F473716

General Info

Members Datasets Scaffolds Average Seq Length
665 322 664 110

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0828111|Ga0395900_0828111_45_434
Length 129
Sequence VSSPRAFRTTYTDRNERTVMPKMTFIERDGTRKEVDAPLGLSVLEVAHKHGIDLEGACEGSLACSTCHVIVESDWFELLKDPTEDEEDMLDLAFGLTQTSRLGCQIIMTEELDGLTVSLPAGTRNMMNG

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
199 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
232 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
233 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
234 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
235 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
236 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
237 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
238 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
239 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
240 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
241 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
300 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
301 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
302 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
303 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
306 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
307 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
312 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
313 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
314 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
315 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
316 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
317 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
318 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
321 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
322 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 1.05
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.08
Nodule 0
Rhizoplane 0.75
Rhizosphere 84.21
Stem 0
Stem Tuber 0
Unclassified 4.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10034116 3300003911 Bacteria 1063
2 Ga0065704_10283593 3300005289 Bacteria 917
3 Ga0070676_11003028 3300005328 Bacteria 627
4 Ga0070676_11432135 3300005328 Bacteria 531
5 Ga0070683_100200618 3300005329 Bacteria 1894
6 Ga0070670_101458998 3300005331 Bacteria 628
7 Ga0070680_100011146 3300005336 Bacteria 6952
8 Ga0070680_100241464 3300005336 Bacteria 1527
9 Ga0070682_100296944 3300005337 Bacteria 1184
10 Ga0070682_101123858 3300005337 Bacteria 659
11 Ga0070660_101458349 3300005339 Bacteria 582
12 Ga0070660_101785357 3300005339 Bacteria 524
13 Ga0070689_100386965 3300005340 Bacteria 1180
14 Ga0070691_10004768 3300005341 Bacteria 6172
15 Ga0070687_100832965 3300005343 Bacteria 656
16 Ga0070661_100076995 3300005344 Bacteria 2458
17 Ga0070669_100063124 3300005353 Bacteria 2726
18 Ga0070675_100114628 3300005354 Bacteria 2284
19 Ga0070675_102138301 3300005354 Bacteria 516
20 Ga0070671_101748467 3300005355 Bacteria 552
21 Ga0070671_102094380 3300005355 Bacteria 504
22 Ga0070674_100154692 3300005356 Bacteria 1734
23 Ga0070673_100763167 3300005364 Bacteria 891
24 Ga0070688_100928285 3300005365 Bacteria 688
25 Ga0070659_100037656 3300005366 Bacteria 3771
26 Ga0070667_100500314 3300005367 Bacteria 1114
27 Ga0070667_100899325 3300005367 Bacteria 824
28 Ga0070714_100072203 3300005435 Bacteria 2987
29 Ga0070714_100353744 3300005435 Bacteria 1380
30 Ga0070714_101282697 3300005435 Bacteria 715
31 Ga0070714_102287746 3300005435 Bacteria 526
32 Ga0070713_100011746 3300005436 Bacteria 6394
33 Ga0070713_100110926 3300005436 Bacteria 2391
34 Ga0070713_100220449 3300005436 Bacteria 1720
35 Ga0070713_100309336 3300005436 Bacteria 1457
36 Ga0070710_10030737 3300005437 Bacteria 2892
37 Ga0070710_10059981 3300005437 Bacteria 2162
38 Ga0070710_10457879 3300005437 Bacteria 866
39 Ga0070711_100139384 3300005439 Bacteria 1816
40 Ga0070711_100675859 3300005439 Bacteria 868
41 Ga0070711_101554820 3300005439 Bacteria 578
42 Ga0070678_100031445 3300005456 Bacteria 3662
43 Ga0070678_100090914 3300005456 Bacteria 2341
44 Ga0070662_100397411 3300005457 Bacteria 1137
45 Ga0070681_10007259 3300005458 Bacteria 10812
46 Ga0070681_10099714 3300005458 Bacteria 2850
47 Ga0070681_10142506 3300005458 Bacteria 2326
48 Ga0070681_10197634 3300005458 Bacteria 1929
49 Ga0070681_10371479 3300005458 Bacteria 1340
50 Ga0070681_11610831 3300005458 Bacteria 575
51 Ga0070706_100663818 3300005467 Bacteria 967
52 Ga0070706_101370366 3300005467 Bacteria 648
53 Ga0070707_100072176 3300005468 Bacteria 3327
54 Ga0070698_100000641 3300005471 Bacteria 37565
55 Ga0070698_100474372 3300005471 Bacteria 1188
56 Ga0070698_100972051 3300005471 Bacteria 796
57 Ga0070699_100179098 3300005518 Bacteria 1880
58 Ga0070679_100001462 3300005530 Bacteria 20930
59 Ga0070679_100004471 3300005530 Bacteria 12911
60 Ga0070679_100340059 3300005530 Bacteria 1449
61 Ga0070679_100786514 3300005530 Bacteria 895
62 Ga0070679_101418393 3300005530 Bacteria 641
63 Ga0070679_102164825 3300005530 Bacteria 506
64 Ga0070684_100129754 3300005535 Bacteria 2273
65 Ga0070684_100867420 3300005535 Bacteria 845
66 Ga0070697_100278070 3300005536 Bacteria 1436
67 Ga0068853_100330810 3300005539 Bacteria 1414
68 Ga0068853_101127355 3300005539 Bacteria 757
69 Ga0070672_100048117 3300005543 Bacteria 3312
70 Ga0070672_101534197 3300005543 Bacteria 597
71 Ga0070665_100139250 3300005548 Bacteria 2430
72 Ga0070665_100398548 3300005548 Bacteria 1384
73 Ga0070665_100498618 3300005548 Bacteria 1229
74 Ga0070665_100503145 3300005548 Bacteria 1223
75 Ga0068855_100016016 3300005563 Bacteria 9018
76 Ga0068855_100260762 3300005563 Bacteria 1931
77 Ga0068855_100592469 3300005563 Bacteria 1196
78 Ga0068855_102325954 3300005563 Bacteria 536
79 Ga0070664_100347455 3300005564 Bacteria 1348
80 Ga0068857_100343133 3300005577 Bacteria 1382
81 Ga0068857_101341839 3300005577 Bacteria 695
82 Ga0068854_100137911 3300005578 Bacteria 1869
83 Ga0068854_101147126 3300005578 Bacteria 694
84 Ga0068856_100014010 3300005614 Bacteria 7753
85 Ga0068856_100145975 3300005614 Bacteria 2374
86 Ga0068856_100641202 3300005614 Bacteria 1083
87 Ga0068856_100952846 3300005614 Bacteria 877
88 Ga0070702_101244607 3300005615 Bacteria 602
89 Ga0068852_100087687 3300005616 Bacteria 2777
90 Ga0068859_100087454 3300005617 Bacteria 3164
91 Ga0068859_103068405 3300005617 Bacteria 510
92 Ga0068864_100869617 3300005618 Bacteria 889
93 Ga0068864_101958916 3300005618 Bacteria 592
94 Ga0068851_10264176 3300005834 Bacteria 980
95 Ga0068851_11087968 3300005834 Bacteria 507
96 Ga0068858_100393281 3300005842 Bacteria 1331
97 Ga0068860_102440677 3300005843 Bacteria 543
98 Ga0068862_100291437 3300005844 Bacteria 1499
99 Ga0081455_10000688 3300005937 Bacteria 43874
100 Ga0081455_10009381 3300005937 Bacteria 10066
101 Ga0081455_10365018 3300005937 Bacteria 1014
102 Ga0081540_1030277 3300005983 Bacteria 3000
103 Ga0081540_1067783 3300005983 Bacteria 1665
104 Ga0081539_10007016 3300005985 Bacteria 10450
105 Ga0081539_10010675 3300005985 Bacteria 7408
106 Ga0070717_10024887 3300006028 Bacteria 4756
107 Ga0070717_10144933 3300006028 Bacteria 2051
108 Ga0070717_10546151 3300006028 Bacteria 1049
109 Ga0070717_10792442 3300006028 Bacteria 862
110 Ga0070717_11632208 3300006028 Bacteria 584
111 Ga0070717_11961999 3300006028 Bacteria 528
112 Ga0075365_10026742 3300006038 Bacteria 3666
113 Ga0075365_10242485 3300006038 Bacteria 1266
114 Ga0075365_10468008 3300006038 Bacteria 890
115 Ga0075365_11064830 3300006038 Bacteria 569
116 Ga0075368_10029075 3300006042 Bacteria 2137
117 Ga0075364_10219070 3300006051 Bacteria 1291
118 Ga0075364_10317627 3300006051 Bacteria 1060
119 Ga0075432_10180476 3300006058 Bacteria 826
120 Ga0070715_10790982 3300006163 Bacteria 575
121 Ga0070716_100193903 3300006173 Bacteria 1345
122 Ga0070716_101176149 3300006173 Bacteria 615
123 Ga0070712_100049785 3300006175 Bacteria 2911
124 Ga0070712_100174596 3300006175 Bacteria 1670
125 Ga0070712_100435971 3300006175 Bacteria 1089
126 Ga0075362_10006964 3300006177 Bacteria 4244
127 Ga0075362_10020910 3300006177 Bacteria 2738
128 Ga0075362_10123776 3300006177 Bacteria 1226
129 Ga0075362_10140285 3300006177 Bacteria 1155
130 Ga0075362_10174824 3300006177 Bacteria 1039
131 Ga0075362_10616114 3300006177 Bacteria 562
132 Ga0075367_10009522 3300006178 Bacteria 5082
133 Ga0075367_10029988 3300006178 Bacteria 3115
134 Ga0075367_10331436 3300006178 Bacteria 960
135 Ga0075369_10015552 3300006186 Bacteria 3056
136 Ga0075369_10018239 3300006186 Bacteria 2856
137 Ga0075369_10231094 3300006186 Bacteria 857
138 Ga0075366_10036962 3300006195 Bacteria 2880
139 Ga0075366_10359758 3300006195 Bacteria 894
140 Ga0075366_10870653 3300006195 Bacteria 561
141 Ga0097621_100485764 3300006237 Bacteria 1117
142 Ga0075370_10016237 3300006353 Bacteria 4003
143 Ga0075370_10049140 3300006353 Bacteria 2391
144 Ga0075370_10251888 3300006353 Bacteria 1047
145 Ga0068871_100776988 3300006358 Bacteria 882
146 Ga0075428_100903433 3300006844 Bacteria 937
147 Ga0068865_102033514 3300006881 Bacteria 522
148 Ga0097620_100087451 3300006931 Bacteria 3164
149 Ga0097620_103068391 3300006931 Bacteria 510
150 Ga0075435_100063828 3300007076 Bacteria 2991
151 Ga0075435_101152611 3300007076 Bacteria 678
152 Ga0099794_10204513 3300007265 Bacteria 1012
153 Ga0099795_10004091 3300007788 Bacteria 3717
154 Ga0099795_10520025 3300007788 Bacteria 557
155 Ga0105250_10383631 3300009092 Bacteria 620
156 Ga0105240_10041196 3300009093 Bacteria 5897
157 Ga0105240_10226885 3300009093 Bacteria 2173
158 Ga0105240_10330513 3300009093 Bacteria 1735
159 Ga0105240_10350020 3300009093 Bacteria 1676
160 Ga0105240_10669165 3300009093 Bacteria 1136
161 Ga0105240_10887408 3300009093 Bacteria 960
162 Ga0105240_11323701 3300009093 Bacteria 759
163 Ga0111539_10434078 3300009094 Bacteria 1529
164 Ga0111539_12823958 3300009094 Bacteria 562
165 Ga0105245_10203960 3300009098 Bacteria 1900
166 Ga0105245_11456449 3300009098 Bacteria 735
167 Ga0105247_10549629 3300009101 Bacteria 849
168 Ga0105247_11676759 3300009101 Bacteria 525
169 Ga0105243_11013740 3300009148 Bacteria 834
170 Ga0105241_10916449 3300009174 Bacteria 815
171 Ga0105242_10464400 3300009176 Bacteria 1196
172 Ga0105248_10250080 3300009177 Bacteria 1995
173 Ga0105237_10167177 3300009545 Bacteria 2198
174 Ga0105237_11035124 3300009545 Bacteria 828
175 Ga0105237_11222290 3300009545 Bacteria 758
176 Ga0105238_10057501 3300009551 Bacteria 3899
177 Ga0105238_10196387 3300009551 Bacteria 1994
178 Ga0105238_10219118 3300009551 Bacteria 1879
179 Ga0105238_11605360 3300009551 Bacteria 680
180 Ga0105238_12974812 3300009551 Bacteria 509
181 Ga0105035_101266 3300009988 Bacteria 1721
182 Ga0099796_10003440 3300010159 Bacteria 3673
183 Ga0105239_10853651 3300010375 Bacteria 1044
184 Ga0105239_11038259 3300010375 Bacteria 943
185 Ga0105239_11050471 3300010375 Bacteria 937
186 Ga0105239_11437621 3300010375 Unclassified 796
187 Ga0105239_11602060 3300010375 Bacteria 753
188 Ga0105239_13249760 3300010375 Bacteria 529
189 Ga0157373_10066839 3300013100 Bacteria 2542
190 Ga0157373_10102685 3300013100 Bacteria 2012
191 Ga0157373_10573386 3300013100 Bacteria 820
192 Ga0157371_10117854 3300013102 Bacteria 1887
193 Ga0157371_10415541 3300013102 Bacteria 986
194 Ga0157370_10019744 3300013104 Bacteria 6746
195 Ga0157370_10410267 3300013104 Bacteria 1246
196 Ga0157370_10625503 3300013104 Bacteria 985
197 Ga0157369_10020086 3300013105 Bacteria 7471
198 Ga0157369_10350166 3300013105 Bacteria 1534
199 Ga0157369_10459304 3300013105 Bacteria 1318
200 Ga0157374_10151595 3300013296 Bacteria 2254
201 Ga0157374_10395854 3300013296 Bacteria 1377
202 Ga0157374_10624215 3300013296 Bacteria 1089
203 Ga0157374_11286931 3300013296 Bacteria 753
204 Ga0157374_11443990 3300013296 Bacteria 711
205 Ga0157378_10092332 3300013297 Bacteria 2754
206 Ga0157378_10323498 3300013297 Bacteria 1499
207 Ga0157378_11545918 3300013297 Bacteria 709
208 Ga0157378_12295875 3300013297 Bacteria 591
209 Ga0157372_10137200 3300013307 Bacteria 2817
210 Ga0157372_12696930 3300013307 Bacteria 570
211 Ga0157375_12163476 3300013308 Bacteria 662
212 Ga0157375_12797947 3300013308 Bacteria 583
213 Ga0157515_116762 3300013875 Bacteria 940
214 Ga0163163_10083133 3300014325 Bacteria 3206
215 Ga0163163_10840000 3300014325 Bacteria 982
216 Ga0163163_11891514 3300014325 Bacteria 657
217 Ga0157380_11837932 3300014326 Bacteria 665
218 Ga0182008_10395070 3300014497 Bacteria 742
219 Ga0182008_10550526 3300014497 Bacteria 641
220 Ga0157379_10884466 3300014968 Bacteria 847
221 Ga0157379_11393208 3300014968 Bacteria 679
222 Ga0157379_12532557 3300014968 Bacteria 513
223 Ga0157379_12563752 3300014968 Bacteria 510
224 Ga0163161_10594122 3300017792 Bacteria 912
225 Ga0197907_11228939 3300020069 Bacteria 741
226 Ga0206355_1585110 3300020076 Bacteria 603
227 Ga0206353_11950597 3300020082 Bacteria 804
228 Ga0154015_1267117 3300020610 Bacteria 535
229 Ga0213873_10056701 3300021358 Bacteria 1051
230 Ga0213872_10056033 3300021361 Bacteria 1786
231 Ga0213872_10242688 3300021361 Bacteria 761
232 Ga0213874_10018944 3300021377 Bacteria 1867
233 Ga0213876_10226281 3300021384 Bacteria 994
234 Ga0213875_10000253 3300021388 Bacteria 53621
235 Ga0213875_10001582 3300021388 Bacteria 14506
236 Ga0213875_10056169 3300021388 Bacteria 1844
237 Ga0213875_10123940 3300021388 Bacteria 1207
238 Ga0213871_10003685 3300021441 Bacteria 2987
239 Ga0213871_10010990 3300021441 Bacteria 2068
240 Ga0213871_10131587 3300021441 Bacteria 751
241 Ga0213871_10172580 3300021441 Bacteria 666
242 Ga0213871_10205762 3300021441 Bacteria 615
243 Ga0224712_10050002 3300022467 Bacteria 1622
244 Ga0209676_1000256 3300025292 Bacteria 112819
245 Ga0209050_1011492 3300025298 Bacteria 4188
246 Ga0207426_1026821 3300025302 Bacteria 1925
247 Ga0207426_1049303 3300025302 Bacteria 1261
248 Ga0207697_10195581 3300025315 Bacteria 888
249 Ga0207697_10319707 3300025315 Bacteria 689
250 Ga0207656_10102313 3300025321 Bacteria 1315
251 Ga0207653_10034017 3300025885 Bacteria 1654
252 Ga0207692_10262871 3300025898 Bacteria 1038
253 Ga0207692_10704860 3300025898 Bacteria 655
254 Ga0207642_11054872 3300025899 Bacteria 524
255 Ga0207710_10621855 3300025900 Bacteria 565
256 Ga0207688_10078557 3300025901 Bacteria 1881
257 Ga0207680_10515880 3300025903 Bacteria 852
258 Ga0207647_10134893 3300025904 Bacteria 1449
259 Ga0207647_10374812 3300025904 Bacteria 804
260 Ga0207699_10089415 3300025906 Bacteria 1930
261 Ga0207699_10105476 3300025906 Bacteria 1797
262 Ga0207699_10272901 3300025906 Bacteria 1172
263 Ga0207645_10817055 3300025907 Bacteria 634
264 Ga0207643_10450241 3300025908 Bacteria 819
265 Ga0207705_10099719 3300025909 Bacteria 2136
266 Ga0207705_10150357 3300025909 Bacteria 1745
267 Ga0207684_10271395 3300025910 Bacteria 1463
268 Ga0207684_10572679 3300025910 Bacteria 965
269 Ga0207684_11177093 3300025910 Bacteria 635
270 Ga0207707_10015024 3300025912 Bacteria 6742
271 Ga0207707_10183121 3300025912 Bacteria 1828
272 Ga0207707_10253734 3300025912 Bacteria 1527
273 Ga0207707_10261457 3300025912 Bacteria 1502
274 Ga0207707_10375367 3300025912 Bacteria 1223
275 Ga0207695_10234562 3300025913 Bacteria 1738
276 Ga0207695_10243724 3300025913 Bacteria 1698
277 Ga0207695_10270929 3300025913 Bacteria 1593
278 Ga0207695_10442983 3300025913 Bacteria 1182
279 Ga0207671_10244839 3300025914 Bacteria 1409
280 Ga0207671_11538467 3300025914 Bacteria 513
281 Ga0207693_10001602 3300025915 Bacteria 20022
282 Ga0207693_10005635 3300025915 Bacteria 10413
283 Ga0207693_10033797 3300025915 Bacteria 4034
284 Ga0207693_10067257 3300025915 Bacteria 2805
285 Ga0207693_10305738 3300025915 Bacteria 1245
286 Ga0207693_10828333 3300025915 Bacteria 712
287 Ga0207663_10036453 3300025916 Bacteria 2959
288 Ga0207663_10252127 3300025916 Bacteria 1299
289 Ga0207663_10433005 3300025916 Bacteria 1011
290 Ga0207663_10518933 3300025916 Bacteria 928
291 Ga0207660_10090086 3300025917 Bacteria 2272
292 Ga0207660_10153117 3300025917 Bacteria 1773
293 Ga0207660_10281049 3300025917 Bacteria 1321
294 Ga0207660_10514987 3300025917 Bacteria 971
295 Ga0207660_10784176 3300025917 Bacteria 778
296 Ga0207662_10675507 3300025918 Bacteria 723
297 Ga0207657_10310018 3300025919 Bacteria 1249
298 Ga0207657_11514352 3300025919 Bacteria 501
299 Ga0207649_10069979 3300025920 Bacteria 2236
300 Ga0207652_10036904 3300025921 Bacteria 4133
301 Ga0207652_10111086 3300025921 Bacteria 2431
302 Ga0207652_10152348 3300025921 Bacteria 2071
303 Ga0207652_10202211 3300025921 Bacteria 1788
304 Ga0207652_10995018 3300025921 Bacteria 737
305 Ga0207652_11020728 3300025921 Bacteria 726
306 Ga0207652_11616747 3300025921 Bacteria 552
307 Ga0207646_11071323 3300025922 Bacteria 710
308 Ga0207681_10645849 3300025923 Bacteria 877
309 Ga0207694_10262322 3300025924 Bacteria 1415
310 Ga0207694_10584148 3300025924 Bacteria 939
311 Ga0207694_10932248 3300025924 Bacteria 734
312 Ga0207659_10096793 3300025926 Bacteria 2216
313 Ga0207687_10379221 3300025927 Bacteria 1158
314 Ga0207700_10073917 3300025928 Bacteria 2634
315 Ga0207700_10123102 3300025928 Bacteria 2106
316 Ga0207700_10294079 3300025928 Bacteria 1400
317 Ga0207700_10622409 3300025928 Bacteria 961
318 Ga0207700_11322383 3300025928 Bacteria 642
319 Ga0207700_11704458 3300025928 Bacteria 556
320 Ga0207664_10014469 3300025929 Bacteria 5698
321 Ga0207664_10971621 3300025929 Bacteria 761
322 Ga0207664_11382384 3300025929 Bacteria 624
323 Ga0207664_11760750 3300025929 Bacteria 542
324 Ga0207664_11879993 3300025929 Bacteria 521
325 Ga0207644_10433186 3300025931 Bacteria 1079
326 Ga0207644_11107021 3300025931 Bacteria 666
327 Ga0207644_11756465 3300025931 Bacteria 519
328 Ga0207690_10087281 3300025932 Bacteria 2195
329 Ga0207690_11767929 3300025932 Bacteria 516
330 Ga0207706_11450020 3300025933 Bacteria 562
331 Ga0207686_10907029 3300025934 Bacteria 711
332 Ga0207670_10330746 3300025936 Bacteria 1201
333 Ga0207670_10439093 3300025936 Bacteria 1050
334 Ga0207669_10223824 3300025937 Bacteria 1383
335 Ga0207669_11591070 3300025937 Bacteria 558
336 Ga0207704_11907057 3300025938 Bacteria 511
337 Ga0207665_10272026 3300025939 Bacteria 1258
338 Ga0207665_10445632 3300025939 Bacteria 993
339 Ga0207691_10568881 3300025940 Bacteria 960
340 Ga0207691_10618568 3300025940 Bacteria 916
341 Ga0207661_12140621 3300025944 Bacteria 505
342 Ga0207679_10094505 3300025945 Bacteria 2321
343 Ga0207679_10630758 3300025945 Bacteria 968
344 Ga0207679_10893511 3300025945 Bacteria 812
345 Ga0207667_10021411 3300025949 Bacteria 7165
346 Ga0207667_10330034 3300025949 Bacteria 1557
347 Ga0207667_10858444 3300025949 Bacteria 902
348 Ga0207651_10668400 3300025960 Bacteria 913
349 Ga0207651_11490695 3300025960 Bacteria 609
350 Ga0207640_10112810 3300025981 Bacteria 1931
351 Ga0207640_10173737 3300025981 Bacteria 1608
352 Ga0207640_10713513 3300025981 Bacteria 861
353 Ga0207640_11066982 3300025981 Bacteria 713
354 Ga0207677_10423435 3300026023 Bacteria 1135
355 Ga0207677_10888627 3300026023 Bacteria 803
356 Ga0207703_10444773 3300026035 Bacteria 1210
357 Ga0207639_11933471 3300026041 Bacteria 551
358 Ga0207708_10626029 3300026075 Bacteria 914
359 Ga0207708_12036747 3300026075 Bacteria 502
360 Ga0207702_10119240 3300026078 Bacteria 2359
361 Ga0207702_10143221 3300026078 Bacteria 2166
362 Ga0207702_10213966 3300026078 Bacteria 1793
363 Ga0207702_11381849 3300026078 Bacteria 698
364 Ga0207702_11539940 3300026078 Bacteria 658
365 Ga0207702_11651298 3300026078 Bacteria 634
366 Ga0207641_11177140 3300026088 Bacteria 766
367 Ga0207648_10527645 3300026089 Bacteria 1082
368 Ga0207648_10701061 3300026089 Bacteria 938
369 Ga0207676_10607945 3300026095 Bacteria 1051
370 Ga0207676_10999404 3300026095 Bacteria 824
371 Ga0207674_10177351 3300026116 Bacteria 2083
372 Ga0207674_11213394 3300026116 Bacteria 724
373 Ga0207674_11495557 3300026116 Bacteria 644
374 Ga0207675_100916825 3300026118 Bacteria 893
375 Ga0207683_10116426 3300026121 Bacteria 2396
376 Ga0207683_10374681 3300026121 Bacteria 1308
377 Ga0207698_11233143 3300026142 Bacteria 762
378 Ga0209813_10031933 3300027866 Bacteria 1557
379 Ga0207428_10665262 3300027907 Bacteria 747
380 Ga0268266_10011062 3300028379 Bacteria 7857
381 Ga0268266_10883551 3300028379 Bacteria 864
382 Ga0268265_11067695 3300028380 Bacteria 800
383 Ga0268264_12689801 3300028381 Bacteria 501
384 Ga0307517_10008012 3300028786 Bacteria 15244
385 Ga0265338_10110497 3300028800 Bacteria 2215
386 Ga0265764_114217 3300030882 Bacteria 537
387 Ga0265332_10080306 3300031238 Bacteria 1384
388 Ga0265340_10331267 3300031247 Bacteria 673
389 Ga0265340_10428710 3300031247 Bacteria 583
390 Ga0265339_10244811 3300031249 Bacteria 870
391 Ga0265339_10306235 3300031249 Bacteria 757
392 Ga0265327_10016206 3300031251 Bacteria 4752
393 Ga0265327_10077979 3300031251 Bacteria 1642
394 Ga0265316_10155618 3300031344 Bacteria 1711
395 Ga0307513_10453174 3300031456 Bacteria 1007
396 Ga0265313_10068075 3300031595 Bacteria 1646
397 Ga0265314_10224550 3300031711 Bacteria 1094
398 Ga0265342_10131690 3300031712 Bacteria 1401
399 Ga0307406_11266050 3300031901 Bacteria 643
400 Ga0307412_10780127 3300031911 Bacteria 828
401 Ga0307409_101551262 3300031995 Bacteria 690
402 Ga0307416_100434725 3300032002 Bacteria 1361
403 Ga0316053_108997 3300032120 Bacteria 681
404 Ga0373926_0138843 3300035083 Bacteria 923
405 Ga0373940_0354956 3300035088 Bacteria 515
406 Ga0373944_0248171 3300035089 Bacteria 656
407 Ga0373952_0224197 3300035092 Bacteria 560
408 Ga0373932_0272048 3300035112 Bacteria 624
409 Ga0373936_0046845 3300035113 Bacteria 1743
410 Ga0373936_0400881 3300035113 Bacteria 630
411 Ga0373941_0163214 3300035115 Bacteria 825
412 Ga0373945_0165035 3300035116 Bacteria 905
413 Ga0373945_0343941 3300035116 Bacteria 646
414 Ga0373945_0471102 3300035116 Bacteria 557
415 Ga0373953_0023627 3300035117 Bacteria 2328
416 Ga0373954_0063587 3300035118 Bacteria 1744
417 Ga0373956_0119709 3300035119 Bacteria 1229
418 Ga0373957_0255623 3300035120 Bacteria 738
419 Ga0373957_0490840 3300035120 Bacteria 534
420 Ga0373957_0504062 3300035120 Bacteria 527
421 Ga0373943_0066903 3300035170 Bacteria 1811
422 Ga0373943_0526444 3300035170 Bacteria 692
423 Ga0373946_0343762 3300035171 Bacteria 745
424 Ga0373946_0515281 3300035171 Bacteria 614
425 Ga0373955_0029777 3300035172 Bacteria 2843
426 Ga0373955_0042579 3300035172 Bacteria 2439
427 Ga0373955_0144379 3300035172 Bacteria 1397
428 Ga0373955_0306388 3300035172 Bacteria 958
429 Ga0373955_0578731 3300035172 Bacteria 687
430 Ga0373955_0675506 3300035172 Bacteria 634
431 Ga0373942_0112719 3300035207 Bacteria 842
432 Ga0373924_0026438 3300035410 Bacteria 2302
433 Ga0373924_0142703 3300035410 Bacteria 1045
434 Ga0373931_0574963 3300035691 Bacteria 734
435 Ga0373931_0810819 3300035691 Bacteria 625
436 Ga0373935_0279179 3300035692 Bacteria 1176
437 Ga0373935_0331225 3300035692 Bacteria 1082
438 Ga0373927_0051388 3300035695 Bacteria 2665
439 Ga0373927_0136058 3300035695 Bacteria 1606
440 Ga0373927_0235275 3300035695 Bacteria 1204
441 Ga0373927_0949559 3300035695 Bacteria 567
442 Ga0373927_1087803 3300035695 Bacteria 527
443 Ga0373927_1177878 3300035695 Bacteria 505
444 Ga0373933_0023266 3300035724 Bacteria 3538
445 Ga0373933_0025398 3300035724 Bacteria 3397
446 Ga0373933_0036405 3300035724 Bacteria 2880
447 Ga0373933_0352553 3300035724 Bacteria 956
448 Ga0373947_0063328 3300035725 Bacteria 2253
449 Ga0373947_0113888 3300035725 Bacteria 1712
450 Ga0373947_0380510 3300035725 Bacteria 950
451 Ga0373947_0723966 3300035725 Bacteria 679
452 Ga0373937_0002848 3300036401 Bacteria 14448
453 Ga0373937_0013547 3300036401 Bacteria 7182
454 Ga0373937_0033495 3300036401 Bacteria 4666
455 Ga0373937_0039758 3300036401 Bacteria 4286
456 Ga0373937_0067697 3300036401 Bacteria 3291
457 Ga0373937_0227153 3300036401 Bacteria 1757
458 Ga0373937_0307786 3300036401 Bacteria 1498
459 Ga0373937_0625329 3300036401 Bacteria 1022
460 Ga0373925_0094048 3300037068 Bacteria 2295
461 Ga0373925_0257352 3300037068 Bacteria 1401
462 Ga0373925_0418843 3300037068 Bacteria 1094
463 Ga0395899_0012914 3300037312 Bacteria 6392
464 Ga0395899_0018107 3300037312 Bacteria 5360
465 Ga0395900_0041556 3300037418 Bacteria 4740
466 Ga0395900_0063433 3300037418 Bacteria 3798
467 Ga0395900_0183837 3300037418 Bacteria 2122
468 Ga0395900_0785651 3300037418 Bacteria 881
469 Ga0395900_0828111 3300037418 Bacteria 852
470 Ga0395900_1000555 3300037418 Bacteria 756
471 Ga0395898_0007528 3300037466 Bacteria 11573
472 Ga0395898_0009732 3300037466 Bacteria 10080
473 Ga0395905_0125747 3300037471 Bacteria 2411
474 Ga0395905_0387326 3300037471 Bacteria 1292
475 Ga0395905_0526040 3300037471 Bacteria 1083
476 Ga0436364_0266271 3300037853 Bacteria 210347
477 Ga0436364_0278369 3300037853 Bacteria 585
478 Ga0436364_0503141 3300037853 Bacteria 962
479 Ga0436364_0574986 3300037853 Bacteria 2579
480 Ga0436364_0694410 3300037853 Bacteria 38233
481 Ga0436364_0921350 3300037853 Bacteria 1284
482 Ga0436364_1344478 3300037853 Bacteria 3078
483 Ga0395901_0010972 3300038443 Bacteria 9178
484 Ga0395901_0029475 3300038443 Bacteria 5651
485 Ga0395901_0909090 3300038443 Bacteria 861
486 Ga0395901_1771223 3300038443 Bacteria 567
487 Ga0436365_0349736 3300039437 Bacteria 598
488 Ga0436365_0472578 3300039437 Bacteria 627
489 Ga0436365_0762128 3300039437 Bacteria 1687
490 Ga0436365_1270328 3300039437 Bacteria 771
491 Ga0436365_1498663 3300039437 Bacteria 1107
492 Ga0436365_1607597 3300039437 Bacteria 938
493 Ga0436365_1691575 3300039437 Bacteria 2097
494 Ga0436365_1717840 3300039437 Bacteria 1782
495 Ga0436360_0107958 3300039438 Bacteria 2399
496 Ga0436360_0185552 3300039438 Bacteria 992
497 Ga0436360_0213506 3300039438 Bacteria 3259
498 Ga0436360_0220240 3300039438 Bacteria 1763
499 Ga0436360_0362032 3300039438 Bacteria 15021
500 Ga0436360_0523890 3300039438 Bacteria 604
501 Ga0436360_0532696 3300039438 Bacteria 1681
502 Ga0436360_0544531 3300039438 Bacteria 1599
503 Ga0436360_0722676 3300039438 Bacteria 1222
504 Ga0436360_0811977 3300039438 Bacteria 3564
505 Ga0436360_0846745 3300039438 Bacteria 926
506 Ga0436360_0890298 3300039438 Bacteria 1199
507 Ga0436360_1217323 3300039438 Bacteria 640
508 Ga0436361_0160412 3300039447 Bacteria 1902
509 Ga0436361_0349372 3300039447 Bacteria 4018
510 Ga0436361_0459654 3300039447 Bacteria 893
511 Ga0436361_0548464 3300039447 Bacteria 2385
512 Ga0436361_1087383 3300039447 Bacteria 1358
513 Ga0436363_0206965 3300039450 Bacteria 653
514 Ga0436363_0724362 3300039450 Bacteria 1110
515 Ga0436363_1670359 3300039450 Bacteria 553
516 Ga0436363_1712732 3300039450 Bacteria 617
517 Ga0436362_0310010 3300039453 Bacteria 633
518 Ga0436362_0552323 3300039453 Bacteria 1185
519 Ga0436362_0619579 3300039453 Bacteria 1158
520 Ga0436362_1230386 3300039453 Bacteria 709
521 Ga0436362_1243951 3300039453 Bacteria 1260
522 Ga0439447_000506 3300041407 Bacteria 14503
523 Ga0439461_0144147 3300041410 Bacteria 611
524 Ga0439466_0003497 3300041411 Bacteria 6084
525 Ga0451789_0587692 3300041443 Bacteria 669
526 Ga0451845_0099901 3300041501 Bacteria 642
527 Ga0439448_0038023 3300042005 Bacteria 1548
528 Ga0439432_201494 3300042006 Bacteria 577
529 Ga0439452_000097 3300042010 Bacteria 74034
530 Ga0450902_012822 3300042137 Bacteria 1345
531 Ga0450905_039778 3300042142 Bacteria 745
532 Ga0466972_0455923 3300044658 Bacteria 601
533 Ga0466966_0968959 3300044684 Bacteria 513
534 Ga0466963_0475424 3300044694 Bacteria 882
535 Ga0466963_0680755 3300044694 Bacteria 726
536 Ga0466963_0843482 3300044694 Bacteria 646
537 Ga0466970_0496133 3300044765 Bacteria 703
538 Ga0466957_0164205 3300044842 Bacteria 1444
539 Ga0451576_0002195 3300045051 Bacteria 30092
540 Ga0466958_0447755 3300045836 Bacteria 836
541 Ga0466967_0394288 3300045976 Bacteria 1346
542 Ga0466967_1395781 3300045976 Bacteria 698
543 Ga0466967_2313715 3300045976 Bacteria 533
544 Ga0495592_0566504 3300046454 Bacteria 697
545 Ga0495651_0135202 3300046462 Bacteria 1795
546 Ga0495651_0283741 3300046462 Bacteria 1117
547 Ga0495650_0068027 3300046471 Bacteria 1406
548 Ga0495580_0529932 3300046472 Bacteria 784
549 Ga0495608_0004971 3300046511 Bacteria 9513
550 Ga0495608_0035177 3300046511 Bacteria 3380
551 Ga0495618_0159236 3300046514 Bacteria 1440
552 Ga0495628_0128019 3300046516 Bacteria 1944
553 Ga0495628_0144741 3300046516 Bacteria 1812
554 Ga0495652_0112773 3300046529 Bacteria 2183
555 Ga0495652_0210142 3300046529 Bacteria 1470
556 Ga0495640_0899280 3300046533 Bacteria 525
557 Ga0495587_0044169 3300046536 Bacteria 2651
558 Ga0495587_0047441 3300046536 Bacteria 2547
559 Ga0495667_0018054 3300046559 Bacteria 4766
560 Ga0495667_0019733 3300046559 Bacteria 4549
561 Ga0495625_0818647 3300046660 Bacteria 540
562 Ga0495635_0228593 3300046663 Bacteria 1257
563 Ga0495635_0758946 3300046663 Bacteria 627
564 Ga0495657_0383813 3300046675 Bacteria 828
565 Ga0495599_0010184 3300046678 Bacteria 5755
566 Ga0495599_0078299 3300046678 Bacteria 2064
567 Ga0495599_0447527 3300046678 Bacteria 765
568 Ga0495623_0139254 3300046679 Bacteria 1445
569 Ga0495646_0064683 3300046680 Bacteria 2167
570 Ga0495647_0288331 3300046681 Bacteria 738
571 Ga0495658_1098178 3300046683 Bacteria 507
572 Ga0495600_0137659 3300046809 Bacteria 1585
573 Ga0495600_0236438 3300046809 Bacteria 1165
574 Ga0495674_0162896 3300047319 Bacteria 1865
575 Ga0495674_0211242 3300047319 Bacteria 1607
576 Ga0495674_0898905 3300047319 Bacteria 684
577 Ga0495680_0051468 3300047322 Bacteria 3215
578 Ga0495680_0355063 3300047322 Bacteria 1020
579 Ga0495675_0043815 3300047444 Bacteria 2850
580 Ga0495684_0838773 3300047471 Bacteria 597
581 Ga0495602_0000143 3300048088 Bacteria 66782
582 Ga0495602_0302086 3300048088 Bacteria 1171
583 Ga0496109_0897786 3300048912 Bacteria 824
584 Ga0496112_0422058 3300048915 Bacteria 1273
585 Ga0496115_0160603 3300048918 Bacteria 1857
586 Ga0496115_1070106 3300048918 Bacteria 613
587 Ga0496121_0856313 3300048924 Bacteria 528
588 Ga0496122_0194255 3300048925 Bacteria 1194
589 Ga0496126_0070540 3300048929 Bacteria 3113
590 Ga0496126_0747768 3300048929 Bacteria 755
591 Ga0501034_0008484 3300049571 Bacteria 10852
592 Ga0501034_0009970 3300049571 Bacteria 9928
593 Ga0501034_0089449 3300049571 Bacteria 3077
594 Ga0501034_0224902 3300049571 Bacteria 1828
595 Ga0501036_1633522 3300049572 Bacteria 520
596 Ga0501037_0463754 3300049573 Bacteria 863
597 Ga0501038_1104453 3300049574 Bacteria 579
598 Ga0501038_1105179 3300049574 Bacteria 579
599 Ga0501039_1095738 3300049575 Bacteria 617
600 Ga0501041_0485695 3300049577 Bacteria 785
601 Ga0501042_0052983 3300049578 Bacteria 2895
602 Ga0501043_0875651 3300049579 Bacteria 645
603 Ga0501046_0054053 3300049580 Bacteria 3161
604 Ga0501047_0077209 3300049581 Bacteria 3205
605 Ga0501047_0079998 3300049581 Bacteria 3142
606 Ga0501047_0397267 3300049581 Bacteria 1212
607 Ga0501048_0554301 3300049582 Bacteria 825
608 Ga0501048_0873220 3300049582 Bacteria 647
609 Ga0501069_0821800 3300049585 Bacteria 564
610 Ga0501070_0137899 3300049586 Bacteria 2014
611 Ga0501070_0226824 3300049586 Bacteria 1531
612 Ga0501072_0246561 3300049588 Bacteria 1423
613 Ga0501073_0438393 3300049589 Bacteria 903
614 Ga0501075_1320437 3300049591 Bacteria 547
615 Ga0501080_0403010 3300049742 Bacteria 1230
616 Ga0501080_1082269 3300049742 Bacteria 693
617 Ga0501035_0664061 3300049822 Bacteria 844
618 Ga0501035_0872133 3300049822 Bacteria 715
619 Ga0501044_0078024 3300049823 Bacteria 3357
620 Ga0501044_0366907 3300049823 Bacteria 1357
621 Ga0501044_0490192 3300049823 Bacteria 1131
622 Ga0501044_0896576 3300049823 Bacteria 762
623 nmdc:mga03683_19223_c1 3300050489 Bacteria 2606
624 nmdc:mga03683_19340_c1 3300050489 Bacteria 2599
625 nmdc:mga03683_4033_c1 3300050489 Bacteria 4817
626 nmdc:mga03683_73121_c1 3300050489 Bacteria 1469
627 nmdc:mga03n38_168735_c1 3300050490 Bacteria 1113
628 nmdc:mga03n38_474206_c1 3300050490 Bacteria 699
629 nmdc:mga00v17_234283_c1 3300050491 Bacteria 1190
630 nmdc:mga00v17_569299_c1 3300050491 Bacteria 732
631 nmdc:mga00v17_609855_c1 3300050491 Bacteria 703
632 nmdc:mga0yw44_168443_c1 3300050492 Bacteria 1437
633 nmdc:mga0yw44_334275_c1 3300050492 Bacteria 1018
634 nmdc:mga0yw44_4681_c1 3300050492 Bacteria 6323
635 nmdc:mga0yw44_529186_c1 3300050492 Bacteria 800
636 nmdc:mga0k408_24954_c1 3300050493 Bacteria 3382
637 nmdc:mga0k408_259169_c1 3300050493 Bacteria 1038
638 nmdc:mga0k408_342567_c1 3300050493 Bacteria 891
639 nmdc:mga0k408_81371_c1 3300050493 Bacteria 1896
640 nmdc:mga06z11_36298_c1 3300050494 Bacteria 2433
641 nmdc:mga04h51_104065_c1 3300050495 Bacteria 1038
642 nmdc:mga07m45_17798_c1 3300050496 Bacteria 3823
643 nmdc:mga07m45_248769_c1 3300050496 Bacteria 1034
644 nmdc:mga07m45_73212_c1 3300050496 Bacteria 1950
645 nmdc:mga0sz30_201706_c1 3300050516 Bacteria 883
646 nmdc:mga0sz30_29924_c1 3300050516 Bacteria 1822
647 nmdc:mga0sz30_3630_c2 3300050516 Bacteria 3328
648 nmdc:mga0sz30_418493_c1 3300050516 Bacteria 601
649 Ga0495601_0013940 3300053077 Bacteria 4841
650 Ga0495601_0457071 3300053077 Bacteria 826
651 Ga0495601_0738730 3300053077 Bacteria 627
652 Ga0495595_0012504 3300053084 Bacteria 3570
653 Ga0495619_0016874 3300053085 Bacteria 4624
654 Ga0500646_0187259 3300053090 Bacteria 704
655 Ga0500647_0041290 3300053091 Bacteria 2213
656 Ga0500641_0000183 3300053096 Bacteria 23609
657 Ga0500650_0197948 3300053098 Bacteria 916
658 Ga0500642_0012558 3300053130 Bacteria 3078
659 Ga0500559_0059996 3300053136 Bacteria 1694
660 Ga0500573_0367916 3300053140 Unclassified 692
661 Ga0500588_0000178 3300053146 Bacteria 8711
662 Ga0500616_0013458 3300053153 Bacteria 4748
663 Ga0500620_028811 3300053155 Bacteria 1740
664 Ga0500552_000449 3300053733 Bacteria 3788

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10102685 Ga0157373_101026853 105
2 3300041407 Ga0439447_000506 Ga0439447_000506_3589_3909 105
3 3300041411 Ga0439466_0003497 Ga0439466_0003497_4391_4711 105
4 3300042006 Ga0439432_201494 Ga0439432_201494_173_493 105
5 3300042010 Ga0439452_000097 Ga0439452_000097_68771_69091 105
6 3300042137 Ga0450902_012822 Ga0450902_012822_507_827 105
7 3300042142 Ga0450905_039778 Ga0450905_039778_165_485 105
8 iso_pu_bacteria 8054002106 8054004624 105
9 3300013297 Ga0157378_10092332 Ga0157378_100923322 106
10 3300028786 Ga0307517_10008012 Ga0307517_1000801215 106
11 3300039447 Ga0436361_0160412 Ga0436361_0160412_325_645 106
12 3300046471 Ga0495650_0068027 Ga0495650_0068027_726_1055 106
13 3300005435 Ga0070714_100072203 Ga0070714_1000722034 107
14 3300005436 Ga0070713_100220449 Ga0070713_1002204493 107
15 3300005436 Ga0070713_100309336 Ga0070713_1003093362 107
16 3300005439 Ga0070711_100675859 Ga0070711_1006758592 107
17 3300005439 Ga0070711_101554820 Ga0070711_1015548202 107
18 3300005543 Ga0070672_101534197 Ga0070672_1015341972 107
19 3300005614 Ga0068856_100952846 Ga0068856_1009528462 107
20 3300006028 Ga0070717_10024887 Ga0070717_100248875 107
21 3300006173 Ga0070716_100193903 Ga0070716_1001939032 107
22 3300006173 Ga0070716_101176149 Ga0070716_1011761492 107
23 3300006175 Ga0070712_100049785 Ga0070712_1000497854 107
24 3300006175 Ga0070712_100435971 Ga0070712_1004359712 107
25 3300007076 Ga0075435_100063828 Ga0075435_1000638285 107
26 3300009093 Ga0105240_10669165 Ga0105240_106691652 107
27 3300014497 Ga0182008_10550526 Ga0182008_105505262 107
28 3300021384 Ga0213876_10226281 Ga0213876_102262812 107
29 3300025906 Ga0207699_10089415 Ga0207699_100894152 107
30 3300025906 Ga0207699_10105476 Ga0207699_101054762 107
31 3300025915 Ga0207693_10001602 Ga0207693_1000160218 107
32 3300025915 Ga0207693_10067257 Ga0207693_100672572 107
33 3300025916 Ga0207663_10036453 Ga0207663_100364533 107
34 3300025916 Ga0207663_10433005 Ga0207663_104330052 107
35 3300025928 Ga0207700_10073917 Ga0207700_100739173 107
36 3300025928 Ga0207700_10123102 Ga0207700_101231022 107
37 3300025928 Ga0207700_11322383 Ga0207700_113223832 107
38 3300025929 Ga0207664_10014469 Ga0207664_100144694 107
39 3300025929 Ga0207664_11879993 Ga0207664_118799931 107
40 3300025931 Ga0207644_11756465 Ga0207644_117564652 107
41 3300026078 Ga0207702_11381849 Ga0207702_113818492 107
42 3300026088 Ga0207641_11177140 Ga0207641_111771402 107
43 3300035116 Ga0373945_0343941 Ga0373945_0343941_94_417 107
44 3300035120 Ga0373957_0504062 Ga0373957_0504062_38_361 107
45 3300035172 Ga0373955_0306388 Ga0373955_0306388_136_459 107
46 3300035692 Ga0373935_0279179 Ga0373935_0279179_724_1047 107
47 3300035724 Ga0373933_0023266 Ga0373933_0023266_3181_3504 107
48 3300036401 Ga0373937_0002848 Ga0373937_0002848_11839_12162 107
49 3300037471 Ga0395905_0125747 Ga0395905_0125747_509_832 107
50 3300039437 Ga0436365_1717840 Ga0436365_1717840_576_899 107
51 3300039438 Ga0436360_0107958 Ga0436360_0107958_165_488 107
52 3300039438 Ga0436360_0544531 Ga0436360_0544531_20_343 107
53 3300039447 Ga0436361_1087383 Ga0436361_1087383_435_758 107
54 3300039450 Ga0436363_0206965 Ga0436363_0206965_49_372 107
55 3300044694 Ga0466963_0680755 Ga0466963_0680755_35_358 107
56 3300048929 Ga0496126_0747768 Ga0496126_0747768_363_686 107
57 3300050516 nmdc:mga0sz30_29924_c1 nmdc:mga0sz30_29924_c1_778_1101 107
58 3300053136 Ga0500559_0059996 Ga0500559_0059996_26_349 107
59 3300005548 Ga0070665_100498618 Ga0070665_1004986182 108
60 3300025940 Ga0207691_10568881 Ga0207691_105688812 108
61 3300005289 Ga0065704_10283593 Ga0065704_102835932 109
62 3300010375 Ga0105239_11437621 Ga0105239_114376211 109
63 3300013308 Ga0157375_12797947 Ga0157375_127979471 109
64 3300020069 Ga0197907_11228939 Ga0197907_112289392 109
65 3300037853 Ga0436364_0921350 Ga0436364_0921350_320_649 109
66 3300048925 Ga0496122_0194255 Ga0496122_0194255_527_856 109
67 3300049589 Ga0501073_0438393 Ga0501073_0438393_148_477 109
68 3300049823 Ga0501044_0896576 Ga0501044_0896576_244_573 109
69 3300005336 Ga0070680_100241464 Ga0070680_1002414642 110
70 3300005337 Ga0070682_100296944 Ga0070682_1002969443 110
71 3300005337 Ga0070682_101123858 Ga0070682_1011238581 110
72 3300005343 Ga0070687_100832965 Ga0070687_1008329651 110
73 3300005354 Ga0070675_102138301 Ga0070675_1021383012 110
74 3300005355 Ga0070671_101748467 Ga0070671_1017484672 110
75 3300005355 Ga0070671_102094380 Ga0070671_1020943801 110
76 3300005356 Ga0070674_100154692 Ga0070674_1001546922 110
77 3300005366 Ga0070659_100037656 Ga0070659_1000376564 110
78 3300005367 Ga0070667_100899325 Ga0070667_1008993252 110
79 3300005435 Ga0070714_100353744 Ga0070714_1003537442 110
80 3300005435 Ga0070714_101282697 Ga0070714_1012826971 110
81 3300005435 Ga0070714_102287746 Ga0070714_1022877461 110
82 3300005436 Ga0070713_100110926 Ga0070713_1001109263 110
83 3300005437 Ga0070710_10030737 Ga0070710_100307374 110
84 3300005437 Ga0070710_10059981 Ga0070710_100599812 110
85 3300005437 Ga0070710_10457879 Ga0070710_104578792 110
86 3300005439 Ga0070711_100139384 Ga0070711_1001393842 110
87 3300005456 Ga0070678_100090914 Ga0070678_1000909142 110
88 3300005458 Ga0070681_10099714 Ga0070681_100997142 110
89 3300005458 Ga0070681_10142506 Ga0070681_101425062 110
90 3300005458 Ga0070681_10371479 Ga0070681_103714792 110
91 3300005458 Ga0070681_11610831 Ga0070681_116108311 110
92 3300005467 Ga0070706_101370366 Ga0070706_1013703662 110
93 3300005471 Ga0070698_100474372 Ga0070698_1004743722 110
94 3300005471 Ga0070698_100972051 Ga0070698_1009720512 110
95 3300005518 Ga0070699_100179098 Ga0070699_1001790982 110
96 3300005530 Ga0070679_100001462 Ga0070679_10000146221 110
97 3300005530 Ga0070679_100786514 Ga0070679_1007865142 110
98 3300005530 Ga0070679_101418393 Ga0070679_1014183932 110
99 3300005530 Ga0070679_102164825 Ga0070679_1021648251 110
100 3300005535 Ga0070684_100867420 Ga0070684_1008674202 110
101 3300005548 Ga0070665_100398548 Ga0070665_1003985482 110
102 3300005563 Ga0068855_100260762 Ga0068855_1002607621 110
103 3300005563 Ga0068855_102325954 Ga0068855_1023259542 110
104 3300005577 Ga0068857_101341839 Ga0068857_1013418392 110
105 3300005578 Ga0068854_100137911 Ga0068854_1001379112 110
106 3300005578 Ga0068854_101147126 Ga0068854_1011471262 110
107 3300005614 Ga0068856_100641202 Ga0068856_1006412022 110
108 3300005615 Ga0070702_101244607 Ga0070702_1012446072 110
109 3300005618 Ga0068864_100869617 Ga0068864_1008696172 110
110 3300005834 Ga0068851_11087968 Ga0068851_110879681 110
111 3300005843 Ga0068860_102440677 Ga0068860_1024406772 110
112 3300005937 Ga0081455_10365018 Ga0081455_103650182 110
113 3300005983 Ga0081540_1067783 Ga0081540_10677832 110
114 3300006028 Ga0070717_10144933 Ga0070717_101449332 110
115 3300006028 Ga0070717_10546151 Ga0070717_105461512 110
116 3300006028 Ga0070717_10792442 Ga0070717_107924422 110
117 3300006028 Ga0070717_11632208 Ga0070717_116322082 110
118 3300006028 Ga0070717_11961999 Ga0070717_119619992 110
119 3300006175 Ga0070712_100174596 Ga0070712_1001745962 110
120 3300006237 Ga0097621_100485764 Ga0097621_1004857641 110
121 3300007788 Ga0099795_10004091 Ga0099795_100040914 110
122 3300007788 Ga0099795_10520025 Ga0099795_105200252 110
123 3300009093 Ga0105240_10330513 Ga0105240_103305131 110
124 3300009093 Ga0105240_10350020 Ga0105240_103500203 110
125 3300009093 Ga0105240_10887408 Ga0105240_108874082 110
126 3300009093 Ga0105240_11323701 Ga0105240_113237012 110
127 3300009098 Ga0105245_10203960 Ga0105245_102039602 110
128 3300009101 Ga0105247_11676759 Ga0105247_116767592 110
129 3300009174 Ga0105241_10916449 Ga0105241_109164491 110
130 3300009176 Ga0105242_10464400 Ga0105242_104644002 110
131 3300009177 Ga0105248_10250080 Ga0105248_102500801 110
132 3300009545 Ga0105237_11035124 Ga0105237_110351242 110
133 3300009551 Ga0105238_10219118 Ga0105238_102191182 110
134 3300009551 Ga0105238_11605360 Ga0105238_116053602 110
135 3300010159 Ga0099796_10003440 Ga0099796_100034404 110
136 3300010375 Ga0105239_10853651 Ga0105239_108536512 110
137 3300010375 Ga0105239_11602060 Ga0105239_116020601 110
138 3300010375 Ga0105239_13249760 Ga0105239_132497602 110
139 3300013100 Ga0157373_10573386 Ga0157373_105733861 110
140 3300013104 Ga0157370_10019744 Ga0157370_100197442 110
141 3300013105 Ga0157369_10020086 Ga0157369_1002008610 110
142 3300013105 Ga0157369_10350166 Ga0157369_103501662 110
143 3300013105 Ga0157369_10459304 Ga0157369_104593041 110
144 3300013296 Ga0157374_10395854 Ga0157374_103958542 110
145 3300013296 Ga0157374_10624215 Ga0157374_106242152 110
146 3300013296 Ga0157374_11443990 Ga0157374_114439902 110
147 3300013297 Ga0157378_11545918 Ga0157378_115459182 110
148 3300013297 Ga0157378_12295875 Ga0157378_122958752 110
149 3300014325 Ga0163163_10083133 Ga0163163_100831334 110
150 3300014325 Ga0163163_10840000 Ga0163163_108400002 110
151 3300014325 Ga0163163_11891514 Ga0163163_118915141 110
152 3300014968 Ga0157379_10884466 Ga0157379_108844662 110
153 3300014968 Ga0157379_12532557 Ga0157379_125325572 110
154 3300014968 Ga0157379_12563752 Ga0157379_125637522 110
155 3300017792 Ga0163161_10594122 Ga0163161_105941222 110
156 3300020076 Ga0206355_1585110 Ga0206355_15851102 110
157 3300021358 Ga0213873_10056701 Ga0213873_100567012 110
158 3300021377 Ga0213874_10018944 Ga0213874_100189443 110
159 3300021388 Ga0213875_10000253 Ga0213875_1000025330 110
160 3300021388 Ga0213875_10001582 Ga0213875_1000158210 110
161 3300021388 Ga0213875_10056169 Ga0213875_100561692 110
162 3300021388 Ga0213875_10123940 Ga0213875_101239402 110
163 3300021441 Ga0213871_10010990 Ga0213871_100109902 110
164 3300021441 Ga0213871_10131587 Ga0213871_101315872 110
165 3300021441 Ga0213871_10172580 Ga0213871_101725802 110
166 3300021441 Ga0213871_10205762 Ga0213871_102057622 110
167 3300022467 Ga0224712_10050002 Ga0224712_100500024 110
168 3300025292 Ga0209676_1000256 Ga0209676_100025677 110
169 3300025298 Ga0209050_1011492 Ga0209050_10114922 110
170 3300025885 Ga0207653_10034017 Ga0207653_100340173 110
171 3300025898 Ga0207692_10262871 Ga0207692_102628712 110
172 3300025898 Ga0207692_10704860 Ga0207692_107048602 110
173 3300025900 Ga0207710_10621855 Ga0207710_106218552 110
174 3300025904 Ga0207647_10134893 Ga0207647_101348932 110
175 3300025904 Ga0207647_10374812 Ga0207647_103748122 110
176 3300025906 Ga0207699_10272901 Ga0207699_102729013 110
177 3300025910 Ga0207684_11177093 Ga0207684_111770932 110
178 3300025912 Ga0207707_10015024 Ga0207707_100150242 110
179 3300025912 Ga0207707_10253734 Ga0207707_102537342 110
180 3300025912 Ga0207707_10261457 Ga0207707_102614572 110
181 3300025913 Ga0207695_10270929 Ga0207695_102709293 110
182 3300025913 Ga0207695_10442983 Ga0207695_104429832 110
183 3300025914 Ga0207671_11538467 Ga0207671_115384672 110
184 3300025915 Ga0207693_10005635 Ga0207693_100056356 110
185 3300025915 Ga0207693_10033797 Ga0207693_100337973 110
186 3300025915 Ga0207693_10305738 Ga0207693_103057382 110
187 3300025915 Ga0207693_10828333 Ga0207693_108283331 110
188 3300025916 Ga0207663_10252127 Ga0207663_102521272 110
189 3300025916 Ga0207663_10518933 Ga0207663_105189331 110
190 3300025917 Ga0207660_10090086 Ga0207660_100900861 110
191 3300025917 Ga0207660_10281049 Ga0207660_102810492 110
192 3300025917 Ga0207660_10514987 Ga0207660_105149873 110
193 3300025917 Ga0207660_10784176 Ga0207660_107841762 110
194 3300025918 Ga0207662_10675507 Ga0207662_106755071 110
195 3300025919 Ga0207657_11514352 Ga0207657_115143521 110
196 3300025921 Ga0207652_10036904 Ga0207652_100369044 110
197 3300025921 Ga0207652_10111086 Ga0207652_101110863 110
198 3300025921 Ga0207652_10152348 Ga0207652_101523482 110
199 3300025921 Ga0207652_10202211 Ga0207652_102022112 110
200 3300025921 Ga0207652_11616747 Ga0207652_116167472 110
201 3300025924 Ga0207694_10932248 Ga0207694_109322482 110
202 3300025927 Ga0207687_10379221 Ga0207687_103792212 110
203 3300025928 Ga0207700_10294079 Ga0207700_102940792 110
204 3300025928 Ga0207700_10622409 Ga0207700_106224092 110
205 3300025929 Ga0207664_10971621 Ga0207664_109716212 110
206 3300025929 Ga0207664_11382384 Ga0207664_113823842 110
207 3300025929 Ga0207664_11760750 Ga0207664_117607501 110
208 3300025932 Ga0207690_10087281 Ga0207690_100872813 110
209 3300025937 Ga0207669_10223824 Ga0207669_102238242 110
210 3300025945 Ga0207679_10630758 Ga0207679_106307582 110
211 3300025945 Ga0207679_10893511 Ga0207679_108935112 110
212 3300025949 Ga0207667_10330034 Ga0207667_103300344 110
213 3300025960 Ga0207651_10668400 Ga0207651_106684001 110
214 3300025981 Ga0207640_10112810 Ga0207640_101128102 110
215 3300025981 Ga0207640_10713513 Ga0207640_107135132 110
216 3300026023 Ga0207677_10423435 Ga0207677_104234352 110
217 3300026078 Ga0207702_10119240 Ga0207702_101192401 110
218 3300026078 Ga0207702_11539940 Ga0207702_115399402 110
219 3300026078 Ga0207702_11651298 Ga0207702_116512982 110
220 3300026095 Ga0207676_10607945 Ga0207676_106079452 110
221 3300026116 Ga0207674_10177351 Ga0207674_101773513 110
222 3300026116 Ga0207674_11213394 Ga0207674_112133942 110
223 3300026121 Ga0207683_10116426 Ga0207683_101164262 110
224 3300028800 Ga0265338_10110497 Ga0265338_101104972 110
225 3300030882 Ga0265764_114217 Ga0265764_1142172 110
226 3300031249 Ga0265339_10244811 Ga0265339_102448111 110
227 3300031251 Ga0265327_10016206 Ga0265327_100162065 110
228 3300031251 Ga0265327_10077979 Ga0265327_100779792 110
229 3300031344 Ga0265316_10155618 Ga0265316_101556181 110
230 3300031595 Ga0265313_10068075 Ga0265313_100680752 110
231 3300031901 Ga0307406_11266050 Ga0307406_112660501 110
232 3300031911 Ga0307412_10780127 Ga0307412_107801272 110
233 3300032120 Ga0316053_108997 Ga0316053_1089972 110
234 3300035083 Ga0373926_0138843 Ga0373926_0138843_465_797 110
235 3300035088 Ga0373940_0354956 Ga0373940_0354956_74_406 110
236 3300035089 Ga0373944_0248171 Ga0373944_0248171_117_449 110
237 3300035113 Ga0373936_0046845 Ga0373936_0046845_1369_1701 110
238 3300035116 Ga0373945_0165035 Ga0373945_0165035_154_486 110
239 3300035117 Ga0373953_0023627 Ga0373953_0023627_1752_2084 110
240 3300035118 Ga0373954_0063587 Ga0373954_0063587_1153_1485 110
241 3300035119 Ga0373956_0119709 Ga0373956_0119709_98_430 110
242 3300035120 Ga0373957_0255623 Ga0373957_0255623_221_553 110
243 3300035120 Ga0373957_0490840 Ga0373957_0490840_46_378 110
244 3300035170 Ga0373943_0066903 Ga0373943_0066903_25_357 110
245 3300035170 Ga0373943_0526444 Ga0373943_0526444_118_450 110
246 3300035171 Ga0373946_0515281 Ga0373946_0515281_83_415 110
247 3300035172 Ga0373955_0029777 Ga0373955_0029777_1267_1599 110
248 3300035172 Ga0373955_0042579 Ga0373955_0042579_487_819 110
249 3300035172 Ga0373955_0144379 Ga0373955_0144379_257_589 110
250 3300035172 Ga0373955_0578731 Ga0373955_0578731_33_365 110
251 3300035172 Ga0373955_0675506 Ga0373955_0675506_152_484 110
252 3300035410 Ga0373924_0026438 Ga0373924_0026438_1086_1418 110
253 3300035410 Ga0373924_0142703 Ga0373924_0142703_544_876 110
254 3300035692 Ga0373935_0331225 Ga0373935_0331225_62_394 110
255 3300035695 Ga0373927_0051388 Ga0373927_0051388_324_656 110
256 3300035695 Ga0373927_0235275 Ga0373927_0235275_441_773 110
257 3300035695 Ga0373927_1087803 Ga0373927_1087803_178_510 110
258 3300035695 Ga0373927_1177878 Ga0373927_1177878_144_476 110
259 3300035724 Ga0373933_0025398 Ga0373933_0025398_1150_1482 110
260 3300035724 Ga0373933_0036405 Ga0373933_0036405_1953_2285 110
261 3300035724 Ga0373933_0352553 Ga0373933_0352553_270_602 110
262 3300035725 Ga0373947_0063328 Ga0373947_0063328_1176_1508 110
263 3300035725 Ga0373947_0113888 Ga0373947_0113888_1251_1583 110
264 3300035725 Ga0373947_0380510 Ga0373947_0380510_419_751 110
265 3300036401 Ga0373937_0013547 Ga0373937_0013547_3599_3931 110
266 3300036401 Ga0373937_0033495 Ga0373937_0033495_1380_1712 110
267 3300036401 Ga0373937_0039758 Ga0373937_0039758_660_992 110
268 3300036401 Ga0373937_0067697 Ga0373937_0067697_2250_2582 110
269 3300036401 Ga0373937_0227153 Ga0373937_0227153_1191_1523 110
270 3300036401 Ga0373937_0625329 Ga0373937_0625329_487_819 110
271 3300037068 Ga0373925_0257352 Ga0373925_0257352_229_561 110
272 3300037068 Ga0373925_0418843 Ga0373925_0418843_639_971 110
273 3300037418 Ga0395900_0785651 Ga0395900_0785651_71_403 110
274 3300037418 Ga0395900_0828111 Ga0395900_0828111_45_434 110
275 3300037418 Ga0395900_1000555 Ga0395900_1000555_10_342 110
276 3300037853 Ga0436364_0266271 Ga0436364_0266271_91899_92231 110
277 3300037853 Ga0436364_0278369 Ga0436364_0278369_120_455 110
278 3300037853 Ga0436364_0503141 Ga0436364_0503141_161_493 110
279 3300037853 Ga0436364_0574986 Ga0436364_0574986_1362_1694 110
280 3300037853 Ga0436364_0694410 Ga0436364_0694410_24120_24452 110
281 3300037853 Ga0436364_1344478 Ga0436364_1344478_2251_2583 110
282 3300038443 Ga0395901_1771223 Ga0395901_1771223_10_342 110
283 3300039437 Ga0436365_0472578 Ga0436365_0472578_35_367 110
284 3300039437 Ga0436365_0762128 Ga0436365_0762128_55_387 110
285 3300039437 Ga0436365_1498663 Ga0436365_1498663_165_497 110
286 3300039437 Ga0436365_1607597 Ga0436365_1607597_212_544 110
287 3300039437 Ga0436365_1691575 Ga0436365_1691575_1545_1877 110
288 3300039438 Ga0436360_0185552 Ga0436360_0185552_530_862 110
289 3300039438 Ga0436360_0213506 Ga0436360_0213506_2278_2610 110
290 3300039438 Ga0436360_0220240 Ga0436360_0220240_660_992 110
291 3300039438 Ga0436360_0523890 Ga0436360_0523890_36_368 110
292 3300039438 Ga0436360_0532696 Ga0436360_0532696_536_868 110
293 3300039438 Ga0436360_0811977 Ga0436360_0811977_1753_2085 110
294 3300039438 Ga0436360_0846745 Ga0436360_0846745_461_793 110
295 3300039438 Ga0436360_1217323 Ga0436360_1217323_122_454 110
296 3300039450 Ga0436363_0724362 Ga0436363_0724362_91_423 110
297 3300039450 Ga0436363_1670359 Ga0436363_1670359_128_460 110
298 3300039450 Ga0436363_1712732 Ga0436363_1712732_192_524 110
299 3300039453 Ga0436362_0310010 Ga0436362_0310010_113_445 110
300 3300039453 Ga0436362_0552323 Ga0436362_0552323_93_425 110
301 3300039453 Ga0436362_0619579 Ga0436362_0619579_427_759 110
302 3300039453 Ga0436362_1230386 Ga0436362_1230386_42_374 110
303 3300039453 Ga0436362_1243951 Ga0436362_1243951_195_527 110
304 3300044658 Ga0466972_0455923 Ga0466972_0455923_143_475 110
305 3300044684 Ga0466966_0968959 Ga0466966_0968959_21_353 110
306 3300044694 Ga0466963_0475424 Ga0466963_0475424_142_474 110
307 3300044765 Ga0466970_0496133 Ga0466970_0496133_53_385 110
308 3300044842 Ga0466957_0164205 Ga0466957_0164205_221_553 110
309 3300045051 Ga0451576_0002195 Ga0451576_0002195_11513_11845 110
310 3300045836 Ga0466958_0447755 Ga0466958_0447755_145_477 110
311 3300045976 Ga0466967_0394288 Ga0466967_0394288_942_1274 110
312 3300045976 Ga0466967_1395781 Ga0466967_1395781_130_462 110
313 3300045976 Ga0466967_2313715 Ga0466967_2313715_153_485 110
314 3300046454 Ga0495592_0566504 Ga0495592_0566504_169_501 110
315 3300046462 Ga0495651_0135202 Ga0495651_0135202_243_575 110
316 3300046462 Ga0495651_0283741 Ga0495651_0283741_444_776 110
317 3300046472 Ga0495580_0529932 Ga0495580_0529932_414_746 110
318 3300046511 Ga0495608_0004971 Ga0495608_0004971_8983_9315 110
319 3300046511 Ga0495608_0035177 Ga0495608_0035177_1459_1791 110
320 3300046514 Ga0495618_0159236 Ga0495618_0159236_217_549 110
321 3300046516 Ga0495628_0128019 Ga0495628_0128019_1276_1608 110
322 3300046516 Ga0495628_0144741 Ga0495628_0144741_1202_1534 110
323 3300046529 Ga0495652_0112773 Ga0495652_0112773_598_930 110
324 3300046529 Ga0495652_0210142 Ga0495652_0210142_851_1183 110
325 3300046533 Ga0495640_0899280 Ga0495640_0899280_62_394 110
326 3300046536 Ga0495587_0044169 Ga0495587_0044169_633_965 110
327 3300046536 Ga0495587_0047441 Ga0495587_0047441_626_958 110
328 3300046559 Ga0495667_0018054 Ga0495667_0018054_3423_3755 110
329 3300046559 Ga0495667_0019733 Ga0495667_0019733_1205_1537 110
330 3300046663 Ga0495635_0228593 Ga0495635_0228593_342_674 110
331 3300046663 Ga0495635_0758946 Ga0495635_0758946_188_520 110
332 3300046675 Ga0495657_0383813 Ga0495657_0383813_79_411 110
333 3300046678 Ga0495599_0010184 Ga0495599_0010184_3674_4006 110
334 3300046678 Ga0495599_0078299 Ga0495599_0078299_1671_2003 110
335 3300046679 Ga0495623_0139254 Ga0495623_0139254_543_875 110
336 3300046680 Ga0495646_0064683 Ga0495646_0064683_1101_1433 110
337 3300046683 Ga0495658_1098178 Ga0495658_1098178_145_477 110
338 3300046809 Ga0495600_0137659 Ga0495600_0137659_675_1007 110
339 3300046809 Ga0495600_0236438 Ga0495600_0236438_798_1130 110
340 3300047319 Ga0495674_0162896 Ga0495674_0162896_1438_1770 110
341 3300047319 Ga0495674_0211242 Ga0495674_0211242_905_1237 110
342 3300047322 Ga0495680_0051468 Ga0495680_0051468_1107_1439 110
343 3300047322 Ga0495680_0355063 Ga0495680_0355063_320_652 110
344 3300047444 Ga0495675_0043815 Ga0495675_0043815_1364_1696 110
345 3300047471 Ga0495684_0838773 Ga0495684_0838773_104_436 110
346 3300048088 Ga0495602_0000143 Ga0495602_0000143_27237_27569 110
347 3300048088 Ga0495602_0302086 Ga0495602_0302086_207_539 110
348 3300048912 Ga0496109_0897786 Ga0496109_0897786_96_428 110
349 3300048915 Ga0496112_0422058 Ga0496112_0422058_297_629 110
350 3300048918 Ga0496115_0160603 Ga0496115_0160603_92_424 110
351 3300049579 Ga0501043_0875651 Ga0501043_0875651_235_567 110
352 3300049586 Ga0501070_0137899 Ga0501070_0137899_1172_1504 110
353 3300049742 Ga0501080_0403010 Ga0501080_0403010_623_955 110
354 3300049822 Ga0501035_0872133 Ga0501035_0872133_200_532 110
355 3300053077 Ga0495601_0013940 Ga0495601_0013940_1085_1417 110
356 3300053077 Ga0495601_0457071 Ga0495601_0457071_70_402 110
357 3300053084 Ga0495595_0012504 Ga0495595_0012504_2163_2495 110
358 3300053085 Ga0495619_0016874 Ga0495619_0016874_3118_3450 110
359 3300053090 Ga0500646_0187259 Ga0500646_0187259_166_498 110
360 3300053098 Ga0500650_0197948 Ga0500650_0197948_477_809 110
361 3300053146 Ga0500588_0000178 Ga0500588_0000178_3155_3487 110
362 3300003911 JGI25405J52794_10034116 JGI25405J52794_100341162 111
363 3300005328 Ga0070676_11003028 Ga0070676_110030282 111
364 3300005328 Ga0070676_11432135 Ga0070676_114321351 111
365 3300005329 Ga0070683_100200618 Ga0070683_1002006183 111
366 3300005331 Ga0070670_101458998 Ga0070670_1014589982 111
367 3300005336 Ga0070680_100011146 Ga0070680_1000111468 111
368 3300005339 Ga0070660_101458349 Ga0070660_1014583491 111
369 3300005339 Ga0070660_101785357 Ga0070660_1017853571 111
370 3300005340 Ga0070689_100386965 Ga0070689_1003869653 111
371 3300005341 Ga0070691_10004768 Ga0070691_100047688 111
372 3300005344 Ga0070661_100076995 Ga0070661_1000769954 111
373 3300005353 Ga0070669_100063124 Ga0070669_1000631243 111
374 3300005354 Ga0070675_100114628 Ga0070675_1001146284 111
375 3300005364 Ga0070673_100763167 Ga0070673_1007631672 111
376 3300005365 Ga0070688_100928285 Ga0070688_1009282852 111
377 3300005367 Ga0070667_100500314 Ga0070667_1005003142 111
378 3300005436 Ga0070713_100011746 Ga0070713_1000117462 111
379 3300005456 Ga0070678_100031445 Ga0070678_1000314455 111
380 3300005457 Ga0070662_100397411 Ga0070662_1003974112 111
381 3300005458 Ga0070681_10007259 Ga0070681_100072592 111
382 3300005458 Ga0070681_10197634 Ga0070681_101976342 111
383 3300005467 Ga0070706_100663818 Ga0070706_1006638182 111
384 3300005468 Ga0070707_100072176 Ga0070707_1000721762 111
385 3300005471 Ga0070698_100000641 Ga0070698_1000006417 111
386 3300005530 Ga0070679_100004471 Ga0070679_10000447111 111
387 3300005530 Ga0070679_100340059 Ga0070679_1003400592 111
388 3300005535 Ga0070684_100129754 Ga0070684_1001297543 111
389 3300005536 Ga0070697_100278070 Ga0070697_1002780703 111
390 3300005539 Ga0068853_100330810 Ga0068853_1003308103 111
391 3300005539 Ga0068853_101127355 Ga0068853_1011273552 111
392 3300005543 Ga0070672_100048117 Ga0070672_1000481173 111
393 3300005548 Ga0070665_100139250 Ga0070665_1001392504 111
394 3300005548 Ga0070665_100503145 Ga0070665_1005031453 111
395 3300005563 Ga0068855_100016016 Ga0068855_10001601610 111
396 3300005563 Ga0068855_100592469 Ga0068855_1005924692 111
397 3300005564 Ga0070664_100347455 Ga0070664_1003474552 111
398 3300005577 Ga0068857_100343133 Ga0068857_1003431333 111
399 3300005614 Ga0068856_100014010 Ga0068856_1000140106 111
400 3300005614 Ga0068856_100145975 Ga0068856_1001459752 111
401 3300005616 Ga0068852_100087687 Ga0068852_1000876872 111
402 3300005617 Ga0068859_100087454 Ga0068859_1000874542 111
403 3300005617 Ga0068859_103068405 Ga0068859_1030684051 111
404 3300005618 Ga0068864_101958916 Ga0068864_1019589161 111
405 3300005834 Ga0068851_10264176 Ga0068851_102641762 111
406 3300005842 Ga0068858_100393281 Ga0068858_1003932812 111
407 3300005844 Ga0068862_100291437 Ga0068862_1002914372 111
408 3300005937 Ga0081455_10000688 Ga0081455_1000068813 111
409 3300005937 Ga0081455_10009381 Ga0081455_100093818 111
410 3300005983 Ga0081540_1030277 Ga0081540_10302774 111
411 3300005985 Ga0081539_10007016 Ga0081539_1000701612 111
412 3300005985 Ga0081539_10010675 Ga0081539_100106756 111
413 3300006038 Ga0075365_10026742 Ga0075365_100267425 111
414 3300006038 Ga0075365_10242485 Ga0075365_102424853 111
415 3300006038 Ga0075365_10468008 Ga0075365_104680083 111
416 3300006038 Ga0075365_11064830 Ga0075365_110648302 111
417 3300006042 Ga0075368_10029075 Ga0075368_100290752 111
418 3300006051 Ga0075364_10219070 Ga0075364_102190703 111
419 3300006051 Ga0075364_10317627 Ga0075364_103176272 111
420 3300006058 Ga0075432_10180476 Ga0075432_101804762 111
421 3300006163 Ga0070715_10790982 Ga0070715_107909821 111
422 3300006177 Ga0075362_10006964 Ga0075362_100069642 111
423 3300006177 Ga0075362_10020910 Ga0075362_100209102 111
424 3300006177 Ga0075362_10123776 Ga0075362_101237762 111
425 3300006177 Ga0075362_10140285 Ga0075362_101402852 111
426 3300006177 Ga0075362_10174824 Ga0075362_101748242 111
427 3300006177 Ga0075362_10616114 Ga0075362_106161142 111
428 3300006178 Ga0075367_10009522 Ga0075367_100095224 111
429 3300006178 Ga0075367_10029988 Ga0075367_100299883 111
430 3300006178 Ga0075367_10331436 Ga0075367_103314363 111
431 3300006186 Ga0075369_10015552 Ga0075369_100155524 111
432 3300006186 Ga0075369_10018239 Ga0075369_100182393 111
433 3300006186 Ga0075369_10231094 Ga0075369_102310943 111
434 3300006195 Ga0075366_10036962 Ga0075366_100369624 111
435 3300006195 Ga0075366_10359758 Ga0075366_103597582 111
436 3300006195 Ga0075366_10870653 Ga0075366_108706532 111
437 3300006353 Ga0075370_10016237 Ga0075370_100162376 111
438 3300006353 Ga0075370_10049140 Ga0075370_100491403 111
439 3300006353 Ga0075370_10251888 Ga0075370_102518882 111
440 3300006358 Ga0068871_100776988 Ga0068871_1007769882 111
441 3300006844 Ga0075428_100903433 Ga0075428_1009034332 111
442 3300006881 Ga0068865_102033514 Ga0068865_1020335141 111
443 3300006931 Ga0097620_100087451 Ga0097620_1000874515 111
444 3300006931 Ga0097620_103068391 Ga0097620_1030683911 111
445 3300007076 Ga0075435_101152611 Ga0075435_1011526112 111
446 3300007265 Ga0099794_10204513 Ga0099794_102045133 111
447 3300009092 Ga0105250_10383631 Ga0105250_103836311 111
448 3300009093 Ga0105240_10041196 Ga0105240_100411962 111
449 3300009093 Ga0105240_10226885 Ga0105240_102268854 111
450 3300009094 Ga0111539_10434078 Ga0111539_104340782 111
451 3300009094 Ga0111539_12823958 Ga0111539_128239582 111
452 3300009098 Ga0105245_11456449 Ga0105245_114564492 111
453 3300009101 Ga0105247_10549629 Ga0105247_105496292 111
454 3300009148 Ga0105243_11013740 Ga0105243_110137402 111
455 3300009545 Ga0105237_10167177 Ga0105237_101671774 111
456 3300009545 Ga0105237_11222290 Ga0105237_112222902 111
457 3300009551 Ga0105238_10057501 Ga0105238_100575012 111
458 3300009551 Ga0105238_10196387 Ga0105238_101963873 111
459 3300009551 Ga0105238_12974812 Ga0105238_129748121 111
460 3300009988 Ga0105035_101266 Ga0105035_1012663 111
461 3300010375 Ga0105239_11038259 Ga0105239_110382591 111
462 3300010375 Ga0105239_11050471 Ga0105239_110504712 111
463 3300013100 Ga0157373_10066839 Ga0157373_100668394 111
464 3300013102 Ga0157371_10117854 Ga0157371_101178542 111
465 3300013102 Ga0157371_10415541 Ga0157371_104155412 111
466 3300013104 Ga0157370_10410267 Ga0157370_104102672 111
467 3300013104 Ga0157370_10625503 Ga0157370_106255032 111
468 3300013296 Ga0157374_10151595 Ga0157374_101515952 111
469 3300013296 Ga0157374_11286931 Ga0157374_112869312 111
470 3300013297 Ga0157378_10323498 Ga0157378_103234982 111
471 3300013307 Ga0157372_10137200 Ga0157372_101372002 111
472 3300013307 Ga0157372_12696930 Ga0157372_126969301 111
473 3300013308 Ga0157375_12163476 Ga0157375_121634762 111
474 3300013875 Ga0157515_116762 Ga0157515_1167622 111
475 3300014326 Ga0157380_11837932 Ga0157380_118379321 111
476 3300014497 Ga0182008_10395070 Ga0182008_103950702 111
477 3300014968 Ga0157379_11393208 Ga0157379_113932082 111
478 3300020082 Ga0206353_11950597 Ga0206353_119505972 111
479 3300020610 Ga0154015_1267117 Ga0154015_12671171 111
480 3300021361 Ga0213872_10056033 Ga0213872_100560332 111
481 3300021361 Ga0213872_10242688 Ga0213872_102426882 111
482 3300021441 Ga0213871_10003685 Ga0213871_100036852 111
483 3300025302 Ga0207426_1026821 Ga0207426_10268212 111
484 3300025302 Ga0207426_1049303 Ga0207426_10493033 111
485 3300025315 Ga0207697_10195581 Ga0207697_101955811 111
486 3300025315 Ga0207697_10319707 Ga0207697_103197072 111
487 3300025321 Ga0207656_10102313 Ga0207656_101023132 111
488 3300025899 Ga0207642_11054872 Ga0207642_110548721 111
489 3300025901 Ga0207688_10078557 Ga0207688_100785573 111
490 3300025903 Ga0207680_10515880 Ga0207680_105158802 111
491 3300025907 Ga0207645_10817055 Ga0207645_108170552 111
492 3300025908 Ga0207643_10450241 Ga0207643_104502413 111
493 3300025909 Ga0207705_10099719 Ga0207705_100997193 111
494 3300025909 Ga0207705_10150357 Ga0207705_101503573 111
495 3300025910 Ga0207684_10271395 Ga0207684_102713953 111
496 3300025910 Ga0207684_10572679 Ga0207684_105726792 111
497 3300025912 Ga0207707_10183121 Ga0207707_101831212 111
498 3300025912 Ga0207707_10375367 Ga0207707_103753672 111
499 3300025913 Ga0207695_10234562 Ga0207695_102345623 111
500 3300025913 Ga0207695_10243724 Ga0207695_102437242 111
501 3300025914 Ga0207671_10244839 Ga0207671_102448392 111
502 3300025917 Ga0207660_10153117 Ga0207660_101531172 111
503 3300025919 Ga0207657_10310018 Ga0207657_103100183 111
504 3300025920 Ga0207649_10069979 Ga0207649_100699792 111
505 3300025921 Ga0207652_10995018 Ga0207652_109950182 111
506 3300025921 Ga0207652_11020728 Ga0207652_110207282 111
507 3300025922 Ga0207646_11071323 Ga0207646_110713232 111
508 3300025923 Ga0207681_10645849 Ga0207681_106458492 111
509 3300025924 Ga0207694_10262322 Ga0207694_102623223 111
510 3300025924 Ga0207694_10584148 Ga0207694_105841483 111
511 3300025926 Ga0207659_10096793 Ga0207659_100967934 111
512 3300025928 Ga0207700_11704458 Ga0207700_117044582 111
513 3300025931 Ga0207644_10433186 Ga0207644_104331863 111
514 3300025931 Ga0207644_11107021 Ga0207644_111070212 111
515 3300025932 Ga0207690_11767929 Ga0207690_117679292 111
516 3300025933 Ga0207706_11450020 Ga0207706_114500201 111
517 3300025934 Ga0207686_10907029 Ga0207686_109070292 111
518 3300025936 Ga0207670_10330746 Ga0207670_103307463 111
519 3300025936 Ga0207670_10439093 Ga0207670_104390932 111
520 3300025937 Ga0207669_11591070 Ga0207669_115910702 111
521 3300025938 Ga0207704_11907057 Ga0207704_119070571 111
522 3300025939 Ga0207665_10272026 Ga0207665_102720263 111
523 3300025939 Ga0207665_10445632 Ga0207665_104456322 111
524 3300025940 Ga0207691_10618568 Ga0207691_106185682 111
525 3300025944 Ga0207661_12140621 Ga0207661_121406212 111
526 3300025945 Ga0207679_10094505 Ga0207679_100945053 111
527 3300025949 Ga0207667_10021411 Ga0207667_100214116 111
528 3300025949 Ga0207667_10858444 Ga0207667_108584442 111
529 3300025960 Ga0207651_11490695 Ga0207651_114906952 111
530 3300025981 Ga0207640_10173737 Ga0207640_101737372 111
531 3300025981 Ga0207640_11066982 Ga0207640_110669821 111
532 3300026023 Ga0207677_10888627 Ga0207677_108886272 111
533 3300026035 Ga0207703_10444773 Ga0207703_104447731 111
534 3300026041 Ga0207639_11933471 Ga0207639_119334711 111
535 3300026075 Ga0207708_10626029 Ga0207708_106260293 111
536 3300026075 Ga0207708_12036747 Ga0207708_120367471 111
537 3300026078 Ga0207702_10143221 Ga0207702_101432212 111
538 3300026078 Ga0207702_10213966 Ga0207702_102139663 111
539 3300026089 Ga0207648_10527645 Ga0207648_105276452 111
540 3300026089 Ga0207648_10701061 Ga0207648_107010613 111
541 3300026095 Ga0207676_10999404 Ga0207676_109994043 111
542 3300026116 Ga0207674_11495557 Ga0207674_114955572 111
543 3300026118 Ga0207675_100916825 Ga0207675_1009168253 111
544 3300026121 Ga0207683_10374681 Ga0207683_103746813 111
545 3300026142 Ga0207698_11233143 Ga0207698_112331431 111
546 3300027866 Ga0209813_10031933 Ga0209813_100319332 111
547 3300027907 Ga0207428_10665262 Ga0207428_106652621 111
548 3300028379 Ga0268266_10011062 Ga0268266_100110622 111
549 3300028379 Ga0268266_10883551 Ga0268266_108835512 111
550 3300028380 Ga0268265_11067695 Ga0268265_110676951 111
551 3300028381 Ga0268264_12689801 Ga0268264_126898011 111
552 3300031238 Ga0265332_10080306 Ga0265332_100803061 111
553 3300031247 Ga0265340_10331267 Ga0265340_103312672 111
554 3300031247 Ga0265340_10428710 Ga0265340_104287102 111
555 3300031249 Ga0265339_10306235 Ga0265339_103062352 111
556 3300031456 Ga0307513_10453174 Ga0307513_104531743 111
557 3300031711 Ga0265314_10224550 Ga0265314_102245502 111
558 3300031712 Ga0265342_10131690 Ga0265342_101316902 111
559 3300031995 Ga0307409_101551262 Ga0307409_1015512622 111
560 3300032002 Ga0307416_100434725 Ga0307416_1004347252 111
561 3300035092 Ga0373952_0224197 Ga0373952_0224197_150_485 111
562 3300035112 Ga0373932_0272048 Ga0373932_0272048_89_424 111
563 3300035113 Ga0373936_0400881 Ga0373936_0400881_107_442 111
564 3300035115 Ga0373941_0163214 Ga0373941_0163214_182_517 111
565 3300035116 Ga0373945_0471102 Ga0373945_0471102_140_475 111
566 3300035171 Ga0373946_0343762 Ga0373946_0343762_197_532 111
567 3300035207 Ga0373942_0112719 Ga0373942_0112719_292_627 111
568 3300035691 Ga0373931_0574963 Ga0373931_0574963_299_634 111
569 3300035691 Ga0373931_0810819 Ga0373931_0810819_147_482 111
570 3300035695 Ga0373927_0136058 Ga0373927_0136058_350_685 111
571 3300035695 Ga0373927_0949559 Ga0373927_0949559_147_482 111
572 3300035725 Ga0373947_0723966 Ga0373947_0723966_73_408 111
573 3300036401 Ga0373937_0307786 Ga0373937_0307786_748_1083 111
574 3300037068 Ga0373925_0094048 Ga0373925_0094048_161_496 111
575 3300037312 Ga0395899_0012914 Ga0395899_0012914_5139_5474 111
576 3300037312 Ga0395899_0018107 Ga0395899_0018107_486_821 111
577 3300037418 Ga0395900_0041556 Ga0395900_0041556_746_1081 111
578 3300037418 Ga0395900_0063433 Ga0395900_0063433_535_870 111
579 3300037418 Ga0395900_0183837 Ga0395900_0183837_1749_2084 111
580 3300037466 Ga0395898_0007528 Ga0395898_0007528_7596_7931 111
581 3300037466 Ga0395898_0009732 Ga0395898_0009732_8541_8876 111
582 3300037471 Ga0395905_0387326 Ga0395905_0387326_556_891 111
583 3300037471 Ga0395905_0526040 Ga0395905_0526040_322_660 111
584 3300038443 Ga0395901_0010972 Ga0395901_0010972_4720_5055 111
585 3300038443 Ga0395901_0029475 Ga0395901_0029475_4293_4628 111
586 3300038443 Ga0395901_0909090 Ga0395901_0909090_39_374 111
587 3300039437 Ga0436365_0349736 Ga0436365_0349736_197_532 111
588 3300039437 Ga0436365_1270328 Ga0436365_1270328_82_417 111
589 3300039438 Ga0436360_0362032 Ga0436360_0362032_4878_5213 111
590 3300039438 Ga0436360_0722676 Ga0436360_0722676_705_1040 111
591 3300039438 Ga0436360_0890298 Ga0436360_0890298_72_407 111
592 3300039447 Ga0436361_0349372 Ga0436361_0349372_2406_2741 111
593 3300039447 Ga0436361_0459654 Ga0436361_0459654_327_662 111
594 3300039447 Ga0436361_0548464 Ga0436361_0548464_1270_1605 111
595 3300041410 Ga0439461_0144147 Ga0439461_0144147_44_379 111
596 3300041443 Ga0451789_0587692 Ga0451789_0587692_273_608 111
597 3300041501 Ga0451845_0099901 Ga0451845_0099901_155_490 111
598 3300042005 Ga0439448_0038023 Ga0439448_0038023_383_718 111
599 3300044694 Ga0466963_0843482 Ga0466963_0843482_20_355 111
600 3300046660 Ga0495625_0818647 Ga0495625_0818647_183_521 111
601 3300046678 Ga0495599_0447527 Ga0495599_0447527_180_515 111
602 3300046681 Ga0495647_0288331 Ga0495647_0288331_48_383 111
603 3300047319 Ga0495674_0898905 Ga0495674_0898905_31_366 111
604 3300048918 Ga0496115_1070106 Ga0496115_1070106_216_551 111
605 3300048924 Ga0496121_0856313 Ga0496121_0856313_129_464 111
606 3300048929 Ga0496126_0070540 Ga0496126_0070540_2653_2988 111
607 3300049571 Ga0501034_0008484 Ga0501034_0008484_5794_6129 111
608 3300049571 Ga0501034_0009970 Ga0501034_0009970_8492_8827 111
609 3300049571 Ga0501034_0089449 Ga0501034_0089449_2327_2662 111
610 3300049571 Ga0501034_0224902 Ga0501034_0224902_246_581 111
611 3300049572 Ga0501036_1633522 Ga0501036_1633522_142_477 111
612 3300049573 Ga0501037_0463754 Ga0501037_0463754_330_665 111
613 3300049574 Ga0501038_1104453 Ga0501038_1104453_87_422 111
614 3300049574 Ga0501038_1105179 Ga0501038_1105179_11_346 111
615 3300049575 Ga0501039_1095738 Ga0501039_1095738_184_522 111
616 3300049577 Ga0501041_0485695 Ga0501041_0485695_372_710 111
617 3300049578 Ga0501042_0052983 Ga0501042_0052983_1502_1840 111
618 3300049580 Ga0501046_0054053 Ga0501046_0054053_1722_2057 111
619 3300049581 Ga0501047_0077209 Ga0501047_0077209_1214_1549 111
620 3300049581 Ga0501047_0079998 Ga0501047_0079998_1742_2077 111
621 3300049581 Ga0501047_0397267 Ga0501047_0397267_177_512 111
622 3300049582 Ga0501048_0554301 Ga0501048_0554301_375_710 111
623 3300049582 Ga0501048_0873220 Ga0501048_0873220_38_373 111
624 3300049585 Ga0501069_0821800 Ga0501069_0821800_148_483 111
625 3300049586 Ga0501070_0226824 Ga0501070_0226824_293_628 111
626 3300049588 Ga0501072_0246561 Ga0501072_0246561_218_553 111
627 3300049591 Ga0501075_1320437 Ga0501075_1320437_118_456 111
628 3300049742 Ga0501080_1082269 Ga0501080_1082269_62_397 111
629 3300049822 Ga0501035_0664061 Ga0501035_0664061_376_711 111
630 3300049823 Ga0501044_0078024 Ga0501044_0078024_886_1221 111
631 3300049823 Ga0501044_0366907 Ga0501044_0366907_675_1010 111
632 3300049823 Ga0501044_0490192 Ga0501044_0490192_732_1067 111
633 3300050489 nmdc:mga03683_19223_c1 nmdc:mga03683_19223_c1_954_1289 111
634 3300050489 nmdc:mga03683_19340_c1 nmdc:mga03683_19340_c1_1668_2003 111
635 3300050489 nmdc:mga03683_4033_c1 nmdc:mga03683_4033_c1_3208_3543 111
636 3300050489 nmdc:mga03683_73121_c1 nmdc:mga03683_73121_c1_552_887 111
637 3300050490 nmdc:mga03n38_168735_c1 nmdc:mga03n38_168735_c1_556_891 111
638 3300050490 nmdc:mga03n38_474206_c1 nmdc:mga03n38_474206_c1_321_656 111
639 3300050491 nmdc:mga00v17_234283_c1 nmdc:mga00v17_234283_c1_816_1151 111
640 3300050491 nmdc:mga00v17_569299_c1 nmdc:mga00v17_569299_c1_334_669 111
641 3300050491 nmdc:mga00v17_609855_c1 nmdc:mga00v17_609855_c1_323_658 111
642 3300050492 nmdc:mga0yw44_168443_c1 nmdc:mga0yw44_168443_c1_859_1194 111
643 3300050492 nmdc:mga0yw44_334275_c1 nmdc:mga0yw44_334275_c1_184_519 111
644 3300050492 nmdc:mga0yw44_4681_c1 nmdc:mga0yw44_4681_c1_66_401 111
645 3300050492 nmdc:mga0yw44_529186_c1 nmdc:mga0yw44_529186_c1_308_643 111
646 3300050493 nmdc:mga0k408_24954_c1 nmdc:mga0k408_24954_c1_448_783 111
647 3300050493 nmdc:mga0k408_259169_c1 nmdc:mga0k408_259169_c1_330_665 111
648 3300050493 nmdc:mga0k408_342567_c1 nmdc:mga0k408_342567_c1_399_734 111
649 3300050493 nmdc:mga0k408_81371_c1 nmdc:mga0k408_81371_c1_1153_1488 111
650 3300050494 nmdc:mga06z11_36298_c1 nmdc:mga06z11_36298_c1_663_998 111
651 3300050495 nmdc:mga04h51_104065_c1 nmdc:mga04h51_104065_c1_564_899 111
652 3300050496 nmdc:mga07m45_17798_c1 nmdc:mga07m45_17798_c1_2546_2881 111
653 3300050496 nmdc:mga07m45_248769_c1 nmdc:mga07m45_248769_c1_533_868 111
654 3300050496 nmdc:mga07m45_73212_c1 nmdc:mga07m45_73212_c1_1225_1560 111
655 3300050516 nmdc:mga0sz30_201706_c1 nmdc:mga0sz30_201706_c1_345_680 111
656 3300050516 nmdc:mga0sz30_3630_c2 nmdc:mga0sz30_3630_c2_2807_3142 111
657 3300050516 nmdc:mga0sz30_418493_c1 nmdc:mga0sz30_418493_c1_169_504 111
658 3300053077 Ga0495601_0738730 Ga0495601_0738730_174_509 111
659 3300053091 Ga0500647_0041290 Ga0500647_0041290_926_1261 111
660 3300053096 Ga0500641_0000183 Ga0500641_0000183_3383_3718 111
661 3300053130 Ga0500642_0012558 Ga0500642_0012558_1082_1420 111
662 3300053140 Ga0500573_0367916 Ga0500573_0367916_273_611 111
663 3300053153 Ga0500616_0013458 Ga0500616_0013458_1734_2069 111
664 3300053155 Ga0500620_028811 Ga0500620_028811_404_739 111
665 3300053733 Ga0500552_000449 Ga0500552_000449_383_718 111

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

26

109

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y5c-assembly2.cif.gz_B structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster 0.9781 2 105
2wlb-assembly2.cif.gz_B adrenodoxin-like ferredoxin etp1fd(516-618) of schizosaccharomyces pombe mitochondria 0.9701 1 101
6nbl-assembly2.cif.gz_D cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide 0.9648 1 105
1r7s-assembly3.cif.gz_C putidaredoxin (fe2s2 ferredoxin), c73g mutant 0.9648 3 105
1xlq-assembly4.cif.gz_A crystal structure of reduced c73s putidaredoxin from pseudomonas putida 0.9648 3 105
ID Description Score Start End Superfamily
af_A4I756_34_144_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9741 2 104 3.10.20.30
2wlbB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9701 1 101 3.10.20.30
af_A4I234_54_172_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9683 2 110 3.10.20.30
af_Q9CPW2_55_168_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9641 2 111 3.10.20.30
1uwmA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9626 3 105 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A522VJV4-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9998 1 86 GO:0009055
GO:0051537
GO:0140647
AF-A0A2V1AYS2-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9984 2 106 GO:0005739
GO:0009055
GO:0051537
GO:0140647
AF-A0A4P7WBU6-F1-model_v4 2Fe-2S ferredoxin 0.9981 1 101 GO:0009055
GO:0051537
GO:0140647
AF-K5ZL87-F1-model_v4 (2Fe-2S) ferredoxin 0.9974 1 108 GO:0009055
GO:0051537
GO:0140647
AF-A0A0F3MDW9-F1-model_v4 2Fe-2S ferredoxin (Adrenodoxin-like protein) 0.9974 16 109 GO:0009055
GO:0051537
GO:0140647

Feature Viewer

pLDDT pTM Quality
93.45 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map