Bacteria 2696
535 Ga0436364_0010332 3300037853 Unclassified 1237
536 Ga0436364_0031051 3300037853 Unclassified 2775
537 Ga0436364_0132953 3300037853 Bacteria 5490
538 Ga0436364_0157811 3300037853 Bacteria 430293
539 Ga0436364_0202263 3300037853 Bacteria 63132
540 Ga0436364_0282990 3300037853 Unclassified 658
541 Ga0436364_0457930 3300037853 Bacteria 8284
542 Ga0436364_0483108 3300037853 Unclassified 1978
543 Ga0436364_0520948 3300037853 Bacteria 5148
544 Ga0436364_0647542 3300037853 Bacteria 2209
545 Ga0436364_0715739 3300037853 Bacteria 8187
546 Ga0436364_0833005 3300037853 Bacteria 8565
547 Ga0436364_1074294 3300037853 Bacteria 1178
548 Ga0436364_1108687 3300037853 Bacteria 3734
549 Ga0436364_1294932 3300037853 Bacteria 3877
550 Ga0436364_1299641 3300037853 Bacteria 554
551 Ga0436364_1369623 3300037853 Bacteria 9686
552 Ga0436364_1443683 3300037853 Unclassified 514
553 Ga0436364_1500628 3300037853 Unclassified 2562
554 Ga0436364_1561923 3300037853 Bacteria 827
555 Ga0436365_0068008 3300039437 Bacteria 17073
556 Ga0436365_0205552 3300039437 Bacteria 2276
557 Ga0436365_0279355 3300039437 Bacteria 853
558 Ga0436365_0693032 3300039437 Bacteria 3674
559 Ga0436365_0837841 3300039437 Bacteria 1465
560 Ga0436365_0892357 3300039437 Bacteria 6885
561 Ga0436365_1336592 3300039437 Bacteria 1073
562 Ga0436360_1116020 3300039438 Unclassified 1071
563 Ga0436361_0377638 3300039447 Bacteria 39633
564 Ga0436363_0094956 3300039450 Bacteria 1708
565 Ga0436363_0612539 3300039450 Bacteria 1036
566 Ga0436363_1512130 3300039450 Bacteria 3856
567 Ga0436362_0280648 3300039453 Bacteria 1059
568 Ga0436362_0647631 3300039453 Unclassified 1581
569 Ga0436362_1121200 3300039453 Unclassified 526
570 Ga0451577_0208311 3300042876 Bacteria 1766
571 Ga0466963_0120787 3300044694 Bacteria 1803
572 Ga0466963_0512189 3300044694 Unclassified 847
573 Ga0466959_1089089 3300045049 Bacteria 531
574 Ga0451576_0309752 3300045051 Bacteria 1652
575 Ga0466958_0080423 3300045836 Bacteria 2005
576 Ga0495629_0000002 3300046459 Bacteria 686975
577 Ga0495629_0471025 3300046459 Bacteria 849
578 Ga0495580_0045958 3300046472 Bacteria 3100
579 Ga0495580_0102942 3300046472 Bacteria 1985
580 Ga0495580_0115221 3300046472 Unclassified 1867
581 Ga0495580_0292998 3300046472 Bacteria 1109
582 Ga0495580_0379179 3300046472 Bacteria 955
583 Ga0495580_0894996 3300046472 Bacteria 571
584 Ga0495582_0024647 3300046473 Bacteria 3292
585 Ga0495582_0125144 3300046473 Bacteria 1450
586 Ga0495582_0479886 3300046473 Bacteria 718
587 Ga0495639_0000783 3300046475 Bacteria 14476
588 Ga0495639_0175534 3300046475 Bacteria 1041
589 Ga0495594_0061097 3300046499 Bacteria 2085
590 Ga0495618_0164506 3300046514 Bacteria 1413
591 Ga0495628_0604900 3300046516 Unclassified 783
592 Ga0495630_0956005 3300046517 Bacteria 652
593 Ga0495630_1262684 3300046517 Bacteria 557
594 Ga0495666_0000292 3300046526 Bacteria 21920
595 Ga0495666_0102408 3300046526 Unclassified 1349
596 Ga0495665_0090028 3300046531 Bacteria 1612
597 Ga0495665_0282441 3300046531 Bacteria 851
598 Ga0495586_0001764 3300046535 Bacteria 11827
599 Ga0495586_0130578 3300046535 Bacteria 1406
600 Ga0495586_0207613 3300046535 Unclassified 1111
601 Ga0495586_0432905 3300046535 Bacteria 758
602 Ga0495586_0439914 3300046535 Bacteria 751
603 Ga0495645_0370944 3300046543 Unclassified 918
604 Ga0495622_0049059 3300046557 Bacteria 1960
605 Ga0495635_0000082 3300046663 Bacteria 58319
606 Ga0495599_0540955 3300046678 Bacteria 683
607 Ga0495647_0024372 3300046681 Bacteria 2202
608 Ga0495658_0020610 3300046683 Bacteria 3463
609 Ga0495658_0124981 3300046683 Bacteria 1560
610 Ga0495613_0390737 3300046689 Bacteria 950
611 Ga0495600_0024148 3300046809 Bacteria 3912
612 Ga0495581_0002055 3300047315 Bacteria 11326
613 Ga0495674_0137270 3300047319 Bacteria 2057
614 Ga0495674_0341773 3300047319 Bacteria 1216
615 Ga0495676_0025057 3300047321 Bacteria 5154
616 Ga0495680_0000053 3300047322 Bacteria 94237
617 Ga0495680_0181699 3300047322 Bacteria 1518
618 Ga0495684_0185026 3300047471 Unclassified 1543
619 Ga0495684_0445081 3300047471 Bacteria 901
620 Ga0495684_0600517 3300047471 Bacteria 743
621 Ga0495602_0499955 3300048088 Bacteria 850
622 Ga0496102_0909161 3300048905 Bacteria 802
623 Ga0496105_0199801 3300048908 Bacteria 1632
624 Ga0496106_1128089 3300048909 Bacteria 614
625 Ga0496107_0547493 3300048910 Unclassified 857
626 Ga0496109_1284206 3300048912 Bacteria 668
627 Ga0496112_0353425 3300048915 Unclassified 1412
628 Ga0496112_0468036 3300048915 Bacteria 1198
629 Ga0496114_1313702 3300048917 Bacteria 610
630 Ga0496115_0098693 3300048918 Unclassified 2392
631 Ga0501032_0358148 3300049569 Unclassified 939
632 Ga0501034_0083100 3300049571 Unclassified 3204
633 Ga0501034_0609268 3300049571 Unclassified 997
634 Ga0501037_0056145 3300049573 Unclassified 2877
635 Ga0501037_0169131 3300049573 Bacteria 1555
636 Ga0501038_0243224 3300049574 Unclassified 1428
637 Ga0501043_0170832 3300049579 Unclassified 1696
638 Ga0501046_0287212 3300049580 Bacteria 1204
639 Ga0501047_0063330 3300049581 Bacteria 3567
640 Ga0501047_0086128 3300049581 Bacteria 3019
641 Ga0501048_0097911 3300049582 Unclassified 2070
642 Ga0501069_0206694 3300049585 Unclassified 1139
643 Ga0501070_0084428 3300049586 Unclassified 2629
644 Ga0501073_0327214 3300049589 Unclassified 1058
645 Ga0501074_0252918 3300049590 Unclassified 1253
646 Ga0501035_0002323 3300049822 Bacteria 18745
647 Ga0501044_0001094 3300049823 Bacteria 32272
648 Ga0501044_0001731 3300049823 Bacteria 25525
649 Ga0501044_0961468 3300049823 Bacteria 727
650 Ga0501045_0253202 3300049824 Bacteria 1311
651 nmdc:mga09592_259501_c1 3300050508 Unclassified 1507
652 nmdc:mga0qj67_29596_c1 3300050509 Bacteria 4254
653 nmdc:mga0qj67_50798_c1 3300050509 Bacteria 3279
654 nmdc:mga06r32_213454_c1 3300050510 Unclassified 1918
655 nmdc:mga06r32_310712_c1 3300050510 Bacteria 1562
656 nmdc:mga08x19_614515_c1 3300050514 Unclassified 770
657 Ga0495601_0100599 3300053077 Bacteria 1867
658 Ga0587128_052210 3300059630 Bacteria 749
659 Ga0587067_046716 3300059640 Bacteria 862
660 Ga0587079_199730 3300059647 Bacteria 545
661 Ga0587114_044098 3300059655 Bacteria 733
662 Ga0501082_0419864 3300060353 Unclassified 1168
663 Ga0466962_0406631 3300061719 Bacteria 682

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10531955 Ga0070658_105319553 116
2 3300005339 Ga0070660_100008288 Ga0070660_1000082886 116
3 3300005435 Ga0070714_100732895 Ga0070714_1007328952 116
4 3300009093 Ga0105240_11135487 Ga0105240_111354871 116
5 3300009093 Ga0105240_11146561 Ga0105240_111465612 116
6 3300013104 Ga0157370_10317500 Ga0157370_103175004 116
7 3300013105 Ga0157369_10043143 Ga0157369_100431436 116
8 3300013307 Ga0157372_10371822 Ga0157372_103718222 116
9 3300005334 Ga0068869_101398968 Ga0068869_1013989681 117
10 3300005335 Ga0070666_11302483 Ga0070666_113024831 117
11 3300005338 Ga0068868_101288376 Ga0068868_1012883761 117
12 3300005340 Ga0070689_100786052 Ga0070689_1007860522 117
13 3300005543 Ga0070672_101132998 Ga0070672_1011329982 117
14 3300005618 Ga0068864_100317252 Ga0068864_1003172524 117
15 3300007788 Ga0099795_10162265 Ga0099795_101622653 117
16 3300009098 Ga0105245_10361442 Ga0105245_103614422 117
17 3300009177 Ga0105248_10142004 Ga0105248_101420042 117
18 3300009177 Ga0105248_10407494 Ga0105248_104074944 117
19 3300009177 Ga0105248_11003796 Ga0105248_110037962 117
20 3300013306 Ga0163162_10688685 Ga0163162_106886851 117
21 3300025941 Ga0207711_10784266 Ga0207711_107842662 117
22 3300025942 Ga0207689_11518930 Ga0207689_115189302 117
23 3300026023 Ga0207677_11058774 Ga0207677_110587741 117
24 3300026035 Ga0207703_11137370 Ga0207703_111373702 117
25 3300042876 Ga0451577_0208311 Ga0451577_0208311_760_1116 117
26 3300046472 Ga0495580_0894996 Ga0495580_0894996_201_557 117
27 3300046517 Ga0495630_0956005 Ga0495630_0956005_78_437 117
28 3300046535 Ga0495586_0432905 Ga0495586_0432905_158_517 117
29 3300048909 Ga0496106_1128089 Ga0496106_1128089_125_481 117
30 3300048910 Ga0496107_0547493 Ga0496107_0547493_159_512 117
31 3300048912 Ga0496109_1284206 Ga0496109_1284206_255_611 117
32 3300048917 Ga0496114_1313702 Ga0496114_1313702_212_568 117
33 3300005340 Ga0070689_100155629 Ga0070689_1001556293 118
34 3300005354 Ga0070675_101291418 Ga0070675_1012914182 118
35 3300005444 Ga0070694_100042459 Ga0070694_1000424594 118
36 3300005459 Ga0068867_100057154 Ga0068867_1000571545 118
37 3300005466 Ga0070685_10734698 Ga0070685_107346982 118
38 3300005543 Ga0070672_100262346 Ga0070672_1002623462 118
39 3300005545 Ga0070695_100016604 Ga0070695_1000166043 118
40 3300005615 Ga0070702_101013441 Ga0070702_1010134411 118
41 3300005617 Ga0068859_100285860 Ga0068859_1002858603 118
42 3300005719 Ga0068861_100098234 Ga0068861_1000982344 118
43 3300005843 Ga0068860_100047825 Ga0068860_1000478253 118
44 3300006237 Ga0097621_100239974 Ga0097621_1002399741 118
45 3300006358 Ga0068871_100040183 Ga0068871_1000401836 118
46 3300006846 Ga0075430_100019462 Ga0075430_1000194623 118
47 3300006847 Ga0075431_100317371 Ga0075431_1003173713 118
48 3300006880 Ga0075429_100369932 Ga0075429_1003699323 118
49 3300006931 Ga0097620_100285852 Ga0097620_1002858523 118
50 3300009098 Ga0105245_11447291 Ga0105245_114472912 118
51 3300009176 Ga0105242_10049623 Ga0105242_100496237 118
52 3300011119 Ga0105246_10169109 Ga0105246_101691093 118
53 3300014326 Ga0157380_10258651 Ga0157380_102586513 118
54 3300017792 Ga0163161_10110939 Ga0163161_101109393 118
55 3300025926 Ga0207659_11762725 Ga0207659_117627252 118
56 3300025934 Ga0207686_10080074 Ga0207686_100800741 118
57 3300026088 Ga0207641_11376057 Ga0207641_113760572 118
58 3300028381 Ga0268264_10239051 Ga0268264_102390513 118
59 3300031344 Ga0265316_10143128 Ga0265316_101431282 118
60 3300035083 Ga0373926_0130013 Ga0373926_0130013_506_865 118
61 3300035116 Ga0373945_0047705 Ga0373945_0047705_573_932 118
62 3300035171 Ga0373946_0191892 Ga0373946_0191892_314_673 118
63 3300035725 Ga0373947_0019057 Ga0373947_0019057_369_728 118
64 3300036401 Ga0373937_0138085 Ga0373937_0138085_776_1135 118
65 3300037068 Ga0373925_0000401 Ga0373925_0000401_19298_19657 118
66 3300037068 Ga0373925_0338538 Ga0373925_0338538_777_1136 118
67 3300046459 Ga0495629_0000002 Ga0495629_0000002_231387_231746 118
68 3300046472 Ga0495580_0379179 Ga0495580_0379179_87_446 118
69 3300046473 Ga0495582_0125144 Ga0495582_0125144_20_379 118
70 3300046475 Ga0495639_0000783 Ga0495639_0000783_6202_6561 118
71 3300046499 Ga0495594_0061097 Ga0495594_0061097_1650_2009 118
72 3300046514 Ga0495618_0164506 Ga0495618_0164506_370_729 118
73 3300046517 Ga0495630_1262684 Ga0495630_1262684_29_388 118
74 3300046526 Ga0495666_0000292 Ga0495666_0000292_14974_15333 118
75 3300046531 Ga0495665_0090028 Ga0495665_0090028_1034_1393 118
76 3300046535 Ga0495586_0001764 Ga0495586_0001764_4643_5002 118
77 3300046535 Ga0495586_0439914 Ga0495586_0439914_141_500 118
78 3300046557 Ga0495622_0049059 Ga0495622_0049059_917_1276 118
79 3300046663 Ga0495635_0000082 Ga0495635_0000082_37816_38175 118
80 3300046681 Ga0495647_0024372 Ga0495647_0024372_1822_2181 118
81 3300046683 Ga0495658_0020610 Ga0495658_0020610_1377_1736 118
82 3300046689 Ga0495613_0390737 Ga0495613_0390737_33_392 118
83 3300046809 Ga0495600_0024148 Ga0495600_0024148_321_680 118
84 3300047315 Ga0495581_0002055 Ga0495581_0002055_6074_6433 118
85 3300047321 Ga0495676_0025057 Ga0495676_0025057_859_1218 118
86 3300047322 Ga0495680_0000053 Ga0495680_0000053_12184_12543 118
87 3300047471 Ga0495684_0445081 Ga0495684_0445081_150_509 118
88 3300050509 nmdc:mga0qj67_50798_c1 nmdc:mga0qj67_50798_c1_2781_3140 118
89 3300050510 nmdc:mga06r32_310712_c1 nmdc:mga06r32_310712_c1_609_968 118
90 3300005328 Ga0070676_10192556 Ga0070676_101925561 119
91 3300005329 Ga0070683_100295948 Ga0070683_1002959482 119
92 3300005338 Ga0068868_100771077 Ga0068868_1007710771 119
93 3300005340 Ga0070689_100505631 Ga0070689_1005056311 119
94 3300005340 Ga0070689_100773520 Ga0070689_1007735201 119
95 3300005341 Ga0070691_10118374 Ga0070691_101183743 119
96 3300005344 Ga0070661_100231954 Ga0070661_1002319543 119
97 3300005355 Ga0070671_100126574 Ga0070671_1001265742 119
98 3300005364 Ga0070673_100601742 Ga0070673_1006017422 119
99 3300005366 Ga0070659_100139029 Ga0070659_1001390293 119
100 3300005367 Ga0070667_100469659 Ga0070667_1004696591 119
101 3300005445 Ga0070708_100882570 Ga0070708_1008825702 119
102 3300005455 Ga0070663_101882517 Ga0070663_1018825171 119
103 3300005457 Ga0070662_100025113 Ga0070662_1000251132 119
104 3300005458 Ga0070681_10460474 Ga0070681_104604743 119
105 3300005535 Ga0070684_100173569 Ga0070684_1001735693 119
106 3300005539 Ga0068853_100672288 Ga0068853_1006722882 119
107 3300005543 Ga0070672_100506352 Ga0070672_1005063522 119
108 3300005544 Ga0070686_100212809 Ga0070686_1002128092 119
109 3300005546 Ga0070696_100497734 Ga0070696_1004977341 119
110 3300005549 Ga0070704_101209843 Ga0070704_1012098432 119
111 3300005563 Ga0068855_100049370 Ga0068855_1000493704 119
112 3300005564 Ga0070664_100042923 Ga0070664_1000429234 119
113 3300005577 Ga0068857_100065032 Ga0068857_1000650321 119
114 3300005578 Ga0068854_100062060 Ga0068854_1000620604 119
115 3300005614 Ga0068856_100169426 Ga0068856_1001694263 119
116 3300005617 Ga0068859_100130525 Ga0068859_1001305253 119
117 3300005617 Ga0068859_101281297 Ga0068859_1012812972 119
118 3300005718 Ga0068866_10879860 Ga0068866_108798601 119
119 3300005841 Ga0068863_100137585 Ga0068863_1001375855 119
120 3300005842 Ga0068858_100055115 Ga0068858_1000551153 119
121 3300005842 Ga0068858_100911467 Ga0068858_1009114672 119
122 3300005843 Ga0068860_100021448 Ga0068860_1000214484 119
123 3300005843 Ga0068860_100542696 Ga0068860_1005426962 119
124 3300006173 Ga0070716_101762491 Ga0070716_1017624911 119
125 3300006237 Ga0097621_100080168 Ga0097621_1000801683 119
126 3300006237 Ga0097621_100206923 Ga0097621_1002069232 119
127 3300006358 Ga0068871_100118187 Ga0068871_1001181873 119
128 3300006844 Ga0075428_100355844 Ga0075428_1003558442 119
129 3300006846 Ga0075430_100039933 Ga0075430_1000399334 119
130 3300006847 Ga0075431_100144240 Ga0075431_1001442404 119
131 3300006880 Ga0075429_100155445 Ga0075429_1001554452 119
132 3300006881 Ga0068865_101370629 Ga0068865_1013706292 119
133 3300006931 Ga0097620_100130522 Ga0097620_1001305223 119
134 3300006931 Ga0097620_101281309 Ga0097620_1012813092 119
135 3300009093 Ga0105240_10499161 Ga0105240_104991613 119
136 3300009093 Ga0105240_11688889 Ga0105240_116888892 119
137 3300009098 Ga0105245_10058904 Ga0105245_100589047 119
138 3300009098 Ga0105245_10306157 Ga0105245_103061573 119
139 3300009148 Ga0105243_10188521 Ga0105243_101885211 119
140 3300009174 Ga0105241_10096179 Ga0105241_100961793 119
141 3300009174 Ga0105241_11151255 Ga0105241_111512551 119
142 3300009176 Ga0105242_11322767 Ga0105242_113227672 119
143 3300009177 Ga0105248_10040530 Ga0105248_100405305 119
144 3300009545 Ga0105237_10426966 Ga0105237_104269663 119
145 3300009551 Ga0105238_10007888 Ga0105238_100078882 119
146 3300010375 Ga0105239_10085123 Ga0105239_100851232 119
147 3300011119 Ga0105246_10102195 Ga0105246_101021951 119
148 3300013102 Ga0157371_10933366 Ga0157371_109333662 119
149 3300013296 Ga0157374_10172683 Ga0157374_101726832 119
150 3300013296 Ga0157374_11225069 Ga0157374_112250691 119
151 3300013297 Ga0157378_10013083 Ga0157378_100130834 119
152 3300013306 Ga0163162_11946601 Ga0163162_119466011 119
153 3300013307 Ga0157372_10366688 Ga0157372_103666884 119
154 3300013308 Ga0157375_11866060 Ga0157375_118660601 119
155 3300014325 Ga0163163_11051503 Ga0163163_110515033 119
156 3300014969 Ga0157376_10722186 Ga0157376_107221863 119
157 3300025893 Ga0207682_10266773 Ga0207682_102667733 119
158 3300025907 Ga0207645_10553628 Ga0207645_105536282 119
159 3300025911 Ga0207654_10023665 Ga0207654_100236653 119
160 3300025913 Ga0207695_10075817 Ga0207695_100758173 119
161 3300025918 Ga0207662_10727961 Ga0207662_107279612 119
162 3300025924 Ga0207694_10195055 Ga0207694_101950553 119
163 3300025927 Ga0207687_10003031 Ga0207687_100030314 119
164 3300025927 Ga0207687_10210522 Ga0207687_102105223 119
165 3300025928 Ga0207700_10051542 Ga0207700_100515424 119
166 3300025929 Ga0207664_10586411 Ga0207664_105864113 119
167 3300025931 Ga0207644_10530635 Ga0207644_105306353 119
168 3300025932 Ga0207690_10069287 Ga0207690_100692872 119
169 3300025933 Ga0207706_10040860 Ga0207706_100408602 119
170 3300025934 Ga0207686_10160931 Ga0207686_101609313 119
171 3300025936 Ga0207670_10602090 Ga0207670_106020903 119
172 3300025936 Ga0207670_10663442 Ga0207670_106634422 119
173 3300025940 Ga0207691_10465359 Ga0207691_104653593 119
174 3300025941 Ga0207711_10073098 Ga0207711_100730983 119
175 3300025941 Ga0207711_10328734 Ga0207711_103287343 119
176 3300025942 Ga0207689_10048271 Ga0207689_100482715 119
177 3300025944 Ga0207661_10141149 Ga0207661_101411493 119
178 3300025944 Ga0207661_11617812 Ga0207661_116178121 119
179 3300025945 Ga0207679_10205424 Ga0207679_102054242 119
180 3300025949 Ga0207667_10088668 Ga0207667_100886682 119
181 3300025949 Ga0207667_10740614 Ga0207667_107406141 119
182 3300025981 Ga0207640_10091314 Ga0207640_100913143 119
183 3300025986 Ga0207658_10765694 Ga0207658_107656943 119
184 3300026023 Ga0207677_10529900 Ga0207677_105299003 119
185 3300026035 Ga0207703_10061783 Ga0207703_100617834 119
186 3300026035 Ga0207703_10213558 Ga0207703_102135581 119
187 3300026041 Ga0207639_10227214 Ga0207639_102272143 119
188 3300026075 Ga0207708_11181892 Ga0207708_111818921 119
189 3300026078 Ga0207702_10301747 Ga0207702_103017473 119
190 3300026078 Ga0207702_10362220 Ga0207702_103622201 119
191 3300026088 Ga0207641_10040482 Ga0207641_100404827 119
192 3300026089 Ga0207648_10143823 Ga0207648_101438233 119
193 3300026116 Ga0207674_10024159 Ga0207674_100241594 119
194 3300026118 Ga0207675_100473752 Ga0207675_1004737523 119
195 3300026121 Ga0207683_10033921 Ga0207683_100339213 119
196 3300026142 Ga0207698_10168201 Ga0207698_101682013 119
197 3300028800 Ga0265338_10238385 Ga0265338_102383851 119
198 3300035089 Ga0373944_0103158 Ga0373944_0103158_302_664 119
199 3300035115 Ga0373941_0295819 Ga0373941_0295819_214_576 119
200 3300035117 Ga0373953_0291206 Ga0373953_0291206_260_622 119
201 3300035724 Ga0373933_0243962 Ga0373933_0243962_365_727 119
202 3300035724 Ga0373933_0343558 Ga0373933_0343558_120_482 119
203 3300045051 Ga0451576_0309752 Ga0451576_0309752_237_602 119
204 3300046459 Ga0495629_0471025 Ga0495629_0471025_451_813 119
205 3300046473 Ga0495582_0024647 Ga0495582_0024647_2009_2371 119
206 3300046475 Ga0495639_0175534 Ga0495639_0175534_527_889 119
207 3300046531 Ga0495665_0282441 Ga0495665_0282441_239_601 119
208 3300046535 Ga0495586_0130578 Ga0495586_0130578_744_1106 119
209 3300046535 Ga0495586_0207613 Ga0495586_0207613_640_1002 119
210 3300046543 Ga0495645_0370944 Ga0495645_0370944_271_633 119
211 3300046683 Ga0495658_0124981 Ga0495658_0124981_363_725 119
212 3300047319 Ga0495674_0137270 Ga0495674_0137270_1056_1418 119
213 3300047471 Ga0495684_0185026 Ga0495684_0185026_734_1096 119
214 3300048905 Ga0496102_0909161 Ga0496102_0909161_58_420 119
215 3300048915 Ga0496112_0353425 Ga0496112_0353425_369_731 119
216 3300050508 nmdc:mga09592_259501_c1 nmdc:mga09592_259501_c1_745_1107 119
217 3300050509 nmdc:mga0qj67_29596_c1 nmdc:mga0qj67_29596_c1_2071_2433 119
218 3300050510 nmdc:mga06r32_213454_c1 nmdc:mga06r32_213454_c1_320_682 119
219 3300050514 nmdc:mga08x19_614515_c1 nmdc:mga08x19_614515_c1_110_472 119
220 3300005329 Ga0070683_101342436 Ga0070683_1013424361 120
221 3300005340 Ga0070689_100575410 Ga0070689_1005754102 120
222 3300005458 Ga0070681_10334353 Ga0070681_103343533 120
223 3300005530 Ga0070679_102037765 Ga0070679_1020377651 120
224 3300005535 Ga0070684_100739081 Ga0070684_1007390811 120
225 3300005549 Ga0070704_100370836 Ga0070704_1003708362 120
226 3300005577 Ga0068857_100807219 Ga0068857_1008072192 120
227 3300005617 Ga0068859_100284326 Ga0068859_1002843262 120
228 3300005719 Ga0068861_101960703 Ga0068861_1019607031 120
229 3300005843 Ga0068860_101757340 Ga0068860_1017573402 120
230 3300006358 Ga0068871_101240311 Ga0068871_1012403111 120
231 3300006931 Ga0097620_100284327 Ga0097620_1002843272 120
232 3300009093 Ga0105240_10002787 Ga0105240_1000278730 120
233 3300009093 Ga0105240_10619423 Ga0105240_106194233 120
234 3300009545 Ga0105237_10004101 Ga0105237_1000410113 120
235 3300013297 Ga0157378_10604789 Ga0157378_106047893 120
236 3300014326 Ga0157380_10336802 Ga0157380_103368021 120
237 3300014968 Ga0157379_11318236 Ga0157379_113182362 120
238 3300025912 Ga0207707_10273765 Ga0207707_102737652 120
239 3300025913 Ga0207695_10028817 Ga0207695_100288176 120
240 3300025913 Ga0207695_10099638 Ga0207695_100996384 120
241 3300025913 Ga0207695_11306626 Ga0207695_113066262 120
242 3300025914 Ga0207671_10083639 Ga0207671_100836394 120
243 3300025919 Ga0207657_10002498 Ga0207657_1000249815 120
244 3300025949 Ga0207667_10019381 Ga0207667_100193816 120
245 3300026075 Ga0207708_10219495 Ga0207708_102194952 120
246 3300026116 Ga0207674_10822491 Ga0207674_108224912 120
247 3300028800 Ga0265338_10048468 Ga0265338_100484683 120
248 3300031242 Ga0265329_10305119 Ga0265329_103051191 120
249 3300031711 Ga0265314_10041508 Ga0265314_100415083 120
250 3300035083 Ga0373926_0098381 Ga0373926_0098381_266_631 120
251 3300035692 Ga0373935_0643690 Ga0373935_0643690_385_750 120
252 3300035695 Ga0373927_0009950 Ga0373927_0009950_3807_4172 120
253 3300046472 Ga0495580_0102942 Ga0495580_0102942_456_821 120
254 3300049824 Ga0501045_0253202 Ga0501045_0253202_717_1082 120
255 3300060353 Ga0501082_0419864 Ga0501082_0419864_396_761 120
256 3300005329 Ga0070683_100888707 Ga0070683_1008887071 121
257 3300005330 Ga0070690_100136936 Ga0070690_1001369362 121
258 3300005335 Ga0070666_10006360 Ga0070666_100063607 121
259 3300005336 Ga0070680_100192715 Ga0070680_1001927154 121
260 3300005338 Ga0068868_100023331 Ga0068868_1000233316 121
261 3300005338 Ga0068868_100774620 Ga0068868_1007746201 121
262 3300005344 Ga0070661_100123457 Ga0070661_1001234572 121
263 3300005344 Ga0070661_100587031 Ga0070661_1005870313 121
264 3300005355 Ga0070671_100280752 Ga0070671_1002807524 121
265 3300005356 Ga0070674_100943576 Ga0070674_1009435762 121
266 3300005367 Ga0070667_100349338 Ga0070667_1003493383 121
267 3300005434 Ga0070709_10020709 Ga0070709_100207092 121
268 3300005437 Ga0070710_10458279 Ga0070710_104582792 121
269 3300005458 Ga0070681_10028097 Ga0070681_100280975 121
270 3300005459 Ga0068867_100081357 Ga0068867_1000813574 121
271 3300005468 Ga0070707_102224400 Ga0070707_1022244002 121
272 3300005535 Ga0070684_100014596 Ga0070684_1000145962 121
273 3300005539 Ga0068853_100047771 Ga0068853_1000477714 121
274 3300005547 Ga0070693_100289739 Ga0070693_1002897393 121
275 3300005548 Ga0070665_100092473 Ga0070665_1000924735 121
276 3300005563 Ga0068855_100010330 Ga0068855_10001033013 121
277 3300005563 Ga0068855_100213986 Ga0068855_1002139864 121
278 3300005563 Ga0068855_100568609 Ga0068855_1005686091 121
279 3300005564 Ga0070664_100242323 Ga0070664_1002423232 121
280 3300005577 Ga0068857_100058439 Ga0068857_1000584395 121
281 3300005614 Ga0068856_100446216 Ga0068856_1004462162 121
282 3300005616 Ga0068852_100404776 Ga0068852_1004047762 121
283 3300005617 Ga0068859_100046390 Ga0068859_1000463907 121
284 3300005718 Ga0068866_10014578 Ga0068866_100145784 121
285 3300005841 Ga0068863_100066148 Ga0068863_1000661484 121
286 3300005842 Ga0068858_100000755 Ga0068858_10000075520 121
287 3300005843 Ga0068860_100001833 Ga0068860_10000183313 121
288 3300006173 Ga0070716_100454196 Ga0070716_1004541962 121
289 3300006237 Ga0097621_100001558 Ga0097621_1000015581 121
290 3300006237 Ga0097621_100184195 Ga0097621_1001841954 121
291 3300006358 Ga0068871_100019220 Ga0068871_1000192201 121
292 3300006358 Ga0068871_100070019 Ga0068871_1000700195 121
293 3300006881 Ga0068865_100030468 Ga0068865_1000304684 121
294 3300006931 Ga0097620_100046390 Ga0097620_1000463903 121
295 3300009093 Ga0105240_10090805 Ga0105240_100908055 121
296 3300009093 Ga0105240_11016622 Ga0105240_110166222 121
297 3300009098 Ga0105245_10004913 Ga0105245_100049135 121
298 3300009098 Ga0105245_10109467 Ga0105245_101094675 121
299 3300009176 Ga0105242_10041533 Ga0105242_100415335 121
300 3300009176 Ga0105242_10844648 Ga0105242_108446482 121
301 3300009177 Ga0105248_10005725 Ga0105248_100057251 121
302 3300009177 Ga0105248_10607861 Ga0105248_106078612 121
303 3300009177 Ga0105248_10687180 Ga0105248_106871801 121
304 3300009545 Ga0105237_10188416 Ga0105237_101884164 121
305 3300009545 Ga0105237_12170977 Ga0105237_121709771 121
306 3300009553 Ga0105249_10521510 Ga0105249_105215102 121
307 3300010375 Ga0105239_10034942 Ga0105239_100349427 121
308 3300010375 Ga0105239_10921552 Ga0105239_109215522 121
309 3300011119 Ga0105246_10344843 Ga0105246_103448433 121
310 3300013104 Ga0157370_10002147 Ga0157370_1000214715 121
311 3300013104 Ga0157370_10328247 Ga0157370_103282471 121
312 3300013105 Ga0157369_10104855 Ga0157369_101048556 121
313 3300013296 Ga0157374_10048728 Ga0157374_100487283 121
314 3300013297 Ga0157378_10059883 Ga0157378_100598832 121
315 3300013297 Ga0157378_10587194 Ga0157378_105871942 121
316 3300013306 Ga0163162_10090556 Ga0163162_100905561 121
317 3300013306 Ga0163162_11029248 Ga0163162_110292481 121
318 3300013308 Ga0157375_10342448 Ga0157375_103424482 121
319 3300013308 Ga0157375_10490049 Ga0157375_104900494 121
320 3300014325 Ga0163163_10028159 Ga0163163_100281597 121
321 3300014968 Ga0157379_10049938 Ga0157379_100499384 121
322 3300014969 Ga0157376_10054769 Ga0157376_100547693 121
323 3300025899 Ga0207642_10013851 Ga0207642_100138513 121
324 3300025903 Ga0207680_10138723 Ga0207680_101387233 121
325 3300025911 Ga0207654_10157132 Ga0207654_101571321 121
326 3300025912 Ga0207707_10019197 Ga0207707_100191977 121
327 3300025913 Ga0207695_10053575 Ga0207695_100535755 121
328 3300025913 Ga0207695_10179309 Ga0207695_101793092 121
329 3300025914 Ga0207671_10150100 Ga0207671_101501004 121
330 3300025916 Ga0207663_10713728 Ga0207663_107137282 121
331 3300025920 Ga0207649_10270259 Ga0207649_102702592 121
332 3300025920 Ga0207649_10489663 Ga0207649_104896633 121
333 3300025921 Ga0207652_10118993 Ga0207652_101189931 121
334 3300025924 Ga0207694_10002164 Ga0207694_1000216414 121
335 3300025927 Ga0207687_10010241 Ga0207687_100102415 121
336 3300025927 Ga0207687_10075778 Ga0207687_100757781 121
337 3300025934 Ga0207686_10005602 Ga0207686_100056027 121
338 3300025934 Ga0207686_10362700 Ga0207686_103627001 121
339 3300025934 Ga0207686_10439724 Ga0207686_104397242 121
340 3300025937 Ga0207669_11236223 Ga0207669_112362232 121
341 3300025938 Ga0207704_10019841 Ga0207704_100198413 121
342 3300025939 Ga0207665_10956034 Ga0207665_109560341 121
343 3300025941 Ga0207711_10003764 Ga0207711_100037645 121
344 3300025941 Ga0207711_10414139 Ga0207711_104141392 121
345 3300025944 Ga0207661_11132106 Ga0207661_111321062 121
346 3300025945 Ga0207679_10055482 Ga0207679_100554825 121
347 3300025949 Ga0207667_10009718 Ga0207667_1000971812 121
348 3300025961 Ga0207712_10853714 Ga0207712_108537142 121
349 3300025986 Ga0207658_10821324 Ga0207658_108213242 121
350 3300026023 Ga0207677_10017429 Ga0207677_100174295 121
351 3300026023 Ga0207677_10166802 Ga0207677_101668021 121
352 3300026023 Ga0207677_11736116 Ga0207677_117361161 121
353 3300026035 Ga0207703_10010386 Ga0207703_100103867 121
354 3300026041 Ga0207639_10246617 Ga0207639_102466172 121
355 3300026078 Ga0207702_10522921 Ga0207702_105229213 121
356 3300026078 Ga0207702_11375678 Ga0207702_113756782 121
357 3300026089 Ga0207648_10023853 Ga0207648_100238538 121
358 3300026116 Ga0207674_10020184 Ga0207674_100201844 121
359 3300026116 Ga0207674_10225552 Ga0207674_102255521 121
360 3300026142 Ga0207698_10307540 Ga0207698_103075404 121
361 3300026142 Ga0207698_11070582 Ga0207698_110705823 121
362 3300028379 Ga0268266_10231470 Ga0268266_102314704 121
363 3300028381 Ga0268264_10008523 Ga0268264_100085238 121
364 3300028800 Ga0265338_10428257 Ga0265338_104282571 121
365 3300031249 Ga0265339_10304183 Ga0265339_103041832 121
366 3300031712 Ga0265342_10305998 Ga0265342_103059983 121
367 3300035113 Ga0373936_0047851 Ga0373936_0047851_1195_1563 121
368 3300035116 Ga0373945_0345719 Ga0373945_0345719_194_562 121
369 3300035691 Ga0373931_1292139 Ga0373931_1292139_85_453 121
370 3300035692 Ga0373935_1476696 Ga0373935_1476696_14_385 121
371 3300035695 Ga0373927_0057982 Ga0373927_0057982_1457_1825 121
372 3300035725 Ga0373947_0057530 Ga0373947_0057530_1727_2095 121
373 3300036401 Ga0373937_1096293 Ga0373937_1096293_274_642 121
374 3300037068 Ga0373925_0174285 Ga0373925_0174285_990_1358 121
375 3300037068 Ga0373925_0200879 Ga0373925_0200879_543_911 121
376 3300046472 Ga0495580_0115221 Ga0495580_0115221_527_895 121
377 3300046473 Ga0495582_0479886 Ga0495582_0479886_340_708 121
378 3300046516 Ga0495628_0604900 Ga0495628_0604900_396_764 121
379 3300046526 Ga0495666_0102408 Ga0495666_0102408_520_888 121
380 3300047319 Ga0495674_0341773 Ga0495674_0341773_11_379 121
381 3300047471 Ga0495684_0600517 Ga0495684_0600517_266_634 121
382 3300004803 Ga0058862_12552942 Ga0058862_125529421 122
383 3300005327 Ga0070658_10605987 Ga0070658_106059872 122
384 3300005329 Ga0070683_100195529 Ga0070683_1001955293 122
385 3300005336 Ga0070680_100018669 Ga0070680_1000186694 122
386 3300005336 Ga0070680_100347628 Ga0070680_1003476283 122
387 3300005336 Ga0070680_100467265 Ga0070680_1004672652 122
388 3300005336 Ga0070680_100789994 Ga0070680_1007899942 122
389 3300005338 Ga0068868_100018643 Ga0068868_1000186432 122
390 3300005339 Ga0070660_100956126 Ga0070660_1009561262 122
391 3300005344 Ga0070661_100197857 Ga0070661_1001978573 122
392 3300005344 Ga0070661_100401851 Ga0070661_1004018511 122
393 3300005344 Ga0070661_100409291 Ga0070661_1004092912 122
394 3300005345 Ga0070692_10215163 Ga0070692_102151632 122
395 3300005355 Ga0070671_100099394 Ga0070671_1000993944 122
396 3300005355 Ga0070671_100901345 Ga0070671_1009013452 122
397 3300005364 Ga0070673_101709683 Ga0070673_1017096832 122
398 3300005366 Ga0070659_100166462 Ga0070659_1001664623 122
399 3300005367 Ga0070667_100580878 Ga0070667_1005808782 122
400 3300005434 Ga0070709_11005761 Ga0070709_110057611 122
401 3300005435 Ga0070714_100069781 Ga0070714_1000697814 122
402 3300005435 Ga0070714_100146572 Ga0070714_1001465724 122
403 3300005436 Ga0070713_101540378 Ga0070713_1015403781 122
404 3300005439 Ga0070711_100032596 Ga0070711_1000325964 122
405 3300005455 Ga0070663_100080656 Ga0070663_1000806564 122
406 3300005455 Ga0070663_100476034 Ga0070663_1004760342 122
407 3300005456 Ga0070678_100092641 Ga0070678_1000926411 122
408 3300005456 Ga0070678_101999017 Ga0070678_1019990171 122
409 3300005457 Ga0070662_101618970 Ga0070662_1016189701 122
410 3300005458 Ga0070681_10139831 Ga0070681_101398314 122
411 3300005458 Ga0070681_10180010 Ga0070681_101800104 122
412 3300005458 Ga0070681_10255979 Ga0070681_102559794 122
413 3300005458 Ga0070681_10822276 Ga0070681_108222762 122
414 3300005459 Ga0068867_101794928 Ga0068867_1017949281 122
415 3300005530 Ga0070679_100087651 Ga0070679_1000876514 122
416 3300005535 Ga0070684_100517949 Ga0070684_1005179491 122
417 3300005539 Ga0068853_100037198 Ga0068853_1000371985 122
418 3300005539 Ga0068853_100343677 Ga0068853_1003436773 122
419 3300005539 Ga0068853_100413171 Ga0068853_1004131712 122
420 3300005546 Ga0070696_101599923 Ga0070696_1015999231 122
421 3300005548 Ga0070665_100012183 Ga0070665_1000121835 122
422 3300005548 Ga0070665_100195190 Ga0070665_1001951904 122
423 3300005548 Ga0070665_100279803 Ga0070665_1002798034 122
424 3300005563 Ga0068855_100115444 Ga0068855_1001154442 122
425 3300005563 Ga0068855_100211219 Ga0068855_1002112193 122
426 3300005563 Ga0068855_100605453 Ga0068855_1006054531 122
427 3300005564 Ga0070664_100155410 Ga0070664_1001554103 122
428 3300005577 Ga0068857_100001847 Ga0068857_10000184711 122
429 3300005577 Ga0068857_100499715 Ga0068857_1004997152 122
430 3300005577 Ga0068857_100670809 Ga0068857_1006708092 122
431 3300005614 Ga0068856_100029579 Ga0068856_1000295791 122
432 3300005614 Ga0068856_100033181 Ga0068856_1000331814 122
433 3300005614 Ga0068856_100062282 Ga0068856_1000622821 122
434 3300005614 Ga0068856_100310341 Ga0068856_1003103413 122
435 3300005614 Ga0068856_101033466 Ga0068856_1010334662 122
436 3300005614 Ga0068856_101452587 Ga0068856_1014525871 122
437 3300005616 Ga0068852_100028325 Ga0068852_1000283252 122
438 3300005616 Ga0068852_101617479 Ga0068852_1016174791 122
439 3300005617 Ga0068859_100240242 Ga0068859_1002402422 122
440 3300005618 Ga0068864_100019910 Ga0068864_1000199102 122
441 3300005841 Ga0068863_100009340 Ga0068863_1000093407 122
442 3300005841 Ga0068863_102355958 Ga0068863_1023559581 122
443 3300005842 Ga0068858_100008800 Ga0068858_1000088007 122
444 3300005842 Ga0068858_100973907 Ga0068858_1009739071 122
445 3300005843 Ga0068860_102251113 Ga0068860_1022511131 122
446 3300005937 Ga0081455_10062775 Ga0081455_100627753 122
447 3300006028 Ga0070717_10004755 Ga0070717_100047554 122
448 3300006028 Ga0070717_10905983 Ga0070717_109059831 122
449 3300006175 Ga0070712_100135808 Ga0070712_1001358082 122
450 3300006237 Ga0097621_100036842 Ga0097621_1000368421 122
451 3300006237 Ga0097621_100470791 Ga0097621_1004707912 122
452 3300006358 Ga0068871_100034190 Ga0068871_1000341905 122
453 3300006358 Ga0068871_100180177 Ga0068871_1001801772 122
454 3300006358 Ga0068871_100393295 Ga0068871_1003932951 122
455 3300006931 Ga0097620_100240225 Ga0097620_1002402254 122
456 3300009098 Ga0105245_10278380 Ga0105245_102783804 122
457 3300009098 Ga0105245_11354416 Ga0105245_113544162 122
458 3300009101 Ga0105247_10275450 Ga0105247_102754503 122
459 3300009148 Ga0105243_11395399 Ga0105243_113953992 122
460 3300009174 Ga0105241_10012575 Ga0105241_100125758 122
461 3300009174 Ga0105241_10028194 Ga0105241_100281944 122
462 3300009174 Ga0105241_10054670 Ga0105241_100546705 122
463 3300009176 Ga0105242_10229351 Ga0105242_102293514 122
464 3300009177 Ga0105248_10102838 Ga0105248_101028385 122
465 3300009177 Ga0105248_11150061 Ga0105248_111500612 122
466 3300009545 Ga0105237_10162513 Ga0105237_101625135 122
467 3300009545 Ga0105237_11026884 Ga0105237_110268842 122
468 3300009551 Ga0105238_10024897 Ga0105238_100248977 122
469 3300009551 Ga0105238_10487384 Ga0105238_104873841 122
470 3300009553 Ga0105249_12204392 Ga0105249_122043921 122
471 3300010375 Ga0105239_10266158 Ga0105239_102661584 122
472 3300010375 Ga0105239_10405486 Ga0105239_104054863 122
473 3300010375 Ga0105239_10801982 Ga0105239_108019823 122
474 3300011119 Ga0105246_11048947 Ga0105246_110489472 122
475 3300013100 Ga0157373_10082321 Ga0157373_100823212 122
476 3300013100 Ga0157373_10222800 Ga0157373_102228002 122
477 3300013100 Ga0157373_10286718 Ga0157373_102867183 122
478 3300013104 Ga0157370_10023389 Ga0157370_100233893 122
479 3300013104 Ga0157370_10295224 Ga0157370_102952242 122
480 3300013104 Ga0157370_10329604 Ga0157370_103296043 122
481 3300013105 Ga0157369_10013033 Ga0157369_1001303310 122
482 3300013105 Ga0157369_10216259 Ga0157369_102162594 122
483 3300013105 Ga0157369_10235210 Ga0157369_102352102 122
484 3300013105 Ga0157369_10677113 Ga0157369_106771131 122
485 3300013296 Ga0157374_10052188 Ga0157374_100521884 122
486 3300013296 Ga0157374_12543211 Ga0157374_125432111 122
487 3300013297 Ga0157378_11240793 Ga0157378_112407932 122
488 3300013306 Ga0163162_10082249 Ga0163162_100822495 122
489 3300013307 Ga0157372_10140298 Ga0157372_101402984 122
490 3300013307 Ga0157372_10697203 Ga0157372_106972033 122
491 3300013307 Ga0157372_11645972 Ga0157372_116459722 122
492 3300013307 Ga0157372_11902025 Ga0157372_119020251 122
493 3300013308 Ga0157375_11081270 Ga0157375_110812702 122
494 3300014325 Ga0163163_10019654 Ga0163163_100196546 122
495 3300014325 Ga0163163_10022881 Ga0163163_100228817 122
496 3300014968 Ga0157379_10011068 Ga0157379_100110686 122
497 3300014969 Ga0157376_10635313 Ga0157376_106353131 122
498 3300020069 Ga0197907_10478193 Ga0197907_104781933 122
499 3300020076 Ga0206355_1016973 Ga0206355_10169732 122
500 3300020076 Ga0206355_1181757 Ga0206355_11817573 122
501 3300020076 Ga0206355_1610152 Ga0206355_16101523 122
502 3300020080 Ga0206350_10782737 Ga0206350_107827372 122
503 3300020081 Ga0206354_10271648 Ga0206354_102716482 122
504 3300020610 Ga0154015_1076892 Ga0154015_10768922 122
505 3300021361 Ga0213872_10019520 Ga0213872_100195204 122
506 3300021384 Ga0213876_10002108 Ga0213876_100021088 122
507 3300021384 Ga0213876_10159913 Ga0213876_101599133 122
508 3300021384 Ga0213876_10628131 Ga0213876_106281312 122
509 3300021388 Ga0213875_10000005 Ga0213875_10000005372 122
510 3300021388 Ga0213875_10000032 Ga0213875_1000003271 122
511 3300021388 Ga0213875_10004701 Ga0213875_100047013 122
512 3300021388 Ga0213875_10052390 Ga0213875_100523903 122
513 3300021388 Ga0213875_10083560 Ga0213875_100835603 122
514 3300021388 Ga0213875_10116236 Ga0213875_101162364 122
515 3300021388 Ga0213875_10119406 Ga0213875_101194062 122
516 3300021388 Ga0213875_10493512 Ga0213875_104935122 122
517 3300025909 Ga0207705_10694328 Ga0207705_106943281 122
518 3300025911 Ga0207654_10053839 Ga0207654_100538394 122
519 3300025911 Ga0207654_10838129 Ga0207654_108381292 122
520 3300025912 Ga0207707_10083251 Ga0207707_100832514 122
521 3300025912 Ga0207707_10124928 Ga0207707_101249281 122
522 3300025912 Ga0207707_10682426 Ga0207707_106824262 122
523 3300025912 Ga0207707_11088897 Ga0207707_110888971 122
524 3300025913 Ga0207695_10758795 Ga0207695_107587952 122
525 3300025914 Ga0207671_10110645 Ga0207671_101106452 122
526 3300025914 Ga0207671_10583272 Ga0207671_105832722 122
527 3300025915 Ga0207693_10377755 Ga0207693_103777552 122
528 3300025916 Ga0207663_10034577 Ga0207663_100345774 122
529 3300025917 Ga0207660_10040808 Ga0207660_100408084 122
530 3300025917 Ga0207660_10908621 Ga0207660_109086211 122
531 3300025919 Ga0207657_10784366 Ga0207657_107843662 122
532 3300025920 Ga0207649_10198100 Ga0207649_101981003 122
533 3300025920 Ga0207649_10310410 Ga0207649_103104103 122
534 3300025921 Ga0207652_10030242 Ga0207652_100302425 122
535 3300025921 Ga0207652_10073269 Ga0207652_100732694 122
536 3300025921 Ga0207652_10205254 Ga0207652_102052543 122
537 3300025924 Ga0207694_10028823 Ga0207694_100288236 122
538 3300025924 Ga0207694_10407300 Ga0207694_104073003 122
539 3300025927 Ga0207687_10038732 Ga0207687_100387324 122
540 3300025928 Ga0207700_10483900 Ga0207700_104839003 122
541 3300025928 Ga0207700_10722293 Ga0207700_107222931 122
542 3300025928 Ga0207700_11971657 Ga0207700_119716571 122
543 3300025929 Ga0207664_10834828 Ga0207664_108348281 122
544 3300025931 Ga0207644_10383002 Ga0207644_103830023 122
545 3300025932 Ga0207690_10017593 Ga0207690_100175933 122
546 3300025933 Ga0207706_10142484 Ga0207706_101424843 122
547 3300025934 Ga0207686_10227632 Ga0207686_102276322 122
548 3300025941 Ga0207711_10006942 Ga0207711_100069425 122
549 3300025941 Ga0207711_10644232 Ga0207711_106442322 122
550 3300025941 Ga0207711_11800448 Ga0207711_118004482 122
551 3300025942 Ga0207689_10270410 Ga0207689_102704102 122
552 3300025944 Ga0207661_10703845 Ga0207661_107038453 122
553 3300025945 Ga0207679_10033266 Ga0207679_100332663 122
554 3300025945 Ga0207679_10893046 Ga0207679_108930462 122
555 3300025949 Ga0207667_10093738 Ga0207667_100937382 122
556 3300025981 Ga0207640_10723355 Ga0207640_107233553 122
557 3300025986 Ga0207658_10125245 Ga0207658_101252454 122
558 3300026023 Ga0207677_10405488 Ga0207677_104054882 122
559 3300026035 Ga0207703_10018464 Ga0207703_100184647 122
560 3300026035 Ga0207703_10208527 Ga0207703_102085274 122
561 3300026041 Ga0207639_10017212 Ga0207639_100172125 122
562 3300026041 Ga0207639_10971520 Ga0207639_109715202 122
563 3300026067 Ga0207678_10015939 Ga0207678_100159398 122
564 3300026067 Ga0207678_10234034 Ga0207678_102340343 122
565 3300026067 Ga0207678_10429065 Ga0207678_104290652 122
566 3300026078 Ga0207702_10011018 Ga0207702_100110181 122
567 3300026078 Ga0207702_10096877 Ga0207702_100968773 122
568 3300026078 Ga0207702_10324265 Ga0207702_103242652 122
569 3300026078 Ga0207702_12004937 Ga0207702_120049371 122
570 3300026088 Ga0207641_10837064 Ga0207641_108370641 122
571 3300026089 Ga0207648_10917814 Ga0207648_109178142 122
572 3300026095 Ga0207676_10005545 Ga0207676_1000554511 122
573 3300026116 Ga0207674_10103476 Ga0207674_101034765 122
574 3300026116 Ga0207674_10987657 Ga0207674_109876572 122
575 3300026142 Ga0207698_10076766 Ga0207698_100767665 122
576 3300026142 Ga0207698_10930288 Ga0207698_109302883 122
577 3300026142 Ga0207698_11616383 Ga0207698_116163831 122
578 3300028379 Ga0268266_10014693 Ga0268266_100146937 122
579 3300028379 Ga0268266_10178037 Ga0268266_101780374 122
580 3300028379 Ga0268266_10791949 Ga0268266_107919492 122
581 3300031090 Ga0265760_10097150 Ga0265760_100971502 122
582 3300035172 Ga0373955_0601032 Ga0373955_0601032_252_635 122
583 3300035241 Ga0373961_0086987 Ga0373961_0086987_165_545 122
584 3300035691 Ga0373931_0163320 Ga0373931_0163320_197_577 122
585 3300035691 Ga0373931_0491434 Ga0373931_0491434_194_577 122
586 3300035692 Ga0373935_0012503 Ga0373935_0012503_4084_4452 122
587 3300036401 Ga0373937_0301627 Ga0373937_0301627_899_1282 122
588 3300037418 Ga0395900_0191212 Ga0395900_0191212_1325_1693 122
589 3300037466 Ga0395898_0106005 Ga0395898_0106005_1139_1507 122
590 3300037853 Ga0436364_0010332 Ga0436364_0010332_411_779 122
591 3300037853 Ga0436364_0031051 Ga0436364_0031051_378_746 122
592 3300037853 Ga0436364_0132953 Ga0436364_0132953_5030_5398 122
593 3300037853 Ga0436364_0157811 Ga0436364_0157811_155159_155527 122
594 3300037853 Ga0436364_0202263 Ga0436364_0202263_14504_14872 122
595 3300037853 Ga0436364_0282990 Ga0436364_0282990_201_569 122
596 3300037853 Ga0436364_0457930 Ga0436364_0457930_4734_5102 122
597 3300037853 Ga0436364_0483108 Ga0436364_0483108_1182_1550 122
598 3300037853 Ga0436364_0520948 Ga0436364_0520948_2783_3151 122
599 3300037853 Ga0436364_0647542 Ga0436364_0647542_722_1090 122
600 3300037853 Ga0436364_0715739 Ga0436364_0715739_7706_8074 122
601 3300037853 Ga0436364_0833005 Ga0436364_0833005_681_1049 122
602 3300037853 Ga0436364_1074294 Ga0436364_1074294_703_1074 122
603 3300037853 Ga0436364_1108687 Ga0436364_1108687_2042_2410 122
604 3300037853 Ga0436364_1294932 Ga0436364_1294932_913_1281 122
605 3300037853 Ga0436364_1299641 Ga0436364_1299641_157_525 122
606 3300037853 Ga0436364_1369623 Ga0436364_1369623_8058_8426 122
607 3300037853 Ga0436364_1443683 Ga0436364_1443683_130_498 122
608 3300037853 Ga0436364_1500628 Ga0436364_1500628_1602_1970 122
609 3300037853 Ga0436364_1561923 Ga0436364_1561923_418_786 122
610 3300039437 Ga0436365_0068008 Ga0436365_0068008_4284_4652 122
611 3300039437 Ga0436365_0205552 Ga0436365_0205552_693_1061 122
612 3300039437 Ga0436365_0279355 Ga0436365_0279355_140_508 122
613 3300039437 Ga0436365_0693032 Ga0436365_0693032_574_942 122
614 3300039437 Ga0436365_0837841 Ga0436365_0837841_343_711 122
615 3300039437 Ga0436365_0892357 Ga0436365_0892357_4771_5139 122
616 3300039437 Ga0436365_1336592 Ga0436365_1336592_141_509 122
617 3300039438 Ga0436360_1116020 Ga0436360_1116020_101_469 122
618 3300039447 Ga0436361_0377638 Ga0436361_0377638_781_1149 122
619 3300039450 Ga0436363_0094956 Ga0436363_0094956_31_399 122
620 3300039450 Ga0436363_0612539 Ga0436363_0612539_553_921 122
621 3300039450 Ga0436363_1512130 Ga0436363_1512130_2715_3083 122
622 3300039453 Ga0436362_0280648 Ga0436362_0280648_473_841 122
623 3300039453 Ga0436362_0647631 Ga0436362_0647631_516_884 122
624 3300039453 Ga0436362_1121200 Ga0436362_1121200_147_515 122
625 3300044694 Ga0466963_0120787 Ga0466963_0120787_713_1081 122
626 3300044694 Ga0466963_0512189 Ga0466963_0512189_264_632 122
627 3300045049 Ga0466959_1089089 Ga0466959_1089089_49_417 122
628 3300045836 Ga0466958_0080423 Ga0466958_0080423_277_645 122
629 3300046472 Ga0495580_0045958 Ga0495580_0045958_515_898 122
630 3300046472 Ga0495580_0292998 Ga0495580_0292998_18_386 122
631 3300046678 Ga0495599_0540955 Ga0495599_0540955_137_520 122
632 3300047322 Ga0495680_0181699 Ga0495680_0181699_755_1132 122
633 3300048088 Ga0495602_0499955 Ga0495602_0499955_377_760 122
634 3300048908 Ga0496105_0199801 Ga0496105_0199801_1230_1598 122
635 3300048915 Ga0496112_0468036 Ga0496112_0468036_446_826 122
636 3300048918 Ga0496115_0098693 Ga0496115_0098693_825_1193 122
637 3300049569 Ga0501032_0358148 Ga0501032_0358148_456_824 122
638 3300049571 Ga0501034_0083100 Ga0501034_0083100_1160_1528 122
639 3300049571 Ga0501034_0609268 Ga0501034_0609268_168_536 122
640 3300049573 Ga0501037_0056145 Ga0501037_0056145_1504_1872 122
641 3300049573 Ga0501037_0169131 Ga0501037_0169131_305_673 122
642 3300049574 Ga0501038_0243224 Ga0501038_0243224_828_1196 122
643 3300049579 Ga0501043_0170832 Ga0501043_0170832_224_592 122
644 3300049580 Ga0501046_0287212 Ga0501046_0287212_348_716 122
645 3300049581 Ga0501047_0063330 Ga0501047_0063330_842_1210 122
646 3300049581 Ga0501047_0086128 Ga0501047_0086128_1666_2034 122
647 3300049582 Ga0501048_0097911 Ga0501048_0097911_1014_1382 122
648 3300049585 Ga0501069_0206694 Ga0501069_0206694_149_517 122
649 3300049586 Ga0501070_0084428 Ga0501070_0084428_1148_1516 122
650 3300049589 Ga0501073_0327214 Ga0501073_0327214_245_613 122
651 3300049590 Ga0501074_0252918 Ga0501074_0252918_287_655 122
652 3300049822 Ga0501035_0002323 Ga0501035_0002323_2358_2726 122
653 3300049823 Ga0501044_0001094 Ga0501044_0001094_1127_1495 122
654 3300049823 Ga0501044_0001731 Ga0501044_0001731_2347_2715 122
655 3300049823 Ga0501044_0961468 Ga0501044_0961468_41_409 122
656 3300053077 Ga0495601_0100599 Ga0495601_0100599_228_596 122
657 3300059630 Ga0587128_052210 Ga0587128_052210_332_700 122
658 3300059640 Ga0587067_046716 Ga0587067_046716_329_697 122
659 3300059647 Ga0587079_199730 Ga0587079_199730_149_517 122
660 3300059655 Ga0587114_044098 Ga0587114_044098_38_406 122
661 3300061719 Ga0466962_0406631 Ga0466962_0406631_96_464 122
662 3300005455 Ga0070663_102068931 Ga0070663_1020689311 124
663 3300004800 Ga0058861_11975732 Ga0058861_119757321 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

26

132

0.99

Feature Viewer

pLDDT pTM Quality
72.65 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map