F473716
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 665 | 322 | 664 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0828111|Ga0395900_0828111_45_434 |
| Length | 129 |
| Sequence | VSSPRAFRTTYTDRNERTVMPKMTFIERDGTRKEVDAPLGLSVLEVAHKHGIDLEGACEGSLACSTCHVIVESDWFELLKDPTEDEEDMLDLAFGLTQTSRLGCQIIMTEELDGLTVSLPAGTRNMMNG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 87 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013875 | Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 108 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 109 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 112 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 113 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 186 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 196 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 197 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 229 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 230 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 231 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 232 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 233 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 234 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 236 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 237 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 238 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 239 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 240 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 241 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 244 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 277 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 278 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 300 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 301 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 303 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 304 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 306 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 307 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 312 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 313 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 314 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 315 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 316 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 317 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 318 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 319 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 321 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 322 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.8 |
| Metatranscriptomes | 1.05 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.08 |
| Nodule | 0 |
| Rhizoplane | 0.75 |
| Rhizosphere | 84.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25405J52794_10034116 | 3300003911 | Bacteria | 1063 |
| 2 | Ga0065704_10283593 | 3300005289 | Bacteria | 917 |
| 3 | Ga0070676_11003028 | 3300005328 | Bacteria | 627 |
| 4 | Ga0070676_11432135 | 3300005328 | Bacteria | 531 |
| 5 | Ga0070683_100200618 | 3300005329 | Bacteria | 1894 |
| 6 | Ga0070670_101458998 | 3300005331 | Bacteria | 628 |
| 7 | Ga0070680_100011146 | 3300005336 | Bacteria | 6952 |
| 8 | Ga0070680_100241464 | 3300005336 | Bacteria | 1527 |
| 9 | Ga0070682_100296944 | 3300005337 | Bacteria | 1184 |
| 10 | Ga0070682_101123858 | 3300005337 | Bacteria | 659 |
| 11 | Ga0070660_101458349 | 3300005339 | Bacteria | 582 |
| 12 | Ga0070660_101785357 | 3300005339 | Bacteria | 524 |
| 13 | Ga0070689_100386965 | 3300005340 | Bacteria | 1180 |
| 14 | Ga0070691_10004768 | 3300005341 | Bacteria | 6172 |
| 15 | Ga0070687_100832965 | 3300005343 | Bacteria | 656 |
| 16 | Ga0070661_100076995 | 3300005344 | Bacteria | 2458 |
| 17 | Ga0070669_100063124 | 3300005353 | Bacteria | 2726 |
| 18 | Ga0070675_100114628 | 3300005354 | Bacteria | 2284 |
| 19 | Ga0070675_102138301 | 3300005354 | Bacteria | 516 |
| 20 | Ga0070671_101748467 | 3300005355 | Bacteria | 552 |
| 21 | Ga0070671_102094380 | 3300005355 | Bacteria | 504 |
| 22 | Ga0070674_100154692 | 3300005356 | Bacteria | 1734 |
| 23 | Ga0070673_100763167 | 3300005364 | Bacteria | 891 |
| 24 | Ga0070688_100928285 | 3300005365 | Bacteria | 688 |
| 25 | Ga0070659_100037656 | 3300005366 | Bacteria | 3771 |
| 26 | Ga0070667_100500314 | 3300005367 | Bacteria | 1114 |
| 27 | Ga0070667_100899325 | 3300005367 | Bacteria | 824 |
| 28 | Ga0070714_100072203 | 3300005435 | Bacteria | 2987 |
| 29 | Ga0070714_100353744 | 3300005435 | Bacteria | 1380 |
| 30 | Ga0070714_101282697 | 3300005435 | Bacteria | 715 |
| 31 | Ga0070714_102287746 | 3300005435 | Bacteria | 526 |
| 32 | Ga0070713_100011746 | 3300005436 | Bacteria | 6394 |
| 33 | Ga0070713_100110926 | 3300005436 | Bacteria | 2391 |
| 34 | Ga0070713_100220449 | 3300005436 | Bacteria | 1720 |
| 35 | Ga0070713_100309336 | 3300005436 | Bacteria | 1457 |
| 36 | Ga0070710_10030737 | 3300005437 | Bacteria | 2892 |
| 37 | Ga0070710_10059981 | 3300005437 | Bacteria | 2162 |
| 38 | Ga0070710_10457879 | 3300005437 | Bacteria | 866 |
| 39 | Ga0070711_100139384 | 3300005439 | Bacteria | 1816 |
| 40 | Ga0070711_100675859 | 3300005439 | Bacteria | 868 |
| 41 | Ga0070711_101554820 | 3300005439 | Bacteria | 578 |
| 42 | Ga0070678_100031445 | 3300005456 | Bacteria | 3662 |
| 43 | Ga0070678_100090914 | 3300005456 | Bacteria | 2341 |
| 44 | Ga0070662_100397411 | 3300005457 | Bacteria | 1137 |
| 45 | Ga0070681_10007259 | 3300005458 | Bacteria | 10812 |
| 46 | Ga0070681_10099714 | 3300005458 | Bacteria | 2850 |
| 47 | Ga0070681_10142506 | 3300005458 | Bacteria | 2326 |
| 48 | Ga0070681_10197634 | 3300005458 | Bacteria | 1929 |
| 49 | Ga0070681_10371479 | 3300005458 | Bacteria | 1340 |
| 50 | Ga0070681_11610831 | 3300005458 | Bacteria | 575 |
| 51 | Ga0070706_100663818 | 3300005467 | Bacteria | 967 |
| 52 | Ga0070706_101370366 | 3300005467 | Bacteria | 648 |
| 53 | Ga0070707_100072176 | 3300005468 | Bacteria | 3327 |
| 54 | Ga0070698_100000641 | 3300005471 | Bacteria | 37565 |
| 55 | Ga0070698_100474372 | 3300005471 | Bacteria | 1188 |
| 56 | Ga0070698_100972051 | 3300005471 | Bacteria | 796 |
| 57 | Ga0070699_100179098 | 3300005518 | Bacteria | 1880 |
| 58 | Ga0070679_100001462 | 3300005530 | Bacteria | 20930 |
| 59 | Ga0070679_100004471 | 3300005530 | Bacteria | 12911 |
| 60 | Ga0070679_100340059 | 3300005530 | Bacteria | 1449 |
| 61 | Ga0070679_100786514 | 3300005530 | Bacteria | 895 |
| 62 | Ga0070679_101418393 | 3300005530 | Bacteria | 641 |
| 63 | Ga0070679_102164825 | 3300005530 | Bacteria | 506 |
| 64 | Ga0070684_100129754 | 3300005535 | Bacteria | 2273 |
| 65 | Ga0070684_100867420 | 3300005535 | Bacteria | 845 |
| 66 | Ga0070697_100278070 | 3300005536 | Bacteria | 1436 |
| 67 | Ga0068853_100330810 | 3300005539 | Bacteria | 1414 |
| 68 | Ga0068853_101127355 | 3300005539 | Bacteria | 757 |
| 69 | Ga0070672_100048117 | 3300005543 | Bacteria | 3312 |
| 70 | Ga0070672_101534197 | 3300005543 | Bacteria | 597 |
| 71 | Ga0070665_100139250 | 3300005548 | Bacteria | 2430 |
| 72 | Ga0070665_100398548 | 3300005548 | Bacteria | 1384 |
| 73 | Ga0070665_100498618 | 3300005548 | Bacteria | 1229 |
| 74 | Ga0070665_100503145 | 3300005548 | Bacteria | 1223 |
| 75 | Ga0068855_100016016 | 3300005563 | Bacteria | 9018 |
| 76 | Ga0068855_100260762 | 3300005563 | Bacteria | 1931 |
| 77 | Ga0068855_100592469 | 3300005563 | Bacteria | 1196 |
| 78 | Ga0068855_102325954 | 3300005563 | Bacteria | 536 |
| 79 | Ga0070664_100347455 | 3300005564 | Bacteria | 1348 |
| 80 | Ga0068857_100343133 | 3300005577 | Bacteria | 1382 |
| 81 | Ga0068857_101341839 | 3300005577 | Bacteria | 695 |
| 82 | Ga0068854_100137911 | 3300005578 | Bacteria | 1869 |
| 83 | Ga0068854_101147126 | 3300005578 | Bacteria | 694 |
| 84 | Ga0068856_100014010 | 3300005614 | Bacteria | 7753 |
| 85 | Ga0068856_100145975 | 3300005614 | Bacteria | 2374 |
| 86 | Ga0068856_100641202 | 3300005614 | Bacteria | 1083 |
| 87 | Ga0068856_100952846 | 3300005614 | Bacteria | 877 |
| 88 | Ga0070702_101244607 | 3300005615 | Bacteria | 602 |
| 89 | Ga0068852_100087687 | 3300005616 | Bacteria | 2777 |
| 90 | Ga0068859_100087454 | 3300005617 | Bacteria | 3164 |
| 91 | Ga0068859_103068405 | 3300005617 | Bacteria | 510 |
| 92 | Ga0068864_100869617 | 3300005618 | Bacteria | 889 |
| 93 | Ga0068864_101958916 | 3300005618 | Bacteria | 592 |
| 94 | Ga0068851_10264176 | 3300005834 | Bacteria | 980 |
| 95 | Ga0068851_11087968 | 3300005834 | Bacteria | 507 |
| 96 | Ga0068858_100393281 | 3300005842 | Bacteria | 1331 |
| 97 | Ga0068860_102440677 | 3300005843 | Bacteria | 543 |
| 98 | Ga0068862_100291437 | 3300005844 | Bacteria | 1499 |
| 99 | Ga0081455_10000688 | 3300005937 | Bacteria | 43874 |
| 100 | Ga0081455_10009381 | 3300005937 | Bacteria | 10066 |
| 101 | Ga0081455_10365018 | 3300005937 | Bacteria | 1014 |
| 102 | Ga0081540_1030277 | 3300005983 | Bacteria | 3000 |
| 103 | Ga0081540_1067783 | 3300005983 | Bacteria | 1665 |
| 104 | Ga0081539_10007016 | 3300005985 | Bacteria | 10450 |
| 105 | Ga0081539_10010675 | 3300005985 | Bacteria | 7408 |
| 106 | Ga0070717_10024887 | 3300006028 | Bacteria | 4756 |
| 107 | Ga0070717_10144933 | 3300006028 | Bacteria | 2051 |
| 108 | Ga0070717_10546151 | 3300006028 | Bacteria | 1049 |
| 109 | Ga0070717_10792442 | 3300006028 | Bacteria | 862 |
| 110 | Ga0070717_11632208 | 3300006028 | Bacteria | 584 |
| 111 | Ga0070717_11961999 | 3300006028 | Bacteria | 528 |
| 112 | Ga0075365_10026742 | 3300006038 | Bacteria | 3666 |
| 113 | Ga0075365_10242485 | 3300006038 | Bacteria | 1266 |
| 114 | Ga0075365_10468008 | 3300006038 | Bacteria | 890 |
| 115 | Ga0075365_11064830 | 3300006038 | Bacteria | 569 |
| 116 | Ga0075368_10029075 | 3300006042 | Bacteria | 2137 |
| 117 | Ga0075364_10219070 | 3300006051 | Bacteria | 1291 |
| 118 | Ga0075364_10317627 | 3300006051 | Bacteria | 1060 |
| 119 | Ga0075432_10180476 | 3300006058 | Bacteria | 826 |
| 120 | Ga0070715_10790982 | 3300006163 | Bacteria | 575 |
| 121 | Ga0070716_100193903 | 3300006173 | Bacteria | 1345 |
| 122 | Ga0070716_101176149 | 3300006173 | Bacteria | 615 |
| 123 | Ga0070712_100049785 | 3300006175 | Bacteria | 2911 |
| 124 | Ga0070712_100174596 | 3300006175 | Bacteria | 1670 |
| 125 | Ga0070712_100435971 | 3300006175 | Bacteria | 1089 |
| 126 | Ga0075362_10006964 | 3300006177 | Bacteria | 4244 |
| 127 | Ga0075362_10020910 | 3300006177 | Bacteria | 2738 |
| 128 | Ga0075362_10123776 | 3300006177 | Bacteria | 1226 |
| 129 | Ga0075362_10140285 | 3300006177 | Bacteria | 1155 |
| 130 | Ga0075362_10174824 | 3300006177 | Bacteria | 1039 |
| 131 | Ga0075362_10616114 | 3300006177 | Bacteria | 562 |
| 132 | Ga0075367_10009522 | 3300006178 | Bacteria | 5082 |
| 133 | Ga0075367_10029988 | 3300006178 | Bacteria | 3115 |
| 134 | Ga0075367_10331436 | 3300006178 | Bacteria | 960 |
| 135 | Ga0075369_10015552 | 3300006186 | Bacteria | 3056 |
| 136 | Ga0075369_10018239 | 3300006186 | Bacteria | 2856 |
| 137 | Ga0075369_10231094 | 3300006186 | Bacteria | 857 |
| 138 | Ga0075366_10036962 | 3300006195 | Bacteria | 2880 |
| 139 | Ga0075366_10359758 | 3300006195 | Bacteria | 894 |
| 140 | Ga0075366_10870653 | 3300006195 | Bacteria | 561 |
| 141 | Ga0097621_100485764 | 3300006237 | Bacteria | 1117 |
| 142 | Ga0075370_10016237 | 3300006353 | Bacteria | 4003 |
| 143 | Ga0075370_10049140 | 3300006353 | Bacteria | 2391 |
| 144 | Ga0075370_10251888 | 3300006353 | Bacteria | 1047 |
| 145 | Ga0068871_100776988 | 3300006358 | Bacteria | 882 |
| 146 | Ga0075428_100903433 | 3300006844 | Bacteria | 937 |
| 147 | Ga0068865_102033514 | 3300006881 | Bacteria | 522 |
| 148 | Ga0097620_100087451 | 3300006931 | Bacteria | 3164 |
| 149 | Ga0097620_103068391 | 3300006931 | Bacteria | 510 |
| 150 | Ga0075435_100063828 | 3300007076 | Bacteria | 2991 |
| 151 | Ga0075435_101152611 | 3300007076 | Bacteria | 678 |
| 152 | Ga0099794_10204513 | 3300007265 | Bacteria | 1012 |
| 153 | Ga0099795_10004091 | 3300007788 | Bacteria | 3717 |
| 154 | Ga0099795_10520025 | 3300007788 | Bacteria | 557 |
| 155 | Ga0105250_10383631 | 3300009092 | Bacteria | 620 |
| 156 | Ga0105240_10041196 | 3300009093 | Bacteria | 5897 |
| 157 | Ga0105240_10226885 | 3300009093 | Bacteria | 2173 |
| 158 | Ga0105240_10330513 | 3300009093 | Bacteria | 1735 |
| 159 | Ga0105240_10350020 | 3300009093 | Bacteria | 1676 |
| 160 | Ga0105240_10669165 | 3300009093 | Bacteria | 1136 |
| 161 | Ga0105240_10887408 | 3300009093 | Bacteria | 960 |
| 162 | Ga0105240_11323701 | 3300009093 | Bacteria | 759 |
| 163 | Ga0111539_10434078 | 3300009094 | Bacteria | 1529 |
| 164 | Ga0111539_12823958 | 3300009094 | Bacteria | 562 |
| 165 | Ga0105245_10203960 | 3300009098 | Bacteria | 1900 |
| 166 | Ga0105245_11456449 | 3300009098 | Bacteria | 735 |
| 167 | Ga0105247_10549629 | 3300009101 | Bacteria | 849 |
| 168 | Ga0105247_11676759 | 3300009101 | Bacteria | 525 |
| 169 | Ga0105243_11013740 | 3300009148 | Bacteria | 834 |
| 170 | Ga0105241_10916449 | 3300009174 | Bacteria | 815 |
| 171 | Ga0105242_10464400 | 3300009176 | Bacteria | 1196 |
| 172 | Ga0105248_10250080 | 3300009177 | Bacteria | 1995 |
| 173 | Ga0105237_10167177 | 3300009545 | Bacteria | 2198 |
| 174 | Ga0105237_11035124 | 3300009545 | Bacteria | 828 |
| 175 | Ga0105237_11222290 | 3300009545 | Bacteria | 758 |
| 176 | Ga0105238_10057501 | 3300009551 | Bacteria | 3899 |
| 177 | Ga0105238_10196387 | 3300009551 | Bacteria | 1994 |
| 178 | Ga0105238_10219118 | 3300009551 | Bacteria | 1879 |
| 179 | Ga0105238_11605360 | 3300009551 | Bacteria | 680 |
| 180 | Ga0105238_12974812 | 3300009551 | Bacteria | 509 |
| 181 | Ga0105035_101266 | 3300009988 | Bacteria | 1721 |
| 182 | Ga0099796_10003440 | 3300010159 | Bacteria | 3673 |
| 183 | Ga0105239_10853651 | 3300010375 | Bacteria | 1044 |
| 184 | Ga0105239_11038259 | 3300010375 | Bacteria | 943 |
| 185 | Ga0105239_11050471 | 3300010375 | Bacteria | 937 |
| 186 | Ga0105239_11437621 | 3300010375 | Unclassified | 796 |
| 187 | Ga0105239_11602060 | 3300010375 | Bacteria | 753 |
| 188 | Ga0105239_13249760 | 3300010375 | Bacteria | 529 |
| 189 | Ga0157373_10066839 | 3300013100 | Bacteria | 2542 |
| 190 | Ga0157373_10102685 | 3300013100 | Bacteria | 2012 |
| 191 | Ga0157373_10573386 | 3300013100 | Bacteria | 820 |
| 192 | Ga0157371_10117854 | 3300013102 | Bacteria | 1887 |
| 193 | Ga0157371_10415541 | 3300013102 | Bacteria | 986 |
| 194 | Ga0157370_10019744 | 3300013104 | Bacteria | 6746 |
| 195 | Ga0157370_10410267 | 3300013104 | Bacteria | 1246 |
| 196 | Ga0157370_10625503 | 3300013104 | Bacteria | 985 |
| 197 | Ga0157369_10020086 | 3300013105 | Bacteria | 7471 |
| 198 | Ga0157369_10350166 | 3300013105 | Bacteria | 1534 |
| 199 | Ga0157369_10459304 | 3300013105 | Bacteria | 1318 |
| 200 | Ga0157374_10151595 | 3300013296 | Bacteria | 2254 |
| 201 | Ga0157374_10395854 | 3300013296 | Bacteria | 1377 |
| 202 | Ga0157374_10624215 | 3300013296 | Bacteria | 1089 |
| 203 | Ga0157374_11286931 | 3300013296 | Bacteria | 753 |
| 204 | Ga0157374_11443990 | 3300013296 | Bacteria | 711 |
| 205 | Ga0157378_10092332 | 3300013297 | Bacteria | 2754 |
| 206 | Ga0157378_10323498 | 3300013297 | Bacteria | 1499 |
| 207 | Ga0157378_11545918 | 3300013297 | Bacteria | 709 |
| 208 | Ga0157378_12295875 | 3300013297 | Bacteria | 591 |
| 209 | Ga0157372_10137200 | 3300013307 | Bacteria | 2817 |
| 210 | Ga0157372_12696930 | 3300013307 | Bacteria | 570 |
| 211 | Ga0157375_12163476 | 3300013308 | Bacteria | 662 |
| 212 | Ga0157375_12797947 | 3300013308 | Bacteria | 583 |
| 213 | Ga0157515_116762 | 3300013875 | Bacteria | 940 |
| 214 | Ga0163163_10083133 | 3300014325 | Bacteria | 3206 |
| 215 | Ga0163163_10840000 | 3300014325 | Bacteria | 982 |
| 216 | Ga0163163_11891514 | 3300014325 | Bacteria | 657 |
| 217 | Ga0157380_11837932 | 3300014326 | Bacteria | 665 |
| 218 | Ga0182008_10395070 | 3300014497 | Bacteria | 742 |
| 219 | Ga0182008_10550526 | 3300014497 | Bacteria | 641 |
| 220 | Ga0157379_10884466 | 3300014968 | Bacteria | 847 |
| 221 | Ga0157379_11393208 | 3300014968 | Bacteria | 679 |
| 222 | Ga0157379_12532557 | 3300014968 | Bacteria | 513 |
| 223 | Ga0157379_12563752 | 3300014968 | Bacteria | 510 |
| 224 | Ga0163161_10594122 | 3300017792 | Bacteria | 912 |
| 225 | Ga0197907_11228939 | 3300020069 | Bacteria | 741 |
| 226 | Ga0206355_1585110 | 3300020076 | Bacteria | 603 |
| 227 | Ga0206353_11950597 | 3300020082 | Bacteria | 804 |
| 228 | Ga0154015_1267117 | 3300020610 | Bacteria | 535 |
| 229 | Ga0213873_10056701 | 3300021358 | Bacteria | 1051 |
| 230 | Ga0213872_10056033 | 3300021361 | Bacteria | 1786 |
| 231 | Ga0213872_10242688 | 3300021361 | Bacteria | 761 |
| 232 | Ga0213874_10018944 | 3300021377 | Bacteria | 1867 |
| 233 | Ga0213876_10226281 | 3300021384 | Bacteria | 994 |
| 234 | Ga0213875_10000253 | 3300021388 | Bacteria | 53621 |
| 235 | Ga0213875_10001582 | 3300021388 | Bacteria | 14506 |
| 236 | Ga0213875_10056169 | 3300021388 | Bacteria | 1844 |
| 237 | Ga0213875_10123940 | 3300021388 | Bacteria | 1207 |
| 238 | Ga0213871_10003685 | 3300021441 | Bacteria | 2987 |
| 239 | Ga0213871_10010990 | 3300021441 | Bacteria | 2068 |
| 240 | Ga0213871_10131587 | 3300021441 | Bacteria | 751 |
| 241 | Ga0213871_10172580 | 3300021441 | Bacteria | 666 |
| 242 | Ga0213871_10205762 | 3300021441 | Bacteria | 615 |
| 243 | Ga0224712_10050002 | 3300022467 | Bacteria | 1622 |
| 244 | Ga0209676_1000256 | 3300025292 | Bacteria | 112819 |
| 245 | Ga0209050_1011492 | 3300025298 | Bacteria | 4188 |
| 246 | Ga0207426_1026821 | 3300025302 | Bacteria | 1925 |
| 247 | Ga0207426_1049303 | 3300025302 | Bacteria | 1261 |
| 248 | Ga0207697_10195581 | 3300025315 | Bacteria | 888 |
| 249 | Ga0207697_10319707 | 3300025315 | Bacteria | 689 |
| 250 | Ga0207656_10102313 | 3300025321 | Bacteria | 1315 |
| 251 | Ga0207653_10034017 | 3300025885 | Bacteria | 1654 |
| 252 | Ga0207692_10262871 | 3300025898 | Bacteria | 1038 |
| 253 | Ga0207692_10704860 | 3300025898 | Bacteria | 655 |
| 254 | Ga0207642_11054872 | 3300025899 | Bacteria | 524 |
| 255 | Ga0207710_10621855 | 3300025900 | Bacteria | 565 |
| 256 | Ga0207688_10078557 | 3300025901 | Bacteria | 1881 |
| 257 | Ga0207680_10515880 | 3300025903 | Bacteria | 852 |
| 258 | Ga0207647_10134893 | 3300025904 | Bacteria | 1449 |
| 259 | Ga0207647_10374812 | 3300025904 | Bacteria | 804 |
| 260 | Ga0207699_10089415 | 3300025906 | Bacteria | 1930 |
| 261 | Ga0207699_10105476 | 3300025906 | Bacteria | 1797 |
| 262 | Ga0207699_10272901 | 3300025906 | Bacteria | 1172 |
| 263 | Ga0207645_10817055 | 3300025907 | Bacteria | 634 |
| 264 | Ga0207643_10450241 | 3300025908 | Bacteria | 819 |
| 265 | Ga0207705_10099719 | 3300025909 | Bacteria | 2136 |
| 266 | Ga0207705_10150357 | 3300025909 | Bacteria | 1745 |
| 267 | Ga0207684_10271395 | 3300025910 | Bacteria | 1463 |
| 268 | Ga0207684_10572679 | 3300025910 | Bacteria | 965 |
| 269 | Ga0207684_11177093 | 3300025910 | Bacteria | 635 |
| 270 | Ga0207707_10015024 | 3300025912 | Bacteria | 6742 |
| 271 | Ga0207707_10183121 | 3300025912 | Bacteria | 1828 |
| 272 | Ga0207707_10253734 | 3300025912 | Bacteria | 1527 |
| 273 | Ga0207707_10261457 | 3300025912 | Bacteria | 1502 |
| 274 | Ga0207707_10375367 | 3300025912 | Bacteria | 1223 |
| 275 | Ga0207695_10234562 | 3300025913 | Bacteria | 1738 |
| 276 | Ga0207695_10243724 | 3300025913 | Bacteria | 1698 |
| 277 | Ga0207695_10270929 | 3300025913 | Bacteria | 1593 |
| 278 | Ga0207695_10442983 | 3300025913 | Bacteria | 1182 |
| 279 | Ga0207671_10244839 | 3300025914 | Bacteria | 1409 |
| 280 | Ga0207671_11538467 | 3300025914 | Bacteria | 513 |
| 281 | Ga0207693_10001602 | 3300025915 | Bacteria | 20022 |
| 282 | Ga0207693_10005635 | 3300025915 | Bacteria | 10413 |
| 283 | Ga0207693_10033797 | 3300025915 | Bacteria | 4034 |
| 284 | Ga0207693_10067257 | 3300025915 | Bacteria | 2805 |
| 285 | Ga0207693_10305738 | 3300025915 | Bacteria | 1245 |
| 286 | Ga0207693_10828333 | 3300025915 | Bacteria | 712 |
| 287 | Ga0207663_10036453 | 3300025916 | Bacteria | 2959 |
| 288 | Ga0207663_10252127 | 3300025916 | Bacteria | 1299 |
| 289 | Ga0207663_10433005 | 3300025916 | Bacteria | 1011 |
| 290 | Ga0207663_10518933 | 3300025916 | Bacteria | 928 |
| 291 | Ga0207660_10090086 | 3300025917 | Bacteria | 2272 |
| 292 | Ga0207660_10153117 | 3300025917 | Bacteria | 1773 |
| 293 | Ga0207660_10281049 | 3300025917 | Bacteria | 1321 |
| 294 | Ga0207660_10514987 | 3300025917 | Bacteria | 971 |
| 295 | Ga0207660_10784176 | 3300025917 | Bacteria | 778 |
| 296 | Ga0207662_10675507 | 3300025918 | Bacteria | 723 |
| 297 | Ga0207657_10310018 | 3300025919 | Bacteria | 1249 |
| 298 | Ga0207657_11514352 | 3300025919 | Bacteria | 501 |
| 299 | Ga0207649_10069979 | 3300025920 | Bacteria | 2236 |
| 300 | Ga0207652_10036904 | 3300025921 | Bacteria | 4133 |
| 301 | Ga0207652_10111086 | 3300025921 | Bacteria | 2431 |
| 302 | Ga0207652_10152348 | 3300025921 | Bacteria | 2071 |
| 303 | Ga0207652_10202211 | 3300025921 | Bacteria | 1788 |
| 304 | Ga0207652_10995018 | 3300025921 | Bacteria | 737 |
| 305 | Ga0207652_11020728 | 3300025921 | Bacteria | 726 |
| 306 | Ga0207652_11616747 | 3300025921 | Bacteria | 552 |
| 307 | Ga0207646_11071323 | 3300025922 | Bacteria | 710 |
| 308 | Ga0207681_10645849 | 3300025923 | Bacteria | 877 |
| 309 | Ga0207694_10262322 | 3300025924 | Bacteria | 1415 |
| 310 | Ga0207694_10584148 | 3300025924 | Bacteria | 939 |
| 311 | Ga0207694_10932248 | 3300025924 | Bacteria | 734 |
| 312 | Ga0207659_10096793 | 3300025926 | Bacteria | 2216 |
| 313 | Ga0207687_10379221 | 3300025927 | Bacteria | 1158 |
| 314 | Ga0207700_10073917 | 3300025928 | Bacteria | 2634 |
| 315 | Ga0207700_10123102 | 3300025928 | Bacteria | 2106 |
| 316 | Ga0207700_10294079 | 3300025928 | Bacteria | 1400 |
| 317 | Ga0207700_10622409 | 3300025928 | Bacteria | 961 |
| 318 | Ga0207700_11322383 | 3300025928 | Bacteria | 642 |
| 319 | Ga0207700_11704458 | 3300025928 | Bacteria | 556 |
| 320 | Ga0207664_10014469 | 3300025929 | Bacteria | 5698 |
| 321 | Ga0207664_10971621 | 3300025929 | Bacteria | 761 |
| 322 | Ga0207664_11382384 | 3300025929 | Bacteria | 624 |
| 323 | Ga0207664_11760750 | 3300025929 | Bacteria | 542 |
| 324 | Ga0207664_11879993 | 3300025929 | Bacteria | 521 |
| 325 | Ga0207644_10433186 | 3300025931 | Bacteria | 1079 |
| 326 | Ga0207644_11107021 | 3300025931 | Bacteria | 666 |
| 327 | Ga0207644_11756465 | 3300025931 | Bacteria | 519 |
| 328 | Ga0207690_10087281 | 3300025932 | Bacteria | 2195 |
| 329 | Ga0207690_11767929 | 3300025932 | Bacteria | 516 |
| 330 | Ga0207706_11450020 | 3300025933 | Bacteria | 562 |
| 331 | Ga0207686_10907029 | 3300025934 | Bacteria | 711 |
| 332 | Ga0207670_10330746 | 3300025936 | Bacteria | 1201 |
| 333 | Ga0207670_10439093 | 3300025936 | Bacteria | 1050 |
| 334 | Ga0207669_10223824 | 3300025937 | Bacteria | 1383 |
| 335 | Ga0207669_11591070 | 3300025937 | Bacteria | 558 |
| 336 | Ga0207704_11907057 | 3300025938 | Bacteria | 511 |
| 337 | Ga0207665_10272026 | 3300025939 | Bacteria | 1258 |
| 338 | Ga0207665_10445632 | 3300025939 | Bacteria | 993 |
| 339 | Ga0207691_10568881 | 3300025940 | Bacteria | 960 |
| 340 | Ga0207691_10618568 | 3300025940 | Bacteria | 916 |
| 341 | Ga0207661_12140621 | 3300025944 | Bacteria | 505 |
| 342 | Ga0207679_10094505 | 3300025945 | Bacteria | 2321 |
| 343 | Ga0207679_10630758 | 3300025945 | Bacteria | 968 |
| 344 | Ga0207679_10893511 | 3300025945 | Bacteria | 812 |
| 345 | Ga0207667_10021411 | 3300025949 | Bacteria | 7165 |
| 346 | Ga0207667_10330034 | 3300025949 | Bacteria | 1557 |
| 347 | Ga0207667_10858444 | 3300025949 | Bacteria | 902 |
| 348 | Ga0207651_10668400 | 3300025960 | Bacteria | 913 |
| 349 | Ga0207651_11490695 | 3300025960 | Bacteria | 609 |
| 350 | Ga0207640_10112810 | 3300025981 | Bacteria | 1931 |
| 351 | Ga0207640_10173737 | 3300025981 | Bacteria | 1608 |
| 352 | Ga0207640_10713513 | 3300025981 | Bacteria | 861 |
| 353 | Ga0207640_11066982 | 3300025981 | Bacteria | 713 |
| 354 | Ga0207677_10423435 | 3300026023 | Bacteria | 1135 |
| 355 | Ga0207677_10888627 | 3300026023 | Bacteria | 803 |
| 356 | Ga0207703_10444773 | 3300026035 | Bacteria | 1210 |
| 357 | Ga0207639_11933471 | 3300026041 | Bacteria | 551 |
| 358 | Ga0207708_10626029 | 3300026075 | Bacteria | 914 |
| 359 | Ga0207708_12036747 | 3300026075 | Bacteria | 502 |
| 360 | Ga0207702_10119240 | 3300026078 | Bacteria | 2359 |
| 361 | Ga0207702_10143221 | 3300026078 | Bacteria | 2166 |
| 362 | Ga0207702_10213966 | 3300026078 | Bacteria | 1793 |
| 363 | Ga0207702_11381849 | 3300026078 | Bacteria | 698 |
| 364 | Ga0207702_11539940 | 3300026078 | Bacteria | 658 |
| 365 | Ga0207702_11651298 | 3300026078 | Bacteria | 634 |
| 366 | Ga0207641_11177140 | 3300026088 | Bacteria | 766 |
| 367 | Ga0207648_10527645 | 3300026089 | Bacteria | 1082 |
| 368 | Ga0207648_10701061 | 3300026089 | Bacteria | 938 |
| 369 | Ga0207676_10607945 | 3300026095 | Bacteria | 1051 |
| 370 | Ga0207676_10999404 | 3300026095 | Bacteria | 824 |
| 371 | Ga0207674_10177351 | 3300026116 | Bacteria | 2083 |
| 372 | Ga0207674_11213394 | 3300026116 | Bacteria | 724 |
| 373 | Ga0207674_11495557 | 3300026116 | Bacteria | 644 |
| 374 | Ga0207675_100916825 | 3300026118 | Bacteria | 893 |
| 375 | Ga0207683_10116426 | 3300026121 | Bacteria | 2396 |
| 376 | Ga0207683_10374681 | 3300026121 | Bacteria | 1308 |
| 377 | Ga0207698_11233143 | 3300026142 | Bacteria | 762 |
| 378 | Ga0209813_10031933 | 3300027866 | Bacteria | 1557 |
| 379 | Ga0207428_10665262 | 3300027907 | Bacteria | 747 |
| 380 | Ga0268266_10011062 | 3300028379 | Bacteria | 7857 |
| 381 | Ga0268266_10883551 | 3300028379 | Bacteria | 864 |
| 382 | Ga0268265_11067695 | 3300028380 | Bacteria | 800 |
| 383 | Ga0268264_12689801 | 3300028381 | Bacteria | 501 |
| 384 | Ga0307517_10008012 | 3300028786 | Bacteria | 15244 |
| 385 | Ga0265338_10110497 | 3300028800 | Bacteria | 2215 |
| 386 | Ga0265764_114217 | 3300030882 | Bacteria | 537 |
| 387 | Ga0265332_10080306 | 3300031238 | Bacteria | 1384 |
| 388 | Ga0265340_10331267 | 3300031247 | Bacteria | 673 |
| 389 | Ga0265340_10428710 | 3300031247 | Bacteria | 583 |
| 390 | Ga0265339_10244811 | 3300031249 | Bacteria | 870 |
| 391 | Ga0265339_10306235 | 3300031249 | Bacteria | 757 |
| 392 | Ga0265327_10016206 | 3300031251 | Bacteria | 4752 |
| 393 | Ga0265327_10077979 | 3300031251 | Bacteria | 1642 |
| 394 | Ga0265316_10155618 | 3300031344 | Bacteria | 1711 |
| 395 | Ga0307513_10453174 | 3300031456 | Bacteria | 1007 |
| 396 | Ga0265313_10068075 | 3300031595 | Bacteria | 1646 |
| 397 | Ga0265314_10224550 | 3300031711 | Bacteria | 1094 |
| 398 | Ga0265342_10131690 | 3300031712 | Bacteria | 1401 |
| 399 | Ga0307406_11266050 | 3300031901 | Bacteria | 643 |
| 400 | Ga0307412_10780127 | 3300031911 | Bacteria | 828 |
| 401 | Ga0307409_101551262 | 3300031995 | Bacteria | 690 |
| 402 | Ga0307416_100434725 | 3300032002 | Bacteria | 1361 |
| 403 | Ga0316053_108997 | 3300032120 | Bacteria | 681 |
| 404 | Ga0373926_0138843 | 3300035083 | Bacteria | 923 |
| 405 | Ga0373940_0354956 | 3300035088 | Bacteria | 515 |
| 406 | Ga0373944_0248171 | 3300035089 | Bacteria | 656 |
| 407 | Ga0373952_0224197 | 3300035092 | Bacteria | 560 |
| 408 | Ga0373932_0272048 | 3300035112 | Bacteria | 624 |
| 409 | Ga0373936_0046845 | 3300035113 | Bacteria | 1743 |
| 410 | Ga0373936_0400881 | 3300035113 | Bacteria | 630 |
| 411 | Ga0373941_0163214 | 3300035115 | Bacteria | 825 |
| 412 | Ga0373945_0165035 | 3300035116 | Bacteria | 905 |
| 413 | Ga0373945_0343941 | 3300035116 | Bacteria | 646 |
| 414 | Ga0373945_0471102 | 3300035116 | Bacteria | 557 |
| 415 | Ga0373953_0023627 | 3300035117 | Bacteria | 2328 |
| 416 | Ga0373954_0063587 | 3300035118 | Bacteria | 1744 |
| 417 | Ga0373956_0119709 | 3300035119 | Bacteria | 1229 |
| 418 | Ga0373957_0255623 | 3300035120 | Bacteria | 738 |
| 419 | Ga0373957_0490840 | 3300035120 | Bacteria | 534 |
| 420 | Ga0373957_0504062 | 3300035120 | Bacteria | 527 |
| 421 | Ga0373943_0066903 | 3300035170 | Bacteria | 1811 |
| 422 | Ga0373943_0526444 | 3300035170 | Bacteria | 692 |
| 423 | Ga0373946_0343762 | 3300035171 | Bacteria | 745 |
| 424 | Ga0373946_0515281 | 3300035171 | Bacteria | 614 |
| 425 | Ga0373955_0029777 | 3300035172 | Bacteria | 2843 |
| 426 | Ga0373955_0042579 | 3300035172 | Bacteria | 2439 |
| 427 | Ga0373955_0144379 | 3300035172 | Bacteria | 1397 |
| 428 | Ga0373955_0306388 | 3300035172 | Bacteria | 958 |
| 429 | Ga0373955_0578731 | 3300035172 | Bacteria | 687 |
| 430 | Ga0373955_0675506 | 3300035172 | Bacteria | 634 |
| 431 | Ga0373942_0112719 | 3300035207 | Bacteria | 842 |
| 432 | Ga0373924_0026438 | 3300035410 | Bacteria | 2302 |
| 433 | Ga0373924_0142703 | 3300035410 | Bacteria | 1045 |
| 434 | Ga0373931_0574963 | 3300035691 | Bacteria | 734 |
| 435 | Ga0373931_0810819 | 3300035691 | Bacteria | 625 |
| 436 | Ga0373935_0279179 | 3300035692 | Bacteria | 1176 |
| 437 | Ga0373935_0331225 | 3300035692 | Bacteria | 1082 |
| 438 | Ga0373927_0051388 | 3300035695 | Bacteria | 2665 |
| 439 | Ga0373927_0136058 | 3300035695 | Bacteria | 1606 |
| 440 | Ga0373927_0235275 | 3300035695 | Bacteria | 1204 |
| 441 | Ga0373927_0949559 | 3300035695 | Bacteria | 567 |
| 442 | Ga0373927_1087803 | 3300035695 | Bacteria | 527 |
| 443 | Ga0373927_1177878 | 3300035695 | Bacteria | 505 |
| 444 | Ga0373933_0023266 | 3300035724 | Bacteria | 3538 |
| 445 | Ga0373933_0025398 | 3300035724 | Bacteria | 3397 |
| 446 | Ga0373933_0036405 | 3300035724 | Bacteria | 2880 |
| 447 | Ga0373933_0352553 | 3300035724 | Bacteria | 956 |
| 448 | Ga0373947_0063328 | 3300035725 | Bacteria | 2253 |
| 449 | Ga0373947_0113888 | 3300035725 | Bacteria | 1712 |
| 450 | Ga0373947_0380510 | 3300035725 | Bacteria | 950 |
| 451 | Ga0373947_0723966 | 3300035725 | Bacteria | 679 |
| 452 | Ga0373937_0002848 | 3300036401 | Bacteria | 14448 |
| 453 | Ga0373937_0013547 | 3300036401 | Bacteria | 7182 |
| 454 | Ga0373937_0033495 | 3300036401 | Bacteria | 4666 |
| 455 | Ga0373937_0039758 | 3300036401 | Bacteria | 4286 |
| 456 | Ga0373937_0067697 | 3300036401 | Bacteria | 3291 |
| 457 | Ga0373937_0227153 | 3300036401 | Bacteria | 1757 |
| 458 | Ga0373937_0307786 | 3300036401 | Bacteria | 1498 |
| 459 | Ga0373937_0625329 | 3300036401 | Bacteria | 1022 |
| 460 | Ga0373925_0094048 | 3300037068 | Bacteria | 2295 |
| 461 | Ga0373925_0257352 | 3300037068 | Bacteria | 1401 |
| 462 | Ga0373925_0418843 | 3300037068 | Bacteria | 1094 |
| 463 | Ga0395899_0012914 | 3300037312 | Bacteria | 6392 |
| 464 | Ga0395899_0018107 | 3300037312 | Bacteria | 5360 |
| 465 | Ga0395900_0041556 | 3300037418 | Bacteria | 4740 |
| 466 | Ga0395900_0063433 | 3300037418 | Bacteria | 3798 |
| 467 | Ga0395900_0183837 | 3300037418 | Bacteria | 2122 |
| 468 | Ga0395900_0785651 | 3300037418 | Bacteria | 881 |
| 469 | Ga0395900_0828111 | 3300037418 | Bacteria | 852 |
| 470 | Ga0395900_1000555 | 3300037418 | Bacteria | 756 |
| 471 | Ga0395898_0007528 | 3300037466 | Bacteria | 11573 |
| 472 | Ga0395898_0009732 | 3300037466 | Bacteria | 10080 |
| 473 | Ga0395905_0125747 | 3300037471 | Bacteria | 2411 |
| 474 | Ga0395905_0387326 | 3300037471 | Bacteria | 1292 |
| 475 | Ga0395905_0526040 | 3300037471 | Bacteria | 1083 |
| 476 | Ga0436364_0266271 | 3300037853 | Bacteria | 210347 |
| 477 | Ga0436364_0278369 | 3300037853 | Bacteria | 585 |
| 478 | Ga0436364_0503141 | 3300037853 | Bacteria | 962 |
| 479 | Ga0436364_0574986 | 3300037853 | Bacteria | 2579 |
| 480 | Ga0436364_0694410 | 3300037853 | Bacteria | 38233 |
| 481 | Ga0436364_0921350 | 3300037853 | Bacteria | 1284 |
| 482 | Ga0436364_1344478 | 3300037853 | Bacteria | 3078 |
| 483 | Ga0395901_0010972 | 3300038443 | Bacteria | 9178 |
| 484 | Ga0395901_0029475 | 3300038443 | Bacteria | 5651 |
| 485 | Ga0395901_0909090 | 3300038443 | Bacteria | 861 |
| 486 | Ga0395901_1771223 | 3300038443 | Bacteria | 567 |
| 487 | Ga0436365_0349736 | 3300039437 | Bacteria | 598 |
| 488 | Ga0436365_0472578 | 3300039437 | Bacteria | 627 |
| 489 | Ga0436365_0762128 | 3300039437 | Bacteria | 1687 |
| 490 | Ga0436365_1270328 | 3300039437 | Bacteria | 771 |
| 491 | Ga0436365_1498663 | 3300039437 | Bacteria | 1107 |
| 492 | Ga0436365_1607597 | 3300039437 | Bacteria | 938 |
| 493 | Ga0436365_1691575 | 3300039437 | Bacteria | 2097 |
| 494 | Ga0436365_1717840 | 3300039437 | Bacteria | 1782 |
| 495 | Ga0436360_0107958 | 3300039438 | Bacteria | 2399 |
| 496 | Ga0436360_0185552 | 3300039438 | Bacteria | 992 |
| 497 | Ga0436360_0213506 | 3300039438 | Bacteria | 3259 |
| 498 | Ga0436360_0220240 | 3300039438 | Bacteria | 1763 |
| 499 | Ga0436360_0362032 | 3300039438 | Bacteria | 15021 |
| 500 | Ga0436360_0523890 | 3300039438 | Bacteria | 604 |
| 501 | Ga0436360_0532696 | 3300039438 | Bacteria | 1681 |
| 502 | Ga0436360_0544531 | 3300039438 | Bacteria | 1599 |
| 503 | Ga0436360_0722676 | 3300039438 | Bacteria | 1222 |
| 504 | Ga0436360_0811977 | 3300039438 | Bacteria | 3564 |
| 505 | Ga0436360_0846745 | 3300039438 | Bacteria | 926 |
| 506 | Ga0436360_0890298 | 3300039438 | Bacteria | 1199 |
| 507 | Ga0436360_1217323 | 3300039438 | Bacteria | 640 |
| 508 | Ga0436361_0160412 | 3300039447 | Bacteria | 1902 |
| 509 | Ga0436361_0349372 | 3300039447 | Bacteria | 4018 |
| 510 | Ga0436361_0459654 | 3300039447 | Bacteria | 893 |
| 511 | Ga0436361_0548464 | 3300039447 | Bacteria | 2385 |
| 512 | Ga0436361_1087383 | 3300039447 | Bacteria | 1358 |
| 513 | Ga0436363_0206965 | 3300039450 | Bacteria | 653 |
| 514 | Ga0436363_0724362 | 3300039450 | Bacteria | 1110 |
| 515 | Ga0436363_1670359 | 3300039450 | Bacteria | 553 |
| 516 | Ga0436363_1712732 | 3300039450 | Bacteria | 617 |
| 517 | Ga0436362_0310010 | 3300039453 | Bacteria | 633 |
| 518 | Ga0436362_0552323 | 3300039453 | Bacteria | 1185 |
| 519 | Ga0436362_0619579 | 3300039453 | Bacteria | 1158 |
| 520 | Ga0436362_1230386 | 3300039453 | Bacteria | 709 |
| 521 | Ga0436362_1243951 | 3300039453 | Bacteria | 1260 |
| 522 | Ga0439447_000506 | 3300041407 | Bacteria | 14503 |
| 523 | Ga0439461_0144147 | 3300041410 | Bacteria | 611 |
| 524 | Ga0439466_0003497 | 3300041411 | Bacteria | 6084 |
| 525 | Ga0451789_0587692 | 3300041443 | Bacteria | 669 |
| 526 | Ga0451845_0099901 | 3300041501 | Bacteria | 642 |
| 527 | Ga0439448_0038023 | 3300042005 | Bacteria | 1548 |
| 528 | Ga0439432_201494 | 3300042006 | Bacteria | 577 |
| 529 | Ga0439452_000097 | 3300042010 | Bacteria | 74034 |
| 530 | Ga0450902_012822 | 3300042137 | Bacteria | 1345 |
| 531 | Ga0450905_039778 | 3300042142 | Bacteria | 745 |
| 532 | Ga0466972_0455923 | 3300044658 | Bacteria | 601 |
| 533 | Ga0466966_0968959 | 3300044684 | Bacteria | 513 |
| 534 | Ga0466963_0475424 | 3300044694 | Bacteria | 882 |
| 535 | Ga0466963_0680755 | 3300044694 | Bacteria | 726 |
| 536 | Ga0466963_0843482 | 3300044694 | Bacteria | 646 |
| 537 | Ga0466970_0496133 | 3300044765 | Bacteria | 703 |
| 538 | Ga0466957_0164205 | 3300044842 | Bacteria | 1444 |
| 539 | Ga0451576_0002195 | 3300045051 | Bacteria | 30092 |
| 540 | Ga0466958_0447755 | 3300045836 | Bacteria | 836 |
| 541 | Ga0466967_0394288 | 3300045976 | Bacteria | 1346 |
| 542 | Ga0466967_1395781 | 3300045976 | Bacteria | 698 |
| 543 | Ga0466967_2313715 | 3300045976 | Bacteria | 533 |
| 544 | Ga0495592_0566504 | 3300046454 | Bacteria | 697 |
| 545 | Ga0495651_0135202 | 3300046462 | Bacteria | 1795 |
| 546 | Ga0495651_0283741 | 3300046462 | Bacteria | 1117 |
| 547 | Ga0495650_0068027 | 3300046471 | Bacteria | 1406 |
| 548 | Ga0495580_0529932 | 3300046472 | Bacteria | 784 |
| 549 | Ga0495608_0004971 | 3300046511 | Bacteria | 9513 |
| 550 | Ga0495608_0035177 | 3300046511 | Bacteria | 3380 |
| 551 | Ga0495618_0159236 | 3300046514 | Bacteria | 1440 |
| 552 | Ga0495628_0128019 | 3300046516 | Bacteria | 1944 |
| 553 | Ga0495628_0144741 | 3300046516 | Bacteria | 1812 |
| 554 | Ga0495652_0112773 | 3300046529 | Bacteria | 2183 |
| 555 | Ga0495652_0210142 | 3300046529 | Bacteria | 1470 |
| 556 | Ga0495640_0899280 | 3300046533 | Bacteria | 525 |
| 557 | Ga0495587_0044169 | 3300046536 | Bacteria | 2651 |
| 558 | Ga0495587_0047441 | 3300046536 | Bacteria | 2547 |
| 559 | Ga0495667_0018054 | 3300046559 | Bacteria | 4766 |
| 560 | Ga0495667_0019733 | 3300046559 | Bacteria | 4549 |
| 561 | Ga0495625_0818647 | 3300046660 | Bacteria | 540 |
| 562 | Ga0495635_0228593 | 3300046663 | Bacteria | 1257 |
| 563 | Ga0495635_0758946 | 3300046663 | Bacteria | 627 |
| 564 | Ga0495657_0383813 | 3300046675 | Bacteria | 828 |
| 565 | Ga0495599_0010184 | 3300046678 | Bacteria | 5755 |
| 566 | Ga0495599_0078299 | 3300046678 | Bacteria | 2064 |
| 567 | Ga0495599_0447527 | 3300046678 | Bacteria | 765 |
| 568 | Ga0495623_0139254 | 3300046679 | Bacteria | 1445 |
| 569 | Ga0495646_0064683 | 3300046680 | Bacteria | 2167 |
| 570 | Ga0495647_0288331 | 3300046681 | Bacteria | 738 |
| 571 | Ga0495658_1098178 | 3300046683 | Bacteria | 507 |
| 572 | Ga0495600_0137659 | 3300046809 | Bacteria | 1585 |
| 573 | Ga0495600_0236438 | 3300046809 | Bacteria | 1165 |
| 574 | Ga0495674_0162896 | 3300047319 | Bacteria | 1865 |
| 575 | Ga0495674_0211242 | 3300047319 | Bacteria | 1607 |
| 576 | Ga0495674_0898905 | 3300047319 | Bacteria | 684 |
| 577 | Ga0495680_0051468 | 3300047322 | Bacteria | 3215 |
| 578 | Ga0495680_0355063 | 3300047322 | Bacteria | 1020 |
| 579 | Ga0495675_0043815 | 3300047444 | Bacteria | 2850 |
| 580 | Ga0495684_0838773 | 3300047471 | Bacteria | 597 |
| 581 | Ga0495602_0000143 | 3300048088 | Bacteria | 66782 |
| 582 | Ga0495602_0302086 | 3300048088 | Bacteria | 1171 |
| 583 | Ga0496109_0897786 | 3300048912 | Bacteria | 824 |
| 584 | Ga0496112_0422058 | 3300048915 | Bacteria | 1273 |
| 585 | Ga0496115_0160603 | 3300048918 | Bacteria | 1857 |
| 586 | Ga0496115_1070106 | 3300048918 | Bacteria | 613 |
| 587 | Ga0496121_0856313 | 3300048924 | Bacteria | 528 |
| 588 | Ga0496122_0194255 | 3300048925 | Bacteria | 1194 |
| 589 | Ga0496126_0070540 | 3300048929 | Bacteria | 3113 |
| 590 | Ga0496126_0747768 | 3300048929 | Bacteria | 755 |
| 591 | Ga0501034_0008484 | 3300049571 | Bacteria | 10852 |
| 592 | Ga0501034_0009970 | 3300049571 | Bacteria | 9928 |
| 593 | Ga0501034_0089449 | 3300049571 | Bacteria | 3077 |
| 594 | Ga0501034_0224902 | 3300049571 | Bacteria | 1828 |
| 595 | Ga0501036_1633522 | 3300049572 | Bacteria | 520 |
| 596 | Ga0501037_0463754 | 3300049573 | Bacteria | 863 |
| 597 | Ga0501038_1104453 | 3300049574 | Bacteria | 579 |
| 598 | Ga0501038_1105179 | 3300049574 | Bacteria | 579 |
| 599 | Ga0501039_1095738 | 3300049575 | Bacteria | 617 |
| 600 | Ga0501041_0485695 | 3300049577 | Bacteria | 785 |
| 601 | Ga0501042_0052983 | 3300049578 | Bacteria | 2895 |
| 602 | Ga0501043_0875651 | 3300049579 | Bacteria | 645 |
| 603 | Ga0501046_0054053 | 3300049580 | Bacteria | 3161 |
| 604 | Ga0501047_0077209 | 3300049581 | Bacteria | 3205 |
| 605 | Ga0501047_0079998 | 3300049581 | Bacteria | 3142 |
| 606 | Ga0501047_0397267 | 3300049581 | Bacteria | 1212 |
| 607 | Ga0501048_0554301 | 3300049582 | Bacteria | 825 |
| 608 | Ga0501048_0873220 | 3300049582 | Bacteria | 647 |
| 609 | Ga0501069_0821800 | 3300049585 | Bacteria | 564 |
| 610 | Ga0501070_0137899 | 3300049586 | Bacteria | 2014 |
| 611 | Ga0501070_0226824 | 3300049586 | Bacteria | 1531 |
| 612 | Ga0501072_0246561 | 3300049588 | Bacteria | 1423 |
| 613 | Ga0501073_0438393 | 3300049589 | Bacteria | 903 |
| 614 | Ga0501075_1320437 | 3300049591 | Bacteria | 547 |
| 615 | Ga0501080_0403010 | 3300049742 | Bacteria | 1230 |
| 616 | Ga0501080_1082269 | 3300049742 | Bacteria | 693 |
| 617 | Ga0501035_0664061 | 3300049822 | Bacteria | 844 |
| 618 | Ga0501035_0872133 | 3300049822 | Bacteria | 715 |
| 619 | Ga0501044_0078024 | 3300049823 | Bacteria | 3357 |
| 620 | Ga0501044_0366907 | 3300049823 | Bacteria | 1357 |
| 621 | Ga0501044_0490192 | 3300049823 | Bacteria | 1131 |
| 622 | Ga0501044_0896576 | 3300049823 | Bacteria | 762 |
| 623 | nmdc:mga03683_19223_c1 | 3300050489 | Bacteria | 2606 |
| 624 | nmdc:mga03683_19340_c1 | 3300050489 | Bacteria | 2599 |
| 625 | nmdc:mga03683_4033_c1 | 3300050489 | Bacteria | 4817 |
| 626 | nmdc:mga03683_73121_c1 | 3300050489 | Bacteria | 1469 |
| 627 | nmdc:mga03n38_168735_c1 | 3300050490 | Bacteria | 1113 |
| 628 | nmdc:mga03n38_474206_c1 | 3300050490 | Bacteria | 699 |
| 629 | nmdc:mga00v17_234283_c1 | 3300050491 | Bacteria | 1190 |
| 630 | nmdc:mga00v17_569299_c1 | 3300050491 | Bacteria | 732 |
| 631 | nmdc:mga00v17_609855_c1 | 3300050491 | Bacteria | 703 |
| 632 | nmdc:mga0yw44_168443_c1 | 3300050492 | Bacteria | 1437 |
| 633 | nmdc:mga0yw44_334275_c1 | 3300050492 | Bacteria | 1018 |
| 634 | nmdc:mga0yw44_4681_c1 | 3300050492 | Bacteria | 6323 |
| 635 | nmdc:mga0yw44_529186_c1 | 3300050492 | Bacteria | 800 |
| 636 | nmdc:mga0k408_24954_c1 | 3300050493 | Bacteria | 3382 |
| 637 | nmdc:mga0k408_259169_c1 | 3300050493 | Bacteria | 1038 |
| 638 | nmdc:mga0k408_342567_c1 | 3300050493 | Bacteria | 891 |
| 639 | nmdc:mga0k408_81371_c1 | 3300050493 | Bacteria | 1896 |
| 640 | nmdc:mga06z11_36298_c1 | 3300050494 | Bacteria | 2433 |
| 641 | nmdc:mga04h51_104065_c1 | 3300050495 | Bacteria | 1038 |
| 642 | nmdc:mga07m45_17798_c1 | 3300050496 | Bacteria | 3823 |
| 643 | nmdc:mga07m45_248769_c1 | 3300050496 | Bacteria | 1034 |
| 644 | nmdc:mga07m45_73212_c1 | 3300050496 | Bacteria | 1950 |
| 645 | nmdc:mga0sz30_201706_c1 | 3300050516 | Bacteria | 883 |
| 646 | nmdc:mga0sz30_29924_c1 | 3300050516 | Bacteria | 1822 |
| 647 | nmdc:mga0sz30_3630_c2 | 3300050516 | Bacteria | 3328 |
| 648 | nmdc:mga0sz30_418493_c1 | 3300050516 | Bacteria | 601 |
| 649 | Ga0495601_0013940 | 3300053077 | Bacteria | 4841 |
| 650 | Ga0495601_0457071 | 3300053077 | Bacteria | 826 |
| 651 | Ga0495601_0738730 | 3300053077 | Bacteria | 627 |
| 652 | Ga0495595_0012504 | 3300053084 | Bacteria | 3570 |
| 653 | Ga0495619_0016874 | 3300053085 | Bacteria | 4624 |
| 654 | Ga0500646_0187259 | 3300053090 | Bacteria | 704 |
| 655 | Ga0500647_0041290 | 3300053091 | Bacteria | 2213 |
| 656 | Ga0500641_0000183 | 3300053096 | Bacteria | 23609 |
| 657 | Ga0500650_0197948 | 3300053098 | Bacteria | 916 |
| 658 | Ga0500642_0012558 | 3300053130 | Bacteria | 3078 |
| 659 | Ga0500559_0059996 | 3300053136 | Bacteria | 1694 |
| 660 | Ga0500573_0367916 | 3300053140 | Unclassified | 692 |
| 661 | Ga0500588_0000178 | 3300053146 | Bacteria | 8711 |
| 662 | Ga0500616_0013458 | 3300053153 | Bacteria | 4748 |
| 663 | Ga0500620_028811 | 3300053155 | Bacteria | 1740 |
| 664 | Ga0500552_000449 | 3300053733 | Bacteria | 3788 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013100 | Ga0157373_10102685 | Ga0157373_101026853 | 105 |
| 2 | 3300041407 | Ga0439447_000506 | Ga0439447_000506_3589_3909 | 105 |
| 3 | 3300041411 | Ga0439466_0003497 | Ga0439466_0003497_4391_4711 | 105 |
| 4 | 3300042006 | Ga0439432_201494 | Ga0439432_201494_173_493 | 105 |
| 5 | 3300042010 | Ga0439452_000097 | Ga0439452_000097_68771_69091 | 105 |
| 6 | 3300042137 | Ga0450902_012822 | Ga0450902_012822_507_827 | 105 |
| 7 | 3300042142 | Ga0450905_039778 | Ga0450905_039778_165_485 | 105 |
| 8 | iso_pu_bacteria | 8054002106 | 8054004624 | 105 |
| 9 | 3300013297 | Ga0157378_10092332 | Ga0157378_100923322 | 106 |
| 10 | 3300028786 | Ga0307517_10008012 | Ga0307517_1000801215 | 106 |
| 11 | 3300039447 | Ga0436361_0160412 | Ga0436361_0160412_325_645 | 106 |
| 12 | 3300046471 | Ga0495650_0068027 | Ga0495650_0068027_726_1055 | 106 |
| 13 | 3300005435 | Ga0070714_100072203 | Ga0070714_1000722034 | 107 |
| 14 | 3300005436 | Ga0070713_100220449 | Ga0070713_1002204493 | 107 |
| 15 | 3300005436 | Ga0070713_100309336 | Ga0070713_1003093362 | 107 |
| 16 | 3300005439 | Ga0070711_100675859 | Ga0070711_1006758592 | 107 |
| 17 | 3300005439 | Ga0070711_101554820 | Ga0070711_1015548202 | 107 |
| 18 | 3300005543 | Ga0070672_101534197 | Ga0070672_1015341972 | 107 |
| 19 | 3300005614 | Ga0068856_100952846 | Ga0068856_1009528462 | 107 |
| 20 | 3300006028 | Ga0070717_10024887 | Ga0070717_100248875 | 107 |
| 21 | 3300006173 | Ga0070716_100193903 | Ga0070716_1001939032 | 107 |
| 22 | 3300006173 | Ga0070716_101176149 | Ga0070716_1011761492 | 107 |
| 23 | 3300006175 | Ga0070712_100049785 | Ga0070712_1000497854 | 107 |
| 24 | 3300006175 | Ga0070712_100435971 | Ga0070712_1004359712 | 107 |
| 25 | 3300007076 | Ga0075435_100063828 | Ga0075435_1000638285 | 107 |
| 26 | 3300009093 | Ga0105240_10669165 | Ga0105240_106691652 | 107 |
| 27 | 3300014497 | Ga0182008_10550526 | Ga0182008_105505262 | 107 |
| 28 | 3300021384 | Ga0213876_10226281 | Ga0213876_102262812 | 107 |
| 29 | 3300025906 | Ga0207699_10089415 | Ga0207699_100894152 | 107 |
| 30 | 3300025906 | Ga0207699_10105476 | Ga0207699_101054762 | 107 |
| 31 | 3300025915 | Ga0207693_10001602 | Ga0207693_1000160218 | 107 |
| 32 | 3300025915 | Ga0207693_10067257 | Ga0207693_100672572 | 107 |
| 33 | 3300025916 | Ga0207663_10036453 | Ga0207663_100364533 | 107 |
| 34 | 3300025916 | Ga0207663_10433005 | Ga0207663_104330052 | 107 |
| 35 | 3300025928 | Ga0207700_10073917 | Ga0207700_100739173 | 107 |
| 36 | 3300025928 | Ga0207700_10123102 | Ga0207700_101231022 | 107 |
| 37 | 3300025928 | Ga0207700_11322383 | Ga0207700_113223832 | 107 |
| 38 | 3300025929 | Ga0207664_10014469 | Ga0207664_100144694 | 107 |
| 39 | 3300025929 | Ga0207664_11879993 | Ga0207664_118799931 | 107 |
| 40 | 3300025931 | Ga0207644_11756465 | Ga0207644_117564652 | 107 |
| 41 | 3300026078 | Ga0207702_11381849 | Ga0207702_113818492 | 107 |
| 42 | 3300026088 | Ga0207641_11177140 | Ga0207641_111771402 | 107 |
| 43 | 3300035116 | Ga0373945_0343941 | Ga0373945_0343941_94_417 | 107 |
| 44 | 3300035120 | Ga0373957_0504062 | Ga0373957_0504062_38_361 | 107 |
| 45 | 3300035172 | Ga0373955_0306388 | Ga0373955_0306388_136_459 | 107 |
| 46 | 3300035692 | Ga0373935_0279179 | Ga0373935_0279179_724_1047 | 107 |
| 47 | 3300035724 | Ga0373933_0023266 | Ga0373933_0023266_3181_3504 | 107 |
| 48 | 3300036401 | Ga0373937_0002848 | Ga0373937_0002848_11839_12162 | 107 |
| 49 | 3300037471 | Ga0395905_0125747 | Ga0395905_0125747_509_832 | 107 |
| 50 | 3300039437 | Ga0436365_1717840 | Ga0436365_1717840_576_899 | 107 |
| 51 | 3300039438 | Ga0436360_0107958 | Ga0436360_0107958_165_488 | 107 |
| 52 | 3300039438 | Ga0436360_0544531 | Ga0436360_0544531_20_343 | 107 |
| 53 | 3300039447 | Ga0436361_1087383 | Ga0436361_1087383_435_758 | 107 |
| 54 | 3300039450 | Ga0436363_0206965 | Ga0436363_0206965_49_372 | 107 |
| 55 | 3300044694 | Ga0466963_0680755 | Ga0466963_0680755_35_358 | 107 |
| 56 | 3300048929 | Ga0496126_0747768 | Ga0496126_0747768_363_686 | 107 |
| 57 | 3300050516 | nmdc:mga0sz30_29924_c1 | nmdc:mga0sz30_29924_c1_778_1101 | 107 |
| 58 | 3300053136 | Ga0500559_0059996 | Ga0500559_0059996_26_349 | 107 |
| 59 | 3300005548 | Ga0070665_100498618 | Ga0070665_1004986182 | 108 |
| 60 | 3300025940 | Ga0207691_10568881 | Ga0207691_105688812 | 108 |
| 61 | 3300005289 | Ga0065704_10283593 | Ga0065704_102835932 | 109 |
| 62 | 3300010375 | Ga0105239_11437621 | Ga0105239_114376211 | 109 |
| 63 | 3300013308 | Ga0157375_12797947 | Ga0157375_127979471 | 109 |
| 64 | 3300020069 | Ga0197907_11228939 | Ga0197907_112289392 | 109 |
| 65 | 3300037853 | Ga0436364_0921350 | Ga0436364_0921350_320_649 | 109 |
| 66 | 3300048925 | Ga0496122_0194255 | Ga0496122_0194255_527_856 | 109 |
| 67 | 3300049589 | Ga0501073_0438393 | Ga0501073_0438393_148_477 | 109 |
| 68 | 3300049823 | Ga0501044_0896576 | Ga0501044_0896576_244_573 | 109 |
| 69 | 3300005336 | Ga0070680_100241464 | Ga0070680_1002414642 | 110 |
| 70 | 3300005337 | Ga0070682_100296944 | Ga0070682_1002969443 | 110 |
| 71 | 3300005337 | Ga0070682_101123858 | Ga0070682_1011238581 | 110 |
| 72 | 3300005343 | Ga0070687_100832965 | Ga0070687_1008329651 | 110 |
| 73 | 3300005354 | Ga0070675_102138301 | Ga0070675_1021383012 | 110 |
| 74 | 3300005355 | Ga0070671_101748467 | Ga0070671_1017484672 | 110 |
| 75 | 3300005355 | Ga0070671_102094380 | Ga0070671_1020943801 | 110 |
| 76 | 3300005356 | Ga0070674_100154692 | Ga0070674_1001546922 | 110 |
| 77 | 3300005366 | Ga0070659_100037656 | Ga0070659_1000376564 | 110 |
| 78 | 3300005367 | Ga0070667_100899325 | Ga0070667_1008993252 | 110 |
| 79 | 3300005435 | Ga0070714_100353744 | Ga0070714_1003537442 | 110 |
| 80 | 3300005435 | Ga0070714_101282697 | Ga0070714_1012826971 | 110 |
| 81 | 3300005435 | Ga0070714_102287746 | Ga0070714_1022877461 | 110 |
| 82 | 3300005436 | Ga0070713_100110926 | Ga0070713_1001109263 | 110 |
| 83 | 3300005437 | Ga0070710_10030737 | Ga0070710_100307374 | 110 |
| 84 | 3300005437 | Ga0070710_10059981 | Ga0070710_100599812 | 110 |
| 85 | 3300005437 | Ga0070710_10457879 | Ga0070710_104578792 | 110 |
| 86 | 3300005439 | Ga0070711_100139384 | Ga0070711_1001393842 | 110 |
| 87 | 3300005456 | Ga0070678_100090914 | Ga0070678_1000909142 | 110 |
| 88 | 3300005458 | Ga0070681_10099714 | Ga0070681_100997142 | 110 |
| 89 | 3300005458 | Ga0070681_10142506 | Ga0070681_101425062 | 110 |
| 90 | 3300005458 | Ga0070681_10371479 | Ga0070681_103714792 | 110 |
| 91 | 3300005458 | Ga0070681_11610831 | Ga0070681_116108311 | 110 |
| 92 | 3300005467 | Ga0070706_101370366 | Ga0070706_1013703662 | 110 |
| 93 | 3300005471 | Ga0070698_100474372 | Ga0070698_1004743722 | 110 |
| 94 | 3300005471 | Ga0070698_100972051 | Ga0070698_1009720512 | 110 |
| 95 | 3300005518 | Ga0070699_100179098 | Ga0070699_1001790982 | 110 |
| 96 | 3300005530 | Ga0070679_100001462 | Ga0070679_10000146221 | 110 |
| 97 | 3300005530 | Ga0070679_100786514 | Ga0070679_1007865142 | 110 |
| 98 | 3300005530 | Ga0070679_101418393 | Ga0070679_1014183932 | 110 |
| 99 | 3300005530 | Ga0070679_102164825 | Ga0070679_1021648251 | 110 |
| 100 | 3300005535 | Ga0070684_100867420 | Ga0070684_1008674202 | 110 |
| 101 | 3300005548 | Ga0070665_100398548 | Ga0070665_1003985482 | 110 |
| 102 | 3300005563 | Ga0068855_100260762 | Ga0068855_1002607621 | 110 |
| 103 | 3300005563 | Ga0068855_102325954 | Ga0068855_1023259542 | 110 |
| 104 | 3300005577 | Ga0068857_101341839 | Ga0068857_1013418392 | 110 |
| 105 | 3300005578 | Ga0068854_100137911 | Ga0068854_1001379112 | 110 |
| 106 | 3300005578 | Ga0068854_101147126 | Ga0068854_1011471262 | 110 |
| 107 | 3300005614 | Ga0068856_100641202 | Ga0068856_1006412022 | 110 |
| 108 | 3300005615 | Ga0070702_101244607 | Ga0070702_1012446072 | 110 |
| 109 | 3300005618 | Ga0068864_100869617 | Ga0068864_1008696172 | 110 |
| 110 | 3300005834 | Ga0068851_11087968 | Ga0068851_110879681 | 110 |
| 111 | 3300005843 | Ga0068860_102440677 | Ga0068860_1024406772 | 110 |
| 112 | 3300005937 | Ga0081455_10365018 | Ga0081455_103650182 | 110 |
| 113 | 3300005983 | Ga0081540_1067783 | Ga0081540_10677832 | 110 |
| 114 | 3300006028 | Ga0070717_10144933 | Ga0070717_101449332 | 110 |
| 115 | 3300006028 | Ga0070717_10546151 | Ga0070717_105461512 | 110 |
| 116 | 3300006028 | Ga0070717_10792442 | Ga0070717_107924422 | 110 |
| 117 | 3300006028 | Ga0070717_11632208 | Ga0070717_116322082 | 110 |
| 118 | 3300006028 | Ga0070717_11961999 | Ga0070717_119619992 | 110 |
| 119 | 3300006175 | Ga0070712_100174596 | Ga0070712_1001745962 | 110 |
| 120 | 3300006237 | Ga0097621_100485764 | Ga0097621_1004857641 | 110 |
| 121 | 3300007788 | Ga0099795_10004091 | Ga0099795_100040914 | 110 |
| 122 | 3300007788 | Ga0099795_10520025 | Ga0099795_105200252 | 110 |
| 123 | 3300009093 | Ga0105240_10330513 | Ga0105240_103305131 | 110 |
| 124 | 3300009093 | Ga0105240_10350020 | Ga0105240_103500203 | 110 |
| 125 | 3300009093 | Ga0105240_10887408 | Ga0105240_108874082 | 110 |
| 126 | 3300009093 | Ga0105240_11323701 | Ga0105240_113237012 | 110 |
| 127 | 3300009098 | Ga0105245_10203960 | Ga0105245_102039602 | 110 |
| 128 | 3300009101 | Ga0105247_11676759 | Ga0105247_116767592 | 110 |
| 129 | 3300009174 | Ga0105241_10916449 | Ga0105241_109164491 | 110 |
| 130 | 3300009176 | Ga0105242_10464400 | Ga0105242_104644002 | 110 |
| 131 | 3300009177 | Ga0105248_10250080 | Ga0105248_102500801 | 110 |
| 132 | 3300009545 | Ga0105237_11035124 | Ga0105237_110351242 | 110 |
| 133 | 3300009551 | Ga0105238_10219118 | Ga0105238_102191182 | 110 |
| 134 | 3300009551 | Ga0105238_11605360 | Ga0105238_116053602 | 110 |
| 135 | 3300010159 | Ga0099796_10003440 | Ga0099796_100034404 | 110 |
| 136 | 3300010375 | Ga0105239_10853651 | Ga0105239_108536512 | 110 |
| 137 | 3300010375 | Ga0105239_11602060 | Ga0105239_116020601 | 110 |
| 138 | 3300010375 | Ga0105239_13249760 | Ga0105239_132497602 | 110 |
| 139 | 3300013100 | Ga0157373_10573386 | Ga0157373_105733861 | 110 |
| 140 | 3300013104 | Ga0157370_10019744 | Ga0157370_100197442 | 110 |
| 141 | 3300013105 | Ga0157369_10020086 | Ga0157369_1002008610 | 110 |
| 142 | 3300013105 | Ga0157369_10350166 | Ga0157369_103501662 | 110 |
| 143 | 3300013105 | Ga0157369_10459304 | Ga0157369_104593041 | 110 |
| 144 | 3300013296 | Ga0157374_10395854 | Ga0157374_103958542 | 110 |
| 145 | 3300013296 | Ga0157374_10624215 | Ga0157374_106242152 | 110 |
| 146 | 3300013296 | Ga0157374_11443990 | Ga0157374_114439902 | 110 |
| 147 | 3300013297 | Ga0157378_11545918 | Ga0157378_115459182 | 110 |
| 148 | 3300013297 | Ga0157378_12295875 | Ga0157378_122958752 | 110 |
| 149 | 3300014325 | Ga0163163_10083133 | Ga0163163_100831334 | 110 |
| 150 | 3300014325 | Ga0163163_10840000 | Ga0163163_108400002 | 110 |
| 151 | 3300014325 | Ga0163163_11891514 | Ga0163163_118915141 | 110 |
| 152 | 3300014968 | Ga0157379_10884466 | Ga0157379_108844662 | 110 |
| 153 | 3300014968 | Ga0157379_12532557 | Ga0157379_125325572 | 110 |
| 154 | 3300014968 | Ga0157379_12563752 | Ga0157379_125637522 | 110 |
| 155 | 3300017792 | Ga0163161_10594122 | Ga0163161_105941222 | 110 |
| 156 | 3300020076 | Ga0206355_1585110 | Ga0206355_15851102 | 110 |
| 157 | 3300021358 | Ga0213873_10056701 | Ga0213873_100567012 | 110 |
| 158 | 3300021377 | Ga0213874_10018944 | Ga0213874_100189443 | 110 |
| 159 | 3300021388 | Ga0213875_10000253 | Ga0213875_1000025330 | 110 |
| 160 | 3300021388 | Ga0213875_10001582 | Ga0213875_1000158210 | 110 |
| 161 | 3300021388 | Ga0213875_10056169 | Ga0213875_100561692 | 110 |
| 162 | 3300021388 | Ga0213875_10123940 | Ga0213875_101239402 | 110 |
| 163 | 3300021441 | Ga0213871_10010990 | Ga0213871_100109902 | 110 |
| 164 | 3300021441 | Ga0213871_10131587 | Ga0213871_101315872 | 110 |
| 165 | 3300021441 | Ga0213871_10172580 | Ga0213871_101725802 | 110 |
| 166 | 3300021441 | Ga0213871_10205762 | Ga0213871_102057622 | 110 |
| 167 | 3300022467 | Ga0224712_10050002 | Ga0224712_100500024 | 110 |
| 168 | 3300025292 | Ga0209676_1000256 | Ga0209676_100025677 | 110 |
| 169 | 3300025298 | Ga0209050_1011492 | Ga0209050_10114922 | 110 |
| 170 | 3300025885 | Ga0207653_10034017 | Ga0207653_100340173 | 110 |
| 171 | 3300025898 | Ga0207692_10262871 | Ga0207692_102628712 | 110 |
| 172 | 3300025898 | Ga0207692_10704860 | Ga0207692_107048602 | 110 |
| 173 | 3300025900 | Ga0207710_10621855 | Ga0207710_106218552 | 110 |
| 174 | 3300025904 | Ga0207647_10134893 | Ga0207647_101348932 | 110 |
| 175 | 3300025904 | Ga0207647_10374812 | Ga0207647_103748122 | 110 |
| 176 | 3300025906 | Ga0207699_10272901 | Ga0207699_102729013 | 110 |
| 177 | 3300025910 | Ga0207684_11177093 | Ga0207684_111770932 | 110 |
| 178 | 3300025912 | Ga0207707_10015024 | Ga0207707_100150242 | 110 |
| 179 | 3300025912 | Ga0207707_10253734 | Ga0207707_102537342 | 110 |
| 180 | 3300025912 | Ga0207707_10261457 | Ga0207707_102614572 | 110 |
| 181 | 3300025913 | Ga0207695_10270929 | Ga0207695_102709293 | 110 |
| 182 | 3300025913 | Ga0207695_10442983 | Ga0207695_104429832 | 110 |
| 183 | 3300025914 | Ga0207671_11538467 | Ga0207671_115384672 | 110 |
| 184 | 3300025915 | Ga0207693_10005635 | Ga0207693_100056356 | 110 |
| 185 | 3300025915 | Ga0207693_10033797 | Ga0207693_100337973 | 110 |
| 186 | 3300025915 | Ga0207693_10305738 | Ga0207693_103057382 | 110 |
| 187 | 3300025915 | Ga0207693_10828333 | Ga0207693_108283331 | 110 |
| 188 | 3300025916 | Ga0207663_10252127 | Ga0207663_102521272 | 110 |
| 189 | 3300025916 | Ga0207663_10518933 | Ga0207663_105189331 | 110 |
| 190 | 3300025917 | Ga0207660_10090086 | Ga0207660_100900861 | 110 |
| 191 | 3300025917 | Ga0207660_10281049 | Ga0207660_102810492 | 110 |
| 192 | 3300025917 | Ga0207660_10514987 | Ga0207660_105149873 | 110 |
| 193 | 3300025917 | Ga0207660_10784176 | Ga0207660_107841762 | 110 |
| 194 | 3300025918 | Ga0207662_10675507 | Ga0207662_106755071 | 110 |
| 195 | 3300025919 | Ga0207657_11514352 | Ga0207657_115143521 | 110 |
| 196 | 3300025921 | Ga0207652_10036904 | Ga0207652_100369044 | 110 |
| 197 | 3300025921 | Ga0207652_10111086 | Ga0207652_101110863 | 110 |
| 198 | 3300025921 | Ga0207652_10152348 | Ga0207652_101523482 | 110 |
| 199 | 3300025921 | Ga0207652_10202211 | Ga0207652_102022112 | 110 |
| 200 | 3300025921 | Ga0207652_11616747 | Ga0207652_116167472 | 110 |
| 201 | 3300025924 | Ga0207694_10932248 | Ga0207694_109322482 | 110 |
| 202 | 3300025927 | Ga0207687_10379221 | Ga0207687_103792212 | 110 |
| 203 | 3300025928 | Ga0207700_10294079 | Ga0207700_102940792 | 110 |
| 204 | 3300025928 | Ga0207700_10622409 | Ga0207700_106224092 | 110 |
| 205 | 3300025929 | Ga0207664_10971621 | Ga0207664_109716212 | 110 |
| 206 | 3300025929 | Ga0207664_11382384 | Ga0207664_113823842 | 110 |
| 207 | 3300025929 | Ga0207664_11760750 | Ga0207664_117607501 | 110 |
| 208 | 3300025932 | Ga0207690_10087281 | Ga0207690_100872813 | 110 |
| 209 | 3300025937 | Ga0207669_10223824 | Ga0207669_102238242 | 110 |
| 210 | 3300025945 | Ga0207679_10630758 | Ga0207679_106307582 | 110 |
| 211 | 3300025945 | Ga0207679_10893511 | Ga0207679_108935112 | 110 |
| 212 | 3300025949 | Ga0207667_10330034 | Ga0207667_103300344 | 110 |
| 213 | 3300025960 | Ga0207651_10668400 | Ga0207651_106684001 | 110 |
| 214 | 3300025981 | Ga0207640_10112810 | Ga0207640_101128102 | 110 |
| 215 | 3300025981 | Ga0207640_10713513 | Ga0207640_107135132 | 110 |
| 216 | 3300026023 | Ga0207677_10423435 | Ga0207677_104234352 | 110 |
| 217 | 3300026078 | Ga0207702_10119240 | Ga0207702_101192401 | 110 |
| 218 | 3300026078 | Ga0207702_11539940 | Ga0207702_115399402 | 110 |
| 219 | 3300026078 | Ga0207702_11651298 | Ga0207702_116512982 | 110 |
| 220 | 3300026095 | Ga0207676_10607945 | Ga0207676_106079452 | 110 |
| 221 | 3300026116 | Ga0207674_10177351 | Ga0207674_101773513 | 110 |
| 222 | 3300026116 | Ga0207674_11213394 | Ga0207674_112133942 | 110 |
| 223 | 3300026121 | Ga0207683_10116426 | Ga0207683_101164262 | 110 |
| 224 | 3300028800 | Ga0265338_10110497 | Ga0265338_101104972 | 110 |
| 225 | 3300030882 | Ga0265764_114217 | Ga0265764_1142172 | 110 |
| 226 | 3300031249 | Ga0265339_10244811 | Ga0265339_102448111 | 110 |
| 227 | 3300031251 | Ga0265327_10016206 | Ga0265327_100162065 | 110 |
| 228 | 3300031251 | Ga0265327_10077979 | Ga0265327_100779792 | 110 |
| 229 | 3300031344 | Ga0265316_10155618 | Ga0265316_101556181 | 110 |
| 230 | 3300031595 | Ga0265313_10068075 | Ga0265313_100680752 | 110 |
| 231 | 3300031901 | Ga0307406_11266050 | Ga0307406_112660501 | 110 |
| 232 | 3300031911 | Ga0307412_10780127 | Ga0307412_107801272 | 110 |
| 233 | 3300032120 | Ga0316053_108997 | Ga0316053_1089972 | 110 |
| 234 | 3300035083 | Ga0373926_0138843 | Ga0373926_0138843_465_797 | 110 |
| 235 | 3300035088 | Ga0373940_0354956 | Ga0373940_0354956_74_406 | 110 |
| 236 | 3300035089 | Ga0373944_0248171 | Ga0373944_0248171_117_449 | 110 |
| 237 | 3300035113 | Ga0373936_0046845 | Ga0373936_0046845_1369_1701 | 110 |
| 238 | 3300035116 | Ga0373945_0165035 | Ga0373945_0165035_154_486 | 110 |
| 239 | 3300035117 | Ga0373953_0023627 | Ga0373953_0023627_1752_2084 | 110 |
| 240 | 3300035118 | Ga0373954_0063587 | Ga0373954_0063587_1153_1485 | 110 |
| 241 | 3300035119 | Ga0373956_0119709 | Ga0373956_0119709_98_430 | 110 |
| 242 | 3300035120 | Ga0373957_0255623 | Ga0373957_0255623_221_553 | 110 |
| 243 | 3300035120 | Ga0373957_0490840 | Ga0373957_0490840_46_378 | 110 |
| 244 | 3300035170 | Ga0373943_0066903 | Ga0373943_0066903_25_357 | 110 |
| 245 | 3300035170 | Ga0373943_0526444 | Ga0373943_0526444_118_450 | 110 |
| 246 | 3300035171 | Ga0373946_0515281 | Ga0373946_0515281_83_415 | 110 |
| 247 | 3300035172 | Ga0373955_0029777 | Ga0373955_0029777_1267_1599 | 110 |
| 248 | 3300035172 | Ga0373955_0042579 | Ga0373955_0042579_487_819 | 110 |
| 249 | 3300035172 | Ga0373955_0144379 | Ga0373955_0144379_257_589 | 110 |
| 250 | 3300035172 | Ga0373955_0578731 | Ga0373955_0578731_33_365 | 110 |
| 251 | 3300035172 | Ga0373955_0675506 | Ga0373955_0675506_152_484 | 110 |
| 252 | 3300035410 | Ga0373924_0026438 | Ga0373924_0026438_1086_1418 | 110 |
| 253 | 3300035410 | Ga0373924_0142703 | Ga0373924_0142703_544_876 | 110 |
| 254 | 3300035692 | Ga0373935_0331225 | Ga0373935_0331225_62_394 | 110 |
| 255 | 3300035695 | Ga0373927_0051388 | Ga0373927_0051388_324_656 | 110 |
| 256 | 3300035695 | Ga0373927_0235275 | Ga0373927_0235275_441_773 | 110 |
| 257 | 3300035695 | Ga0373927_1087803 | Ga0373927_1087803_178_510 | 110 |
| 258 | 3300035695 | Ga0373927_1177878 | Ga0373927_1177878_144_476 | 110 |
| 259 | 3300035724 | Ga0373933_0025398 | Ga0373933_0025398_1150_1482 | 110 |
| 260 | 3300035724 | Ga0373933_0036405 | Ga0373933_0036405_1953_2285 | 110 |
| 261 | 3300035724 | Ga0373933_0352553 | Ga0373933_0352553_270_602 | 110 |
| 262 | 3300035725 | Ga0373947_0063328 | Ga0373947_0063328_1176_1508 | 110 |
| 263 | 3300035725 | Ga0373947_0113888 | Ga0373947_0113888_1251_1583 | 110 |
| 264 | 3300035725 | Ga0373947_0380510 | Ga0373947_0380510_419_751 | 110 |
| 265 | 3300036401 | Ga0373937_0013547 | Ga0373937_0013547_3599_3931 | 110 |
| 266 | 3300036401 | Ga0373937_0033495 | Ga0373937_0033495_1380_1712 | 110 |
| 267 | 3300036401 | Ga0373937_0039758 | Ga0373937_0039758_660_992 | 110 |
| 268 | 3300036401 | Ga0373937_0067697 | Ga0373937_0067697_2250_2582 | 110 |
| 269 | 3300036401 | Ga0373937_0227153 | Ga0373937_0227153_1191_1523 | 110 |
| 270 | 3300036401 | Ga0373937_0625329 | Ga0373937_0625329_487_819 | 110 |
| 271 | 3300037068 | Ga0373925_0257352 | Ga0373925_0257352_229_561 | 110 |
| 272 | 3300037068 | Ga0373925_0418843 | Ga0373925_0418843_639_971 | 110 |
| 273 | 3300037418 | Ga0395900_0785651 | Ga0395900_0785651_71_403 | 110 |
| 274 | 3300037418 | Ga0395900_0828111 | Ga0395900_0828111_45_434 | 110 |
| 275 | 3300037418 | Ga0395900_1000555 | Ga0395900_1000555_10_342 | 110 |
| 276 | 3300037853 | Ga0436364_0266271 | Ga0436364_0266271_91899_92231 | 110 |
| 277 | 3300037853 | Ga0436364_0278369 | Ga0436364_0278369_120_455 | 110 |
| 278 | 3300037853 | Ga0436364_0503141 | Ga0436364_0503141_161_493 | 110 |
| 279 | 3300037853 | Ga0436364_0574986 | Ga0436364_0574986_1362_1694 | 110 |
| 280 | 3300037853 | Ga0436364_0694410 | Ga0436364_0694410_24120_24452 | 110 |
| 281 | 3300037853 | Ga0436364_1344478 | Ga0436364_1344478_2251_2583 | 110 |
| 282 | 3300038443 | Ga0395901_1771223 | Ga0395901_1771223_10_342 | 110 |
| 283 | 3300039437 | Ga0436365_0472578 | Ga0436365_0472578_35_367 | 110 |
| 284 | 3300039437 | Ga0436365_0762128 | Ga0436365_0762128_55_387 | 110 |
| 285 | 3300039437 | Ga0436365_1498663 | Ga0436365_1498663_165_497 | 110 |
| 286 | 3300039437 | Ga0436365_1607597 | Ga0436365_1607597_212_544 | 110 |
| 287 | 3300039437 | Ga0436365_1691575 | Ga0436365_1691575_1545_1877 | 110 |
| 288 | 3300039438 | Ga0436360_0185552 | Ga0436360_0185552_530_862 | 110 |
| 289 | 3300039438 | Ga0436360_0213506 | Ga0436360_0213506_2278_2610 | 110 |
| 290 | 3300039438 | Ga0436360_0220240 | Ga0436360_0220240_660_992 | 110 |
| 291 | 3300039438 | Ga0436360_0523890 | Ga0436360_0523890_36_368 | 110 |
| 292 | 3300039438 | Ga0436360_0532696 | Ga0436360_0532696_536_868 | 110 |
| 293 | 3300039438 | Ga0436360_0811977 | Ga0436360_0811977_1753_2085 | 110 |
| 294 | 3300039438 | Ga0436360_0846745 | Ga0436360_0846745_461_793 | 110 |
| 295 | 3300039438 | Ga0436360_1217323 | Ga0436360_1217323_122_454 | 110 |
| 296 | 3300039450 | Ga0436363_0724362 | Ga0436363_0724362_91_423 | 110 |
| 297 | 3300039450 | Ga0436363_1670359 | Ga0436363_1670359_128_460 | 110 |
| 298 | 3300039450 | Ga0436363_1712732 | Ga0436363_1712732_192_524 | 110 |
| 299 | 3300039453 | Ga0436362_0310010 | Ga0436362_0310010_113_445 | 110 |
| 300 | 3300039453 | Ga0436362_0552323 | Ga0436362_0552323_93_425 | 110 |
| 301 | 3300039453 | Ga0436362_0619579 | Ga0436362_0619579_427_759 | 110 |
| 302 | 3300039453 | Ga0436362_1230386 | Ga0436362_1230386_42_374 | 110 |
| 303 | 3300039453 | Ga0436362_1243951 | Ga0436362_1243951_195_527 | 110 |
| 304 | 3300044658 | Ga0466972_0455923 | Ga0466972_0455923_143_475 | 110 |
| 305 | 3300044684 | Ga0466966_0968959 | Ga0466966_0968959_21_353 | 110 |
| 306 | 3300044694 | Ga0466963_0475424 | Ga0466963_0475424_142_474 | 110 |
| 307 | 3300044765 | Ga0466970_0496133 | Ga0466970_0496133_53_385 | 110 |
| 308 | 3300044842 | Ga0466957_0164205 | Ga0466957_0164205_221_553 | 110 |
| 309 | 3300045051 | Ga0451576_0002195 | Ga0451576_0002195_11513_11845 | 110 |
| 310 | 3300045836 | Ga0466958_0447755 | Ga0466958_0447755_145_477 | 110 |
| 311 | 3300045976 | Ga0466967_0394288 | Ga0466967_0394288_942_1274 | 110 |
| 312 | 3300045976 | Ga0466967_1395781 | Ga0466967_1395781_130_462 | 110 |
| 313 | 3300045976 | Ga0466967_2313715 | Ga0466967_2313715_153_485 | 110 |
| 314 | 3300046454 | Ga0495592_0566504 | Ga0495592_0566504_169_501 | 110 |
| 315 | 3300046462 | Ga0495651_0135202 | Ga0495651_0135202_243_575 | 110 |
| 316 | 3300046462 | Ga0495651_0283741 | Ga0495651_0283741_444_776 | 110 |
| 317 | 3300046472 | Ga0495580_0529932 | Ga0495580_0529932_414_746 | 110 |
| 318 | 3300046511 | Ga0495608_0004971 | Ga0495608_0004971_8983_9315 | 110 |
| 319 | 3300046511 | Ga0495608_0035177 | Ga0495608_0035177_1459_1791 | 110 |
| 320 | 3300046514 | Ga0495618_0159236 | Ga0495618_0159236_217_549 | 110 |
| 321 | 3300046516 | Ga0495628_0128019 | Ga0495628_0128019_1276_1608 | 110 |
| 322 | 3300046516 | Ga0495628_0144741 | Ga0495628_0144741_1202_1534 | 110 |
| 323 | 3300046529 | Ga0495652_0112773 | Ga0495652_0112773_598_930 | 110 |
| 324 | 3300046529 | Ga0495652_0210142 | Ga0495652_0210142_851_1183 | 110 |
| 325 | 3300046533 | Ga0495640_0899280 | Ga0495640_0899280_62_394 | 110 |
| 326 | 3300046536 | Ga0495587_0044169 | Ga0495587_0044169_633_965 | 110 |
| 327 | 3300046536 | Ga0495587_0047441 | Ga0495587_0047441_626_958 | 110 |
| 328 | 3300046559 | Ga0495667_0018054 | Ga0495667_0018054_3423_3755 | 110 |
| 329 | 3300046559 | Ga0495667_0019733 | Ga0495667_0019733_1205_1537 | 110 |
| 330 | 3300046663 | Ga0495635_0228593 | Ga0495635_0228593_342_674 | 110 |
| 331 | 3300046663 | Ga0495635_0758946 | Ga0495635_0758946_188_520 | 110 |
| 332 | 3300046675 | Ga0495657_0383813 | Ga0495657_0383813_79_411 | 110 |
| 333 | 3300046678 | Ga0495599_0010184 | Ga0495599_0010184_3674_4006 | 110 |
| 334 | 3300046678 | Ga0495599_0078299 | Ga0495599_0078299_1671_2003 | 110 |
| 335 | 3300046679 | Ga0495623_0139254 | Ga0495623_0139254_543_875 | 110 |
| 336 | 3300046680 | Ga0495646_0064683 | Ga0495646_0064683_1101_1433 | 110 |
| 337 | 3300046683 | Ga0495658_1098178 | Ga0495658_1098178_145_477 | 110 |
| 338 | 3300046809 | Ga0495600_0137659 | Ga0495600_0137659_675_1007 | 110 |
| 339 | 3300046809 | Ga0495600_0236438 | Ga0495600_0236438_798_1130 | 110 |
| 340 | 3300047319 | Ga0495674_0162896 | Ga0495674_0162896_1438_1770 | 110 |
| 341 | 3300047319 | Ga0495674_0211242 | Ga0495674_0211242_905_1237 | 110 |
| 342 | 3300047322 | Ga0495680_0051468 | Ga0495680_0051468_1107_1439 | 110 |
| 343 | 3300047322 | Ga0495680_0355063 | Ga0495680_0355063_320_652 | 110 |
| 344 | 3300047444 | Ga0495675_0043815 | Ga0495675_0043815_1364_1696 | 110 |
| 345 | 3300047471 | Ga0495684_0838773 | Ga0495684_0838773_104_436 | 110 |
| 346 | 3300048088 | Ga0495602_0000143 | Ga0495602_0000143_27237_27569 | 110 |
| 347 | 3300048088 | Ga0495602_0302086 | Ga0495602_0302086_207_539 | 110 |
| 348 | 3300048912 | Ga0496109_0897786 | Ga0496109_0897786_96_428 | 110 |
| 349 | 3300048915 | Ga0496112_0422058 | Ga0496112_0422058_297_629 | 110 |
| 350 | 3300048918 | Ga0496115_0160603 | Ga0496115_0160603_92_424 | 110 |
| 351 | 3300049579 | Ga0501043_0875651 | Ga0501043_0875651_235_567 | 110 |
| 352 | 3300049586 | Ga0501070_0137899 | Ga0501070_0137899_1172_1504 | 110 |
| 353 | 3300049742 | Ga0501080_0403010 | Ga0501080_0403010_623_955 | 110 |
| 354 | 3300049822 | Ga0501035_0872133 | Ga0501035_0872133_200_532 | 110 |
| 355 | 3300053077 | Ga0495601_0013940 | Ga0495601_0013940_1085_1417 | 110 |
| 356 | 3300053077 | Ga0495601_0457071 | Ga0495601_0457071_70_402 | 110 |
| 357 | 3300053084 | Ga0495595_0012504 | Ga0495595_0012504_2163_2495 | 110 |
| 358 | 3300053085 | Ga0495619_0016874 | Ga0495619_0016874_3118_3450 | 110 |
| 359 | 3300053090 | Ga0500646_0187259 | Ga0500646_0187259_166_498 | 110 |
| 360 | 3300053098 | Ga0500650_0197948 | Ga0500650_0197948_477_809 | 110 |
| 361 | 3300053146 | Ga0500588_0000178 | Ga0500588_0000178_3155_3487 | 110 |
| 362 | 3300003911 | JGI25405J52794_10034116 | JGI25405J52794_100341162 | 111 |
| 363 | 3300005328 | Ga0070676_11003028 | Ga0070676_110030282 | 111 |
| 364 | 3300005328 | Ga0070676_11432135 | Ga0070676_114321351 | 111 |
| 365 | 3300005329 | Ga0070683_100200618 | Ga0070683_1002006183 | 111 |
| 366 | 3300005331 | Ga0070670_101458998 | Ga0070670_1014589982 | 111 |
| 367 | 3300005336 | Ga0070680_100011146 | Ga0070680_1000111468 | 111 |
| 368 | 3300005339 | Ga0070660_101458349 | Ga0070660_1014583491 | 111 |
| 369 | 3300005339 | Ga0070660_101785357 | Ga0070660_1017853571 | 111 |
| 370 | 3300005340 | Ga0070689_100386965 | Ga0070689_1003869653 | 111 |
| 371 | 3300005341 | Ga0070691_10004768 | Ga0070691_100047688 | 111 |
| 372 | 3300005344 | Ga0070661_100076995 | Ga0070661_1000769954 | 111 |
| 373 | 3300005353 | Ga0070669_100063124 | Ga0070669_1000631243 | 111 |
| 374 | 3300005354 | Ga0070675_100114628 | Ga0070675_1001146284 | 111 |
| 375 | 3300005364 | Ga0070673_100763167 | Ga0070673_1007631672 | 111 |
| 376 | 3300005365 | Ga0070688_100928285 | Ga0070688_1009282852 | 111 |
| 377 | 3300005367 | Ga0070667_100500314 | Ga0070667_1005003142 | 111 |
| 378 | 3300005436 | Ga0070713_100011746 | Ga0070713_1000117462 | 111 |
| 379 | 3300005456 | Ga0070678_100031445 | Ga0070678_1000314455 | 111 |
| 380 | 3300005457 | Ga0070662_100397411 | Ga0070662_1003974112 | 111 |
| 381 | 3300005458 | Ga0070681_10007259 | Ga0070681_100072592 | 111 |
| 382 | 3300005458 | Ga0070681_10197634 | Ga0070681_101976342 | 111 |
| 383 | 3300005467 | Ga0070706_100663818 | Ga0070706_1006638182 | 111 |
| 384 | 3300005468 | Ga0070707_100072176 | Ga0070707_1000721762 | 111 |
| 385 | 3300005471 | Ga0070698_100000641 | Ga0070698_1000006417 | 111 |
| 386 | 3300005530 | Ga0070679_100004471 | Ga0070679_10000447111 | 111 |
| 387 | 3300005530 | Ga0070679_100340059 | Ga0070679_1003400592 | 111 |
| 388 | 3300005535 | Ga0070684_100129754 | Ga0070684_1001297543 | 111 |
| 389 | 3300005536 | Ga0070697_100278070 | Ga0070697_1002780703 | 111 |
| 390 | 3300005539 | Ga0068853_100330810 | Ga0068853_1003308103 | 111 |
| 391 | 3300005539 | Ga0068853_101127355 | Ga0068853_1011273552 | 111 |
| 392 | 3300005543 | Ga0070672_100048117 | Ga0070672_1000481173 | 111 |
| 393 | 3300005548 | Ga0070665_100139250 | Ga0070665_1001392504 | 111 |
| 394 | 3300005548 | Ga0070665_100503145 | Ga0070665_1005031453 | 111 |
| 395 | 3300005563 | Ga0068855_100016016 | Ga0068855_10001601610 | 111 |
| 396 | 3300005563 | Ga0068855_100592469 | Ga0068855_1005924692 | 111 |
| 397 | 3300005564 | Ga0070664_100347455 | Ga0070664_1003474552 | 111 |
| 398 | 3300005577 | Ga0068857_100343133 | Ga0068857_1003431333 | 111 |
| 399 | 3300005614 | Ga0068856_100014010 | Ga0068856_1000140106 | 111 |
| 400 | 3300005614 | Ga0068856_100145975 | Ga0068856_1001459752 | 111 |
| 401 | 3300005616 | Ga0068852_100087687 | Ga0068852_1000876872 | 111 |
| 402 | 3300005617 | Ga0068859_100087454 | Ga0068859_1000874542 | 111 |
| 403 | 3300005617 | Ga0068859_103068405 | Ga0068859_1030684051 | 111 |
| 404 | 3300005618 | Ga0068864_101958916 | Ga0068864_1019589161 | 111 |
| 405 | 3300005834 | Ga0068851_10264176 | Ga0068851_102641762 | 111 |
| 406 | 3300005842 | Ga0068858_100393281 | Ga0068858_1003932812 | 111 |
| 407 | 3300005844 | Ga0068862_100291437 | Ga0068862_1002914372 | 111 |
| 408 | 3300005937 | Ga0081455_10000688 | Ga0081455_1000068813 | 111 |
| 409 | 3300005937 | Ga0081455_10009381 | Ga0081455_100093818 | 111 |
| 410 | 3300005983 | Ga0081540_1030277 | Ga0081540_10302774 | 111 |
| 411 | 3300005985 | Ga0081539_10007016 | Ga0081539_1000701612 | 111 |
| 412 | 3300005985 | Ga0081539_10010675 | Ga0081539_100106756 | 111 |
| 413 | 3300006038 | Ga0075365_10026742 | Ga0075365_100267425 | 111 |
| 414 | 3300006038 | Ga0075365_10242485 | Ga0075365_102424853 | 111 |
| 415 | 3300006038 | Ga0075365_10468008 | Ga0075365_104680083 | 111 |
| 416 | 3300006038 | Ga0075365_11064830 | Ga0075365_110648302 | 111 |
| 417 | 3300006042 | Ga0075368_10029075 | Ga0075368_100290752 | 111 |
| 418 | 3300006051 | Ga0075364_10219070 | Ga0075364_102190703 | 111 |
| 419 | 3300006051 | Ga0075364_10317627 | Ga0075364_103176272 | 111 |
| 420 | 3300006058 | Ga0075432_10180476 | Ga0075432_101804762 | 111 |
| 421 | 3300006163 | Ga0070715_10790982 | Ga0070715_107909821 | 111 |
| 422 | 3300006177 | Ga0075362_10006964 | Ga0075362_100069642 | 111 |
| 423 | 3300006177 | Ga0075362_10020910 | Ga0075362_100209102 | 111 |
| 424 | 3300006177 | Ga0075362_10123776 | Ga0075362_101237762 | 111 |
| 425 | 3300006177 | Ga0075362_10140285 | Ga0075362_101402852 | 111 |
| 426 | 3300006177 | Ga0075362_10174824 | Ga0075362_101748242 | 111 |
| 427 | 3300006177 | Ga0075362_10616114 | Ga0075362_106161142 | 111 |
| 428 | 3300006178 | Ga0075367_10009522 | Ga0075367_100095224 | 111 |
| 429 | 3300006178 | Ga0075367_10029988 | Ga0075367_100299883 | 111 |
| 430 | 3300006178 | Ga0075367_10331436 | Ga0075367_103314363 | 111 |
| 431 | 3300006186 | Ga0075369_10015552 | Ga0075369_100155524 | 111 |
| 432 | 3300006186 | Ga0075369_10018239 | Ga0075369_100182393 | 111 |
| 433 | 3300006186 | Ga0075369_10231094 | Ga0075369_102310943 | 111 |
| 434 | 3300006195 | Ga0075366_10036962 | Ga0075366_100369624 | 111 |
| 435 | 3300006195 | Ga0075366_10359758 | Ga0075366_103597582 | 111 |
| 436 | 3300006195 | Ga0075366_10870653 | Ga0075366_108706532 | 111 |
| 437 | 3300006353 | Ga0075370_10016237 | Ga0075370_100162376 | 111 |
| 438 | 3300006353 | Ga0075370_10049140 | Ga0075370_100491403 | 111 |
| 439 | 3300006353 | Ga0075370_10251888 | Ga0075370_102518882 | 111 |
| 440 | 3300006358 | Ga0068871_100776988 | Ga0068871_1007769882 | 111 |
| 441 | 3300006844 | Ga0075428_100903433 | Ga0075428_1009034332 | 111 |
| 442 | 3300006881 | Ga0068865_102033514 | Ga0068865_1020335141 | 111 |
| 443 | 3300006931 | Ga0097620_100087451 | Ga0097620_1000874515 | 111 |
| 444 | 3300006931 | Ga0097620_103068391 | Ga0097620_1030683911 | 111 |
| 445 | 3300007076 | Ga0075435_101152611 | Ga0075435_1011526112 | 111 |
| 446 | 3300007265 | Ga0099794_10204513 | Ga0099794_102045133 | 111 |
| 447 | 3300009092 | Ga0105250_10383631 | Ga0105250_103836311 | 111 |
| 448 | 3300009093 | Ga0105240_10041196 | Ga0105240_100411962 | 111 |
| 449 | 3300009093 | Ga0105240_10226885 | Ga0105240_102268854 | 111 |
| 450 | 3300009094 | Ga0111539_10434078 | Ga0111539_104340782 | 111 |
| 451 | 3300009094 | Ga0111539_12823958 | Ga0111539_128239582 | 111 |
| 452 | 3300009098 | Ga0105245_11456449 | Ga0105245_114564492 | 111 |
| 453 | 3300009101 | Ga0105247_10549629 | Ga0105247_105496292 | 111 |
| 454 | 3300009148 | Ga0105243_11013740 | Ga0105243_110137402 | 111 |
| 455 | 3300009545 | Ga0105237_10167177 | Ga0105237_101671774 | 111 |
| 456 | 3300009545 | Ga0105237_11222290 | Ga0105237_112222902 | 111 |
| 457 | 3300009551 | Ga0105238_10057501 | Ga0105238_100575012 | 111 |
| 458 | 3300009551 | Ga0105238_10196387 | Ga0105238_101963873 | 111 |
| 459 | 3300009551 | Ga0105238_12974812 | Ga0105238_129748121 | 111 |
| 460 | 3300009988 | Ga0105035_101266 | Ga0105035_1012663 | 111 |
| 461 | 3300010375 | Ga0105239_11038259 | Ga0105239_110382591 | 111 |
| 462 | 3300010375 | Ga0105239_11050471 | Ga0105239_110504712 | 111 |
| 463 | 3300013100 | Ga0157373_10066839 | Ga0157373_100668394 | 111 |
| 464 | 3300013102 | Ga0157371_10117854 | Ga0157371_101178542 | 111 |
| 465 | 3300013102 | Ga0157371_10415541 | Ga0157371_104155412 | 111 |
| 466 | 3300013104 | Ga0157370_10410267 | Ga0157370_104102672 | 111 |
| 467 | 3300013104 | Ga0157370_10625503 | Ga0157370_106255032 | 111 |
| 468 | 3300013296 | Ga0157374_10151595 | Ga0157374_101515952 | 111 |
| 469 | 3300013296 | Ga0157374_11286931 | Ga0157374_112869312 | 111 |
| 470 | 3300013297 | Ga0157378_10323498 | Ga0157378_103234982 | 111 |
| 471 | 3300013307 | Ga0157372_10137200 | Ga0157372_101372002 | 111 |
| 472 | 3300013307 | Ga0157372_12696930 | Ga0157372_126969301 | 111 |
| 473 | 3300013308 | Ga0157375_12163476 | Ga0157375_121634762 | 111 |
| 474 | 3300013875 | Ga0157515_116762 | Ga0157515_1167622 | 111 |
| 475 | 3300014326 | Ga0157380_11837932 | Ga0157380_118379321 | 111 |
| 476 | 3300014497 | Ga0182008_10395070 | Ga0182008_103950702 | 111 |
| 477 | 3300014968 | Ga0157379_11393208 | Ga0157379_113932082 | 111 |
| 478 | 3300020082 | Ga0206353_11950597 | Ga0206353_119505972 | 111 |
| 479 | 3300020610 | Ga0154015_1267117 | Ga0154015_12671171 | 111 |
| 480 | 3300021361 | Ga0213872_10056033 | Ga0213872_100560332 | 111 |
| 481 | 3300021361 | Ga0213872_10242688 | Ga0213872_102426882 | 111 |
| 482 | 3300021441 | Ga0213871_10003685 | Ga0213871_100036852 | 111 |
| 483 | 3300025302 | Ga0207426_1026821 | Ga0207426_10268212 | 111 |
| 484 | 3300025302 | Ga0207426_1049303 | Ga0207426_10493033 | 111 |
| 485 | 3300025315 | Ga0207697_10195581 | Ga0207697_101955811 | 111 |
| 486 | 3300025315 | Ga0207697_10319707 | Ga0207697_103197072 | 111 |
| 487 | 3300025321 | Ga0207656_10102313 | Ga0207656_101023132 | 111 |
| 488 | 3300025899 | Ga0207642_11054872 | Ga0207642_110548721 | 111 |
| 489 | 3300025901 | Ga0207688_10078557 | Ga0207688_100785573 | 111 |
| 490 | 3300025903 | Ga0207680_10515880 | Ga0207680_105158802 | 111 |
| 491 | 3300025907 | Ga0207645_10817055 | Ga0207645_108170552 | 111 |
| 492 | 3300025908 | Ga0207643_10450241 | Ga0207643_104502413 | 111 |
| 493 | 3300025909 | Ga0207705_10099719 | Ga0207705_100997193 | 111 |
| 494 | 3300025909 | Ga0207705_10150357 | Ga0207705_101503573 | 111 |
| 495 | 3300025910 | Ga0207684_10271395 | Ga0207684_102713953 | 111 |
| 496 | 3300025910 | Ga0207684_10572679 | Ga0207684_105726792 | 111 |
| 497 | 3300025912 | Ga0207707_10183121 | Ga0207707_101831212 | 111 |
| 498 | 3300025912 | Ga0207707_10375367 | Ga0207707_103753672 | 111 |
| 499 | 3300025913 | Ga0207695_10234562 | Ga0207695_102345623 | 111 |
| 500 | 3300025913 | Ga0207695_10243724 | Ga0207695_102437242 | 111 |
| 501 | 3300025914 | Ga0207671_10244839 | Ga0207671_102448392 | 111 |
| 502 | 3300025917 | Ga0207660_10153117 | Ga0207660_101531172 | 111 |
| 503 | 3300025919 | Ga0207657_10310018 | Ga0207657_103100183 | 111 |
| 504 | 3300025920 | Ga0207649_10069979 | Ga0207649_100699792 | 111 |
| 505 | 3300025921 | Ga0207652_10995018 | Ga0207652_109950182 | 111 |
| 506 | 3300025921 | Ga0207652_11020728 | Ga0207652_110207282 | 111 |
| 507 | 3300025922 | Ga0207646_11071323 | Ga0207646_110713232 | 111 |
| 508 | 3300025923 | Ga0207681_10645849 | Ga0207681_106458492 | 111 |
| 509 | 3300025924 | Ga0207694_10262322 | Ga0207694_102623223 | 111 |
| 510 | 3300025924 | Ga0207694_10584148 | Ga0207694_105841483 | 111 |
| 511 | 3300025926 | Ga0207659_10096793 | Ga0207659_100967934 | 111 |
| 512 | 3300025928 | Ga0207700_11704458 | Ga0207700_117044582 | 111 |
| 513 | 3300025931 | Ga0207644_10433186 | Ga0207644_104331863 | 111 |
| 514 | 3300025931 | Ga0207644_11107021 | Ga0207644_111070212 | 111 |
| 515 | 3300025932 | Ga0207690_11767929 | Ga0207690_117679292 | 111 |
| 516 | 3300025933 | Ga0207706_11450020 | Ga0207706_114500201 | 111 |
| 517 | 3300025934 | Ga0207686_10907029 | Ga0207686_109070292 | 111 |
| 518 | 3300025936 | Ga0207670_10330746 | Ga0207670_103307463 | 111 |
| 519 | 3300025936 | Ga0207670_10439093 | Ga0207670_104390932 | 111 |
| 520 | 3300025937 | Ga0207669_11591070 | Ga0207669_115910702 | 111 |
| 521 | 3300025938 | Ga0207704_11907057 | Ga0207704_119070571 | 111 |
| 522 | 3300025939 | Ga0207665_10272026 | Ga0207665_102720263 | 111 |
| 523 | 3300025939 | Ga0207665_10445632 | Ga0207665_104456322 | 111 |
| 524 | 3300025940 | Ga0207691_10618568 | Ga0207691_106185682 | 111 |
| 525 | 3300025944 | Ga0207661_12140621 | Ga0207661_121406212 | 111 |
| 526 | 3300025945 | Ga0207679_10094505 | Ga0207679_100945053 | 111 |
| 527 | 3300025949 | Ga0207667_10021411 | Ga0207667_100214116 | 111 |
| 528 | 3300025949 | Ga0207667_10858444 | Ga0207667_108584442 | 111 |
| 529 | 3300025960 | Ga0207651_11490695 | Ga0207651_114906952 | 111 |
| 530 | 3300025981 | Ga0207640_10173737 | Ga0207640_101737372 | 111 |
| 531 | 3300025981 | Ga0207640_11066982 | Ga0207640_110669821 | 111 |
| 532 | 3300026023 | Ga0207677_10888627 | Ga0207677_108886272 | 111 |
| 533 | 3300026035 | Ga0207703_10444773 | Ga0207703_104447731 | 111 |
| 534 | 3300026041 | Ga0207639_11933471 | Ga0207639_119334711 | 111 |
| 535 | 3300026075 | Ga0207708_10626029 | Ga0207708_106260293 | 111 |
| 536 | 3300026075 | Ga0207708_12036747 | Ga0207708_120367471 | 111 |
| 537 | 3300026078 | Ga0207702_10143221 | Ga0207702_101432212 | 111 |
| 538 | 3300026078 | Ga0207702_10213966 | Ga0207702_102139663 | 111 |
| 539 | 3300026089 | Ga0207648_10527645 | Ga0207648_105276452 | 111 |
| 540 | 3300026089 | Ga0207648_10701061 | Ga0207648_107010613 | 111 |
| 541 | 3300026095 | Ga0207676_10999404 | Ga0207676_109994043 | 111 |
| 542 | 3300026116 | Ga0207674_11495557 | Ga0207674_114955572 | 111 |
| 543 | 3300026118 | Ga0207675_100916825 | Ga0207675_1009168253 | 111 |
| 544 | 3300026121 | Ga0207683_10374681 | Ga0207683_103746813 | 111 |
| 545 | 3300026142 | Ga0207698_11233143 | Ga0207698_112331431 | 111 |
| 546 | 3300027866 | Ga0209813_10031933 | Ga0209813_100319332 | 111 |
| 547 | 3300027907 | Ga0207428_10665262 | Ga0207428_106652621 | 111 |
| 548 | 3300028379 | Ga0268266_10011062 | Ga0268266_100110622 | 111 |
| 549 | 3300028379 | Ga0268266_10883551 | Ga0268266_108835512 | 111 |
| 550 | 3300028380 | Ga0268265_11067695 | Ga0268265_110676951 | 111 |
| 551 | 3300028381 | Ga0268264_12689801 | Ga0268264_126898011 | 111 |
| 552 | 3300031238 | Ga0265332_10080306 | Ga0265332_100803061 | 111 |
| 553 | 3300031247 | Ga0265340_10331267 | Ga0265340_103312672 | 111 |
| 554 | 3300031247 | Ga0265340_10428710 | Ga0265340_104287102 | 111 |
| 555 | 3300031249 | Ga0265339_10306235 | Ga0265339_103062352 | 111 |
| 556 | 3300031456 | Ga0307513_10453174 | Ga0307513_104531743 | 111 |
| 557 | 3300031711 | Ga0265314_10224550 | Ga0265314_102245502 | 111 |
| 558 | 3300031712 | Ga0265342_10131690 | Ga0265342_101316902 | 111 |
| 559 | 3300031995 | Ga0307409_101551262 | Ga0307409_1015512622 | 111 |
| 560 | 3300032002 | Ga0307416_100434725 | Ga0307416_1004347252 | 111 |
| 561 | 3300035092 | Ga0373952_0224197 | Ga0373952_0224197_150_485 | 111 |
| 562 | 3300035112 | Ga0373932_0272048 | Ga0373932_0272048_89_424 | 111 |
| 563 | 3300035113 | Ga0373936_0400881 | Ga0373936_0400881_107_442 | 111 |
| 564 | 3300035115 | Ga0373941_0163214 | Ga0373941_0163214_182_517 | 111 |
| 565 | 3300035116 | Ga0373945_0471102 | Ga0373945_0471102_140_475 | 111 |
| 566 | 3300035171 | Ga0373946_0343762 | Ga0373946_0343762_197_532 | 111 |
| 567 | 3300035207 | Ga0373942_0112719 | Ga0373942_0112719_292_627 | 111 |
| 568 | 3300035691 | Ga0373931_0574963 | Ga0373931_0574963_299_634 | 111 |
| 569 | 3300035691 | Ga0373931_0810819 | Ga0373931_0810819_147_482 | 111 |
| 570 | 3300035695 | Ga0373927_0136058 | Ga0373927_0136058_350_685 | 111 |
| 571 | 3300035695 | Ga0373927_0949559 | Ga0373927_0949559_147_482 | 111 |
| 572 | 3300035725 | Ga0373947_0723966 | Ga0373947_0723966_73_408 | 111 |
| 573 | 3300036401 | Ga0373937_0307786 | Ga0373937_0307786_748_1083 | 111 |
| 574 | 3300037068 | Ga0373925_0094048 | Ga0373925_0094048_161_496 | 111 |
| 575 | 3300037312 | Ga0395899_0012914 | Ga0395899_0012914_5139_5474 | 111 |
| 576 | 3300037312 | Ga0395899_0018107 | Ga0395899_0018107_486_821 | 111 |
| 577 | 3300037418 | Ga0395900_0041556 | Ga0395900_0041556_746_1081 | 111 |
| 578 | 3300037418 | Ga0395900_0063433 | Ga0395900_0063433_535_870 | 111 |
| 579 | 3300037418 | Ga0395900_0183837 | Ga0395900_0183837_1749_2084 | 111 |
| 580 | 3300037466 | Ga0395898_0007528 | Ga0395898_0007528_7596_7931 | 111 |
| 581 | 3300037466 | Ga0395898_0009732 | Ga0395898_0009732_8541_8876 | 111 |
| 582 | 3300037471 | Ga0395905_0387326 | Ga0395905_0387326_556_891 | 111 |
| 583 | 3300037471 | Ga0395905_0526040 | Ga0395905_0526040_322_660 | 111 |
| 584 | 3300038443 | Ga0395901_0010972 | Ga0395901_0010972_4720_5055 | 111 |
| 585 | 3300038443 | Ga0395901_0029475 | Ga0395901_0029475_4293_4628 | 111 |
| 586 | 3300038443 | Ga0395901_0909090 | Ga0395901_0909090_39_374 | 111 |
| 587 | 3300039437 | Ga0436365_0349736 | Ga0436365_0349736_197_532 | 111 |
| 588 | 3300039437 | Ga0436365_1270328 | Ga0436365_1270328_82_417 | 111 |
| 589 | 3300039438 | Ga0436360_0362032 | Ga0436360_0362032_4878_5213 | 111 |
| 590 | 3300039438 | Ga0436360_0722676 | Ga0436360_0722676_705_1040 | 111 |
| 591 | 3300039438 | Ga0436360_0890298 | Ga0436360_0890298_72_407 | 111 |
| 592 | 3300039447 | Ga0436361_0349372 | Ga0436361_0349372_2406_2741 | 111 |
| 593 | 3300039447 | Ga0436361_0459654 | Ga0436361_0459654_327_662 | 111 |
| 594 | 3300039447 | Ga0436361_0548464 | Ga0436361_0548464_1270_1605 | 111 |
| 595 | 3300041410 | Ga0439461_0144147 | Ga0439461_0144147_44_379 | 111 |
| 596 | 3300041443 | Ga0451789_0587692 | Ga0451789_0587692_273_608 | 111 |
| 597 | 3300041501 | Ga0451845_0099901 | Ga0451845_0099901_155_490 | 111 |
| 598 | 3300042005 | Ga0439448_0038023 | Ga0439448_0038023_383_718 | 111 |
| 599 | 3300044694 | Ga0466963_0843482 | Ga0466963_0843482_20_355 | 111 |
| 600 | 3300046660 | Ga0495625_0818647 | Ga0495625_0818647_183_521 | 111 |
| 601 | 3300046678 | Ga0495599_0447527 | Ga0495599_0447527_180_515 | 111 |
| 602 | 3300046681 | Ga0495647_0288331 | Ga0495647_0288331_48_383 | 111 |
| 603 | 3300047319 | Ga0495674_0898905 | Ga0495674_0898905_31_366 | 111 |
| 604 | 3300048918 | Ga0496115_1070106 | Ga0496115_1070106_216_551 | 111 |
| 605 | 3300048924 | Ga0496121_0856313 | Ga0496121_0856313_129_464 | 111 |
| 606 | 3300048929 | Ga0496126_0070540 | Ga0496126_0070540_2653_2988 | 111 |
| 607 | 3300049571 | Ga0501034_0008484 | Ga0501034_0008484_5794_6129 | 111 |
| 608 | 3300049571 | Ga0501034_0009970 | Ga0501034_0009970_8492_8827 | 111 |
| 609 | 3300049571 | Ga0501034_0089449 | Ga0501034_0089449_2327_2662 | 111 |
| 610 | 3300049571 | Ga0501034_0224902 | Ga0501034_0224902_246_581 | 111 |
| 611 | 3300049572 | Ga0501036_1633522 | Ga0501036_1633522_142_477 | 111 |
| 612 | 3300049573 | Ga0501037_0463754 | Ga0501037_0463754_330_665 | 111 |
| 613 | 3300049574 | Ga0501038_1104453 | Ga0501038_1104453_87_422 | 111 |
| 614 | 3300049574 | Ga0501038_1105179 | Ga0501038_1105179_11_346 | 111 |
| 615 | 3300049575 | Ga0501039_1095738 | Ga0501039_1095738_184_522 | 111 |
| 616 | 3300049577 | Ga0501041_0485695 | Ga0501041_0485695_372_710 | 111 |
| 617 | 3300049578 | Ga0501042_0052983 | Ga0501042_0052983_1502_1840 | 111 |
| 618 | 3300049580 | Ga0501046_0054053 | Ga0501046_0054053_1722_2057 | 111 |
| 619 | 3300049581 | Ga0501047_0077209 | Ga0501047_0077209_1214_1549 | 111 |
| 620 | 3300049581 | Ga0501047_0079998 | Ga0501047_0079998_1742_2077 | 111 |
| 621 | 3300049581 | Ga0501047_0397267 | Ga0501047_0397267_177_512 | 111 |
| 622 | 3300049582 | Ga0501048_0554301 | Ga0501048_0554301_375_710 | 111 |
| 623 | 3300049582 | Ga0501048_0873220 | Ga0501048_0873220_38_373 | 111 |
| 624 | 3300049585 | Ga0501069_0821800 | Ga0501069_0821800_148_483 | 111 |
| 625 | 3300049586 | Ga0501070_0226824 | Ga0501070_0226824_293_628 | 111 |
| 626 | 3300049588 | Ga0501072_0246561 | Ga0501072_0246561_218_553 | 111 |
| 627 | 3300049591 | Ga0501075_1320437 | Ga0501075_1320437_118_456 | 111 |
| 628 | 3300049742 | Ga0501080_1082269 | Ga0501080_1082269_62_397 | 111 |
| 629 | 3300049822 | Ga0501035_0664061 | Ga0501035_0664061_376_711 | 111 |
| 630 | 3300049823 | Ga0501044_0078024 | Ga0501044_0078024_886_1221 | 111 |
| 631 | 3300049823 | Ga0501044_0366907 | Ga0501044_0366907_675_1010 | 111 |
| 632 | 3300049823 | Ga0501044_0490192 | Ga0501044_0490192_732_1067 | 111 |
| 633 | 3300050489 | nmdc:mga03683_19223_c1 | nmdc:mga03683_19223_c1_954_1289 | 111 |
| 634 | 3300050489 | nmdc:mga03683_19340_c1 | nmdc:mga03683_19340_c1_1668_2003 | 111 |
| 635 | 3300050489 | nmdc:mga03683_4033_c1 | nmdc:mga03683_4033_c1_3208_3543 | 111 |
| 636 | 3300050489 | nmdc:mga03683_73121_c1 | nmdc:mga03683_73121_c1_552_887 | 111 |
| 637 | 3300050490 | nmdc:mga03n38_168735_c1 | nmdc:mga03n38_168735_c1_556_891 | 111 |
| 638 | 3300050490 | nmdc:mga03n38_474206_c1 | nmdc:mga03n38_474206_c1_321_656 | 111 |
| 639 | 3300050491 | nmdc:mga00v17_234283_c1 | nmdc:mga00v17_234283_c1_816_1151 | 111 |
| 640 | 3300050491 | nmdc:mga00v17_569299_c1 | nmdc:mga00v17_569299_c1_334_669 | 111 |
| 641 | 3300050491 | nmdc:mga00v17_609855_c1 | nmdc:mga00v17_609855_c1_323_658 | 111 |
| 642 | 3300050492 | nmdc:mga0yw44_168443_c1 | nmdc:mga0yw44_168443_c1_859_1194 | 111 |
| 643 | 3300050492 | nmdc:mga0yw44_334275_c1 | nmdc:mga0yw44_334275_c1_184_519 | 111 |
| 644 | 3300050492 | nmdc:mga0yw44_4681_c1 | nmdc:mga0yw44_4681_c1_66_401 | 111 |
| 645 | 3300050492 | nmdc:mga0yw44_529186_c1 | nmdc:mga0yw44_529186_c1_308_643 | 111 |
| 646 | 3300050493 | nmdc:mga0k408_24954_c1 | nmdc:mga0k408_24954_c1_448_783 | 111 |
| 647 | 3300050493 | nmdc:mga0k408_259169_c1 | nmdc:mga0k408_259169_c1_330_665 | 111 |
| 648 | 3300050493 | nmdc:mga0k408_342567_c1 | nmdc:mga0k408_342567_c1_399_734 | 111 |
| 649 | 3300050493 | nmdc:mga0k408_81371_c1 | nmdc:mga0k408_81371_c1_1153_1488 | 111 |
| 650 | 3300050494 | nmdc:mga06z11_36298_c1 | nmdc:mga06z11_36298_c1_663_998 | 111 |
| 651 | 3300050495 | nmdc:mga04h51_104065_c1 | nmdc:mga04h51_104065_c1_564_899 | 111 |
| 652 | 3300050496 | nmdc:mga07m45_17798_c1 | nmdc:mga07m45_17798_c1_2546_2881 | 111 |
| 653 | 3300050496 | nmdc:mga07m45_248769_c1 | nmdc:mga07m45_248769_c1_533_868 | 111 |
| 654 | 3300050496 | nmdc:mga07m45_73212_c1 | nmdc:mga07m45_73212_c1_1225_1560 | 111 |
| 655 | 3300050516 | nmdc:mga0sz30_201706_c1 | nmdc:mga0sz30_201706_c1_345_680 | 111 |
| 656 | 3300050516 | nmdc:mga0sz30_3630_c2 | nmdc:mga0sz30_3630_c2_2807_3142 | 111 |
| 657 | 3300050516 | nmdc:mga0sz30_418493_c1 | nmdc:mga0sz30_418493_c1_169_504 | 111 |
| 658 | 3300053077 | Ga0495601_0738730 | Ga0495601_0738730_174_509 | 111 |
| 659 | 3300053091 | Ga0500647_0041290 | Ga0500647_0041290_926_1261 | 111 |
| 660 | 3300053096 | Ga0500641_0000183 | Ga0500641_0000183_3383_3718 | 111 |
| 661 | 3300053130 | Ga0500642_0012558 | Ga0500642_0012558_1082_1420 | 111 |
| 662 | 3300053140 | Ga0500573_0367916 | Ga0500573_0367916_273_611 | 111 |
| 663 | 3300053153 | Ga0500616_0013458 | Ga0500616_0013458_1734_2069 | 111 |
| 664 | 3300053155 | Ga0500620_028811 | Ga0500620_028811_404_739 | 111 |
| 665 | 3300053733 | Ga0500552_000449 | Ga0500552_000449_383_718 | 111 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2y5c-assembly2.cif.gz_B | structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster | 0.9781 | 2 | 105 |
| 2wlb-assembly2.cif.gz_B | adrenodoxin-like ferredoxin etp1fd(516-618) of schizosaccharomyces pombe mitochondria | 0.9701 | 1 | 101 |
| 6nbl-assembly2.cif.gz_D | cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide | 0.9648 | 1 | 105 |
| 1r7s-assembly3.cif.gz_C | putidaredoxin (fe2s2 ferredoxin), c73g mutant | 0.9648 | 3 | 105 |
| 1xlq-assembly4.cif.gz_A | crystal structure of reduced c73s putidaredoxin from pseudomonas putida | 0.9648 | 3 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I756_34_144_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9741 | 2 | 104 | 3.10.20.30 |
| 2wlbB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9701 | 1 | 101 | 3.10.20.30 |
| af_A4I234_54_172_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9683 | 2 | 110 | 3.10.20.30 |
| af_Q9CPW2_55_168_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9641 | 2 | 111 | 3.10.20.30 |
| 1uwmA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9626 | 3 | 105 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522VJV4-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9998 | 1 | 86 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A2V1AYS2-F1-model_v4 | 2Fe-2S ferredoxin-type domain-containing protein | 0.9984 | 2 | 106 |
GO:0005739
GO:0009055 GO:0051537 GO:0140647 |
| AF-A0A4P7WBU6-F1-model_v4 | 2Fe-2S ferredoxin | 0.9981 | 1 | 101 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-K5ZL87-F1-model_v4 | (2Fe-2S) ferredoxin | 0.9974 | 1 | 108 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A0F3MDW9-F1-model_v4 | 2Fe-2S ferredoxin (Adrenodoxin-like protein) | 0.9974 | 16 | 109 |
GO:0009055
GO:0051537 GO:0140647 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar