F473757

General Info

Members Datasets Scaffolds Average Seq Length
666 343 664 172

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10098898|rootH1_100988982
Length 181
Sequence VSDSFNILFLCTANSARSILAEAILSRLGGDRFRAFSAGSFPRGQVNPVAIELLHSLGYETSAFRSKSWDVFAAEGAPRIDLVVTVCDNAAGEICPIWPGHPLKAHWGIEDPASADGMGKRDAFLKAYRYLSAKIGRLVALPVETMDSAALRAELVAIGRSEGATELAGASEPFAAARGPE

Samples

Sample ID Description Type Environment
1 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
2 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
125 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
126 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
127 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
215 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
216 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
222 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
234 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
241 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
246 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
247 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
250 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
277 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
317 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
318 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
319 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
320 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
321 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
325 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
326 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
340 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
341 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
343 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 1.35
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 7.06
Rhizosphere 90.99
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10015591 3300001990 Bacteria 2460
2 JGI24743J22301_10030376 3300001991 Bacteria 1062
3 JGI24750J21931_1001123 3300002070 Bacteria 3447
4 JGI24745J21846_1017478 3300002073 Bacteria 835
5 JGI24034J26672_10020594 3300002239 Bacteria 1034
6 rootH1_10098898 3300003316 Bacteria 1968
7 rootL2_10344107 3300003322 Bacteria 1082
8 Ga0065712_10429642 3300005290 Bacteria 704
9 Ga0065707_10365715 3300005295 Bacteria 897
10 Ga0070676_10001040 3300005328 Bacteria 13814
11 Ga0070683_100079541 3300005329 Bacteria 3068
12 Ga0070690_100060456 3300005330 Bacteria 2438
13 Ga0070670_100003994 3300005331 Bacteria 12312
14 Ga0070670_100006332 3300005331 Bacteria 10018
15 Ga0068869_100877632 3300005334 Bacteria 775
16 Ga0070666_10000184 3300005335 Bacteria 42807
17 Ga0070666_10372063 3300005335 Bacteria 1025
18 Ga0070682_100014187 3300005337 Bacteria 4602
19 Ga0068868_100011581 3300005338 Bacteria 6424
20 Ga0068868_100016942 3300005338 Bacteria 5422
21 Ga0070660_100015280 3300005339 Bacteria 5539
22 Ga0070689_100000219 3300005340 Bacteria 34066
23 Ga0070689_100022362 3300005340 Bacteria 4721
24 Ga0070691_10000775 3300005341 Bacteria 12670
25 Ga0070661_100000383 3300005344 Bacteria 34710
26 Ga0070661_100815913 3300005344 Bacteria 766
27 Ga0070692_10000953 3300005345 Bacteria 9837
28 Ga0070668_100002203 3300005347 Bacteria 14300
29 Ga0070668_100065828 3300005347 Bacteria 2811
30 Ga0070668_100774343 3300005347 Bacteria 851
31 Ga0070669_100000008 3300005353 Bacteria 226764
32 Ga0070669_100003604 3300005353 Bacteria 11179
33 Ga0070669_100117138 3300005353 Bacteria 2028
34 Ga0070669_100458512 3300005353 Bacteria 1052
35 Ga0070675_100005782 3300005354 Bacteria 9462
36 Ga0070671_100000015 3300005355 Bacteria 166132
37 Ga0070671_100001149 3300005355 Bacteria 19672
38 Ga0070674_100017247 3300005356 Bacteria 4538
39 Ga0070673_100233477 3300005364 Bacteria 1596
40 Ga0070688_100001435 3300005365 Bacteria 11859
41 Ga0070688_100416387 3300005365 Bacteria 998
42 Ga0070659_100377510 3300005366 Bacteria 1193
43 Ga0070659_100549679 3300005366 Bacteria 988
44 Ga0070659_100757801 3300005366 Bacteria 842
45 Ga0070659_100807902 3300005366 Bacteria 816
46 Ga0070667_100006317 3300005367 Bacteria 9847
47 Ga0070667_100125738 3300005367 Bacteria 2234
48 Ga0070703_10013427 3300005406 Bacteria 2326
49 Ga0070709_10017423 3300005434 Bacteria 4120
50 Ga0070709_10114986 3300005434 Bacteria 1814
51 Ga0070709_10120264 3300005434 Bacteria 1779
52 Ga0070714_100003382 3300005435 Bacteria 11889
53 Ga0070714_100112156 3300005435 Bacteria 2416
54 Ga0070713_100030941 3300005436 Bacteria 4256
55 Ga0070713_100066254 3300005436 Bacteria 3037
56 Ga0070713_100259934 3300005436 Bacteria 1586
57 Ga0070710_10006473 3300005437 Bacteria 5628
58 Ga0070701_10001291 3300005438 Bacteria 9205
59 Ga0070711_100000201 3300005439 Bacteria 31559
60 Ga0070711_100263488 3300005439 Bacteria 1357
61 Ga0070705_100001686 3300005440 Bacteria 11568
62 Ga0070700_100047121 3300005441 Bacteria 2666
63 Ga0070694_100015238 3300005444 Bacteria 4823
64 Ga0070708_100064225 3300005445 Bacteria 3289
65 Ga0070663_100000190 3300005455 Bacteria 30948
66 Ga0070663_100397458 3300005455 Bacteria 1126
67 Ga0070678_100002392 3300005456 Bacteria 10265
68 Ga0070662_100553074 3300005457 Bacteria 964
69 Ga0070681_10001396 3300005458 Bacteria 21186
70 Ga0070681_10086875 3300005458 Bacteria 3081
71 Ga0070681_10603144 3300005458 Unclassified 1012
72 Ga0068867_100043246 3300005459 Bacteria 3298
73 Ga0070685_10004770 3300005466 Bacteria 6864
74 Ga0070685_10011013 3300005466 Bacteria 4719
75 Ga0070706_100136654 3300005467 Bacteria 2288
76 Ga0070699_100042983 3300005518 Bacteria 3912
77 Ga0070679_100100744 3300005530 Bacteria 2875
78 Ga0070679_100985603 3300005530 Unclassified 787
79 Ga0070684_100031953 3300005535 Bacteria 4483
80 Ga0070697_100003155 3300005536 Bacteria 12663
81 Ga0068853_100000460 3300005539 Bacteria 27825
82 Ga0068853_100054633 3300005539 Bacteria 3442
83 Ga0068853_100098948 3300005539 Bacteria 2576
84 Ga0070672_100000564 3300005543 Bacteria 21723
85 Ga0070672_100279077 3300005543 Bacteria 1412
86 Ga0070686_100000306 3300005544 Bacteria 32359
87 Ga0070686_100067493 3300005544 Bacteria 2330
88 Ga0070695_100002867 3300005545 Bacteria 10032
89 Ga0070695_100269421 3300005545 Bacteria 1247
90 Ga0070696_100010206 3300005546 Bacteria 6285
91 Ga0070696_101016533 3300005546 Unclassified 693
92 Ga0070693_100002707 3300005547 Bacteria 8147
93 Ga0070665_100060733 3300005548 Bacteria 3789
94 Ga0070665_100097361 3300005548 Bacteria 2947
95 Ga0070665_100203815 3300005548 Bacteria 1978
96 Ga0070704_100001638 3300005549 Bacteria 12135
97 Ga0068855_100004155 3300005563 Bacteria 17666
98 Ga0068855_100194090 3300005563 Bacteria 2288
99 Ga0068855_100694659 3300005563 Bacteria 1089
100 Ga0070664_100063935 3300005564 Bacteria 3138
101 Ga0068857_100000318 3300005577 Bacteria 33240
102 Ga0068857_100392284 3300005577 Bacteria 1291
103 Ga0068854_100014348 3300005578 Bacteria 5221
104 Ga0068854_100034996 3300005578 Bacteria 3513
105 Ga0068854_100235688 3300005578 Bacteria 1455
106 Ga0068856_100030353 3300005614 Bacteria 5284
107 Ga0068856_100227853 3300005614 Bacteria 1879
108 Ga0068856_100955104 3300005614 Bacteria 876
109 Ga0070702_100004629 3300005615 Bacteria 6307
110 Ga0070702_100667327 3300005615 Bacteria 788
111 Ga0068852_100107155 3300005616 Bacteria 2534
112 Ga0068859_100002375 3300005617 Bacteria 19171
113 Ga0068859_100004533 3300005617 Bacteria 14167
114 Ga0068859_100273747 3300005617 Bacteria 1781
115 Ga0068859_100538034 3300005617 Bacteria 1263
116 Ga0068864_100003703 3300005618 Bacteria 12622
117 Ga0068864_100211910 3300005618 Bacteria 1784
118 Ga0068866_10000636 3300005718 Bacteria 15906
119 Ga0068866_10052166 3300005718 Bacteria 2086
120 Ga0068861_100000277 3300005719 Bacteria 28797
121 Ga0068861_100001851 3300005719 Bacteria 13614
122 Ga0068861_100085472 3300005719 Bacteria 2478
123 Ga0068861_100112150 3300005719 Bacteria 2186
124 Ga0068861_100355457 3300005719 Bacteria 1287
125 Ga0068861_100611348 3300005719 Bacteria 1002
126 Ga0068851_10034206 3300005834 Bacteria 2536
127 Ga0068863_100000968 3300005841 Bacteria 28879
128 Ga0068863_100003742 3300005841 Bacteria 15049
129 Ga0068863_100374286 3300005841 Bacteria 1390
130 Ga0068863_100394536 3300005841 Bacteria 1353
131 Ga0068858_100006243 3300005842 Bacteria 11612
132 Ga0068858_100019432 3300005842 Bacteria 6354
133 Ga0068858_100038583 3300005842 Bacteria 4431
134 Ga0068858_100045051 3300005842 Bacteria 4088
135 Ga0068858_100086579 3300005842 Bacteria 2914
136 Ga0068858_100099514 3300005842 Bacteria 2711
137 Ga0068860_100001081 3300005843 Bacteria 30047
138 Ga0068860_100017469 3300005843 Bacteria 6990
139 Ga0068860_100027086 3300005843 Bacteria 5522
140 Ga0068862_100006641 3300005844 Bacteria 9596
141 Ga0068862_100022138 3300005844 Bacteria 5319
142 Ga0068862_100029227 3300005844 Bacteria 4644
143 Ga0068862_100723671 3300005844 Bacteria 966
144 Ga0081455_10002652 3300005937 Bacteria 21173
145 Ga0081455_10022381 3300005937 Bacteria 5908
146 Ga0081540_1006477 3300005983 Bacteria 8519
147 Ga0070717_10508525 3300006028 Bacteria 1089
148 Ga0070715_10001080 3300006163 Bacteria 7721
149 Ga0070716_100007391 3300006173 Bacteria 5405
150 Ga0070712_100000840 3300006175 Bacteria 18252
151 Ga0070712_100154216 3300006175 Bacteria 1767
152 Ga0097621_100032862 3300006237 Bacteria 4127
153 Ga0097621_100160698 3300006237 Bacteria 1931
154 Ga0097621_101038306 3300006237 Bacteria 768
155 Ga0075428_100647968 3300006844 Bacteria 1127
156 Ga0075430_100169822 3300006846 Bacteria 1814
157 Ga0075433_11305720 3300006852 Bacteria 629
158 Ga0068865_100018469 3300006881 Bacteria 4500
159 Ga0068865_100097171 3300006881 Bacteria 2149
160 Ga0097620_100002375 3300006931 Bacteria 19171
161 Ga0097620_100004533 3300006931 Bacteria 14167
162 Ga0097620_100273785 3300006931 Bacteria 1781
163 Ga0097620_100538056 3300006931 Bacteria 1263
164 Ga0075435_100097938 3300007076 Bacteria 2428
165 Ga0105250_10004823 3300009092 Bacteria 6140
166 Ga0105240_10072847 3300009093 Bacteria 4244
167 Ga0105245_10004696 3300009098 Bacteria 12076
168 Ga0105247_10000361 3300009101 Bacteria 38770
169 Ga0105247_10001891 3300009101 Bacteria 14614
170 Ga0105247_10066081 3300009101 Bacteria 2251
171 Ga0114129_10193369 3300009147 Bacteria 2761
172 Ga0114129_10270067 3300009147 Bacteria 2276
173 Ga0114129_10489451 3300009147 Bacteria 1608
174 Ga0114129_10533555 3300009147 Bacteria 1528
175 Ga0114129_12478275 3300009147 Bacteria 620
176 Ga0105243_10001606 3300009148 Bacteria 19702
177 Ga0105243_10055222 3300009148 Bacteria 3155
178 Ga0105243_10241823 3300009148 Bacteria 1607
179 Ga0105243_10262925 3300009148 Bacteria 1546
180 Ga0105243_10586939 3300009148 Bacteria 1070
181 Ga0105241_10001291 3300009174 Bacteria 19082
182 Ga0105242_10020157 3300009176 Bacteria 5227
183 Ga0105248_10000586 3300009177 Bacteria 41465
184 Ga0105248_10054850 3300009177 Bacteria 4471
185 Ga0105248_10072270 3300009177 Bacteria 3877
186 Ga0105248_10146582 3300009177 Bacteria 2664
187 Ga0105237_10003139 3300009545 Bacteria 19874
188 Ga0105237_10286040 3300009545 Bacteria 1651
189 Ga0105238_10013074 3300009551 Bacteria 8374
190 Ga0105238_10118083 3300009551 Bacteria 2633
191 Ga0105249_10003539 3300009553 Bacteria 13507
192 Ga0105249_10181812 3300009553 Bacteria 2046
193 Ga0105249_10222956 3300009553 Bacteria 1856
194 Ga0105249_10548810 3300009553 Bacteria 1206
195 Ga0105249_11278729 3300009553 Bacteria 805
196 Ga0099796_10102754 3300010159 Bacteria 1077
197 Ga0105239_10003994 3300010375 Bacteria 17864
198 Ga0105239_10107980 3300010375 Bacteria 3083
199 Ga0105246_10000208 3300011119 Bacteria 29695
200 Ga0105246_10152973 3300011119 Bacteria 1748
201 Ga0157371_10007923 3300013102 Bacteria 8524
202 Ga0157369_10021041 3300013105 Bacteria 7292
203 Ga0157374_10003797 3300013296 Bacteria 12710
204 Ga0157374_10034884 3300013296 Bacteria 4600
205 Ga0157378_10000452 3300013297 Bacteria 39237
206 Ga0157378_10048564 3300013297 Bacteria 3774
207 Ga0157378_10062694 3300013297 Bacteria 3320
208 Ga0163162_10002876 3300013306 Bacteria 16391
209 Ga0163162_10003369 3300013306 Bacteria 15291
210 Ga0163162_10007327 3300013306 Bacteria 10725
211 Ga0157372_10000529 3300013307 Bacteria 42341
212 Ga0157372_10391804 3300013307 Bacteria 1619
213 Ga0157375_10001554 3300013308 Bacteria 19762
214 Ga0157375_10002784 3300013308 Bacteria 15121
215 Ga0157375_10020734 3300013308 Bacteria 6013
216 Ga0163163_10009295 3300014325 Bacteria 8769
217 Ga0163163_10013796 3300014325 Bacteria 7409
218 Ga0163163_12097697 3300014325 Bacteria 625
219 Ga0157380_10019453 3300014326 Bacteria 5060
220 Ga0157380_10178296 3300014326 Bacteria 1864
221 Ga0157380_10323625 3300014326 Bacteria 1431
222 Ga0157380_10770853 3300014326 Bacteria 976
223 Ga0157380_10805219 3300014326 Bacteria 957
224 Ga0157377_10037195 3300014745 Bacteria 2681
225 Ga0157377_10159268 3300014745 Bacteria 1402
226 Ga0157379_10011989 3300014968 Bacteria 7572
227 Ga0157379_10020462 3300014968 Bacteria 5851
228 Ga0157379_10048156 3300014968 Bacteria 3805
229 Ga0157379_10365860 3300014968 Bacteria 1322
230 Ga0157376_10517878 3300014969 Bacteria 1175
231 Ga0157376_10668246 3300014969 Bacteria 1041
232 Ga0163161_10000549 3300017792 Bacteria 30479
233 Ga0163161_10098109 3300017792 Bacteria 2177
234 Ga0163161_10168203 3300017792 Bacteria 1675
235 Ga0184599_122713 3300019188 Bacteria 854
236 Ga0213874_10012055 3300021377 Bacteria 2208
237 Ga0213876_10000170 3300021384 Bacteria 68004
238 Ga0224570_100713 3300022730 Bacteria 2648
239 Ga0224571_108185 3300022734 Bacteria 709
240 Ga0224572_1001411 3300024225 Bacteria 3543
241 Ga0224572_1014422 3300024225 Bacteria 1510
242 Ga0228598_1000036 3300024227 Bacteria 18755
243 Ga0207697_10000274 3300025315 Bacteria 28418
244 Ga0207697_10153956 3300025315 Bacteria 1001
245 Ga0207656_10071398 3300025321 Bacteria 1543
246 Ga0207653_10044388 3300025885 Bacteria 1465
247 Ga0207692_10007121 3300025898 Bacteria 4571
248 Ga0207642_10012479 3300025899 Bacteria 3068
249 Ga0207710_10023544 3300025900 Bacteria 2647
250 Ga0207710_10299210 3300025900 Bacteria 813
251 Ga0207688_10017490 3300025901 Bacteria 3896
252 Ga0207688_10270112 3300025901 Bacteria 1034
253 Ga0207647_10002142 3300025904 Bacteria 15083
254 Ga0207685_10013786 3300025905 Bacteria 2511
255 Ga0207699_10008743 3300025906 Bacteria 5011
256 Ga0207699_10014321 3300025906 Bacteria 4085
257 Ga0207699_10184570 3300025906 Bacteria 1404
258 Ga0207699_10265829 3300025906 Bacteria 1187
259 Ga0207645_10009805 3300025907 Bacteria 6605
260 Ga0207643_10236117 3300025908 Bacteria 1123
261 Ga0207684_10070391 3300025910 Bacteria 2973
262 Ga0207654_10031516 3300025911 Bacteria 2921
263 Ga0207707_10026912 3300025912 Bacteria 5026
264 Ga0207707_10331884 3300025912 Bacteria 1312
265 Ga0207695_10372007 3300025913 Bacteria 1315
266 Ga0207671_10289178 3300025914 Bacteria 1294
267 Ga0207671_10418887 3300025914 Bacteria 1065
268 Ga0207693_10000247 3300025915 Bacteria 50003
269 Ga0207693_10303506 3300025915 Bacteria 1250
270 Ga0207693_10565027 3300025915 Bacteria 887
271 Ga0207663_10002489 3300025916 Bacteria 8872
272 Ga0207663_10156668 3300025916 Bacteria 1603
273 Ga0207663_10325658 3300025916 Bacteria 1156
274 Ga0207660_10042023 3300025917 Bacteria 3207
275 Ga0207657_10000257 3300025919 Bacteria 56368
276 Ga0207657_10478530 3300025919 Bacteria 976
277 Ga0207649_10010986 3300025920 Bacteria 4980
278 Ga0207652_10019036 3300025921 Bacteria 5638
279 Ga0207681_10000002 3300025923 Bacteria 985597
280 Ga0207681_10021983 3300025923 Bacteria 4062
281 Ga0207650_10009399 3300025925 Bacteria 6683
282 Ga0207650_10173050 3300025925 Bacteria 1717
283 Ga0207650_10807430 3300025925 Bacteria 795
284 Ga0207687_10166359 3300025927 Bacteria 1697
285 Ga0207700_10053074 3300025928 Bacteria 3035
286 Ga0207700_10282369 3300025928 Bacteria 1428
287 Ga0207700_10746004 3300025928 Bacteria 875
288 Ga0207700_10958806 3300025928 Bacteria 766
289 Ga0207664_10086794 3300025929 Bacteria 2557
290 Ga0207664_10100539 3300025929 Bacteria 2388
291 Ga0207644_10000002 3300025931 Bacteria 942221
292 Ga0207644_10006496 3300025931 Bacteria 7622
293 Ga0207690_10001995 3300025932 Bacteria 12503
294 Ga0207706_10000691 3300025933 Bacteria 35258
295 Ga0207686_10812250 3300025934 Bacteria 750
296 Ga0207709_10300832 3300025935 Bacteria 1193
297 Ga0207670_10377552 3300025936 Bacteria 1128
298 Ga0207670_11168598 3300025936 Bacteria 651
299 Ga0207669_10135004 3300025937 Bacteria 1702
300 Ga0207704_10014366 3300025938 Bacteria 3996
301 Ga0207704_10127650 3300025938 Bacteria 1754
302 Ga0207704_10513086 3300025938 Bacteria 968
303 Ga0207704_11103402 3300025938 Bacteria 674
304 Ga0207665_10001185 3300025939 Bacteria 17548
305 Ga0207665_10031996 3300025939 Bacteria 3483
306 Ga0207691_10000483 3300025940 Bacteria 39447
307 Ga0207711_10032876 3300025941 Bacteria 4388
308 Ga0207711_10039646 3300025941 Bacteria 4008
309 Ga0207711_10042219 3300025941 Bacteria 3886
310 Ga0207711_10691037 3300025941 Bacteria 951
311 Ga0207711_10846935 3300025941 Bacteria 851
312 Ga0207689_10002538 3300025942 Bacteria 16946
313 Ga0207689_10218204 3300025942 Bacteria 1576
314 Ga0207689_10329021 3300025942 Bacteria 1269
315 Ga0207661_10104705 3300025944 Bacteria 2383
316 Ga0207667_10006761 3300025949 Bacteria 13845
317 Ga0207667_10664085 3300025949 Bacteria 1047
318 Ga0207651_10001838 3300025960 Bacteria 9903
319 Ga0207712_10072127 3300025961 Bacteria 2486
320 Ga0207712_10152496 3300025961 Bacteria 1787
321 Ga0207712_10226545 3300025961 Bacteria 1498
322 Ga0207712_10317048 3300025961 Bacteria 1285
323 Ga0207668_10002116 3300025972 Bacteria 11591
324 Ga0207668_10673288 3300025972 Bacteria 907
325 Ga0207640_10004266 3300025981 Bacteria 7739
326 Ga0207658_10008007 3300025986 Bacteria 7197
327 Ga0207658_10354415 3300025986 Bacteria 1278
328 Ga0207677_10018797 3300026023 Bacteria 4156
329 Ga0207677_10159158 3300026023 Bacteria 1752
330 Ga0207703_10014360 3300026035 Bacteria 6177
331 Ga0207703_10021210 3300026035 Bacteria 5084
332 Ga0207703_10041614 3300026035 Bacteria 3682
333 Ga0207639_10002595 3300026041 Bacteria 12127
334 Ga0207678_10000401 3300026067 Bacteria 39431
335 Ga0207678_10248453 3300026067 Bacteria 1523
336 Ga0207708_10000809 3300026075 Bacteria 23494
337 Ga0207708_10004449 3300026075 Bacteria 10332
338 Ga0207708_10117281 3300026075 Bacteria 2072
339 Ga0207702_10350748 3300026078 Bacteria 1412
340 Ga0207641_10004155 3300026088 Bacteria 12616
341 Ga0207641_10009456 3300026088 Bacteria 8032
342 Ga0207641_10275211 3300026088 Bacteria 1581
343 Ga0207641_10279996 3300026088 Bacteria 1568
344 Ga0207648_10546126 3300026089 Bacteria 1064
345 Ga0207676_10019455 3300026095 Bacteria 4954
346 Ga0207676_10157705 3300026095 Bacteria 1962
347 Ga0207674_10000524 3300026116 Bacteria 50350
348 Ga0207675_100000358 3300026118 Bacteria 43765
349 Ga0207675_100000908 3300026118 Bacteria 29576
350 Ga0207675_100210807 3300026118 Bacteria 1868
351 Ga0207683_10000416 3300026121 Bacteria 39377
352 Ga0207683_10495966 3300026121 Bacteria 1128
353 Ga0207698_10003521 3300026142 Bacteria 9440
354 Ga0207698_11380723 3300026142 Bacteria 719
355 Ga0209588_1038707 3300027671 Bacteria 1537
356 Ga0209974_10135792 3300027876 Bacteria 879
357 Ga0265356_1000106 3300028017 Bacteria 14350
358 Ga0268266_10013221 3300028379 Bacteria 7115
359 Ga0268266_10049671 3300028379 Bacteria 3598
360 Ga0268266_10704654 3300028379 Bacteria 973
361 Ga0268265_10000285 3300028380 Bacteria 57084
362 Ga0268265_10011728 3300028380 Bacteria 5928
363 Ga0268265_10114864 3300028380 Bacteria 2205
364 Ga0268265_10427913 3300028380 Bacteria 1231
365 Ga0268265_11071370 3300028380 Bacteria 799
366 Ga0268264_10000010 3300028381 Bacteria 596543
367 Ga0268264_10120950 3300028381 Bacteria 2307
368 Ga0268264_10316219 3300028381 Bacteria 1475
369 Ga0265338_10409311 3300028800 Bacteria 966
370 Ga0265338_10449290 3300028800 Unclassified 913
371 Ga0265762_1000561 3300030760 Bacteria 6516
372 Ga0265760_10000138 3300031090 Bacteria 18344
373 Ga0265760_10073663 3300031090 Bacteria 1050
374 Ga0265330_10103468 3300031235 Bacteria 1218
375 Ga0265325_10033553 3300031241 Bacteria 2736
376 Ga0265329_10166070 3300031242 Bacteria 719
377 Ga0265340_10036071 3300031247 Bacteria 2453
378 Ga0265340_10041819 3300031247 Bacteria 2252
379 Ga0265340_10124740 3300031247 Bacteria 1183
380 Ga0265340_10125731 3300031247 Bacteria 1178
381 Ga0265340_10284351 3300031247 Bacteria 734
382 Ga0265327_10001788 3300031251 Bacteria 25267
383 Ga0265316_10020689 3300031344 Bacteria 5594
384 Ga0265316_10199146 3300031344 Bacteria 1485
385 Ga0307408_100315091 3300031548 Bacteria 1316
386 Ga0316579_10007419 3300031691 Bacteria 4528
387 Ga0265314_10257373 3300031711 Bacteria 998
388 Ga0265342_10059659 3300031712 Bacteria 2253
389 Ga0316576_10045262 3300031727 Bacteria 3181
390 Ga0307405_10106792 3300031731 Bacteria 1889
391 Ga0316577_10023237 3300031733 Bacteria 3442
392 Ga0316577_10070205 3300031733 Bacteria 1956
393 Ga0307413_10158479 3300031824 Bacteria 1587
394 Ga0307409_100718908 3300031995 Bacteria 1000
395 Ga0307416_100040997 3300032002 Bacteria 3603
396 Ga0307416_102856053 3300032002 Bacteria 578
397 Ga0307415_100920003 3300032126 Bacteria 807
398 Ga0307415_101266766 3300032126 Bacteria 697
399 Ga0316585_10066050 3300032137 Bacteria 1172
400 Ga0316585_10148503 3300032137 Bacteria 773
401 Ga0316580_10051043 3300032139 Bacteria 1274
402 Ga0316593_10004898 3300032168 Bacteria 3482
403 Ga0316592_1007181 3300033524 Bacteria 2170
404 Ga0316586_1009168 3300033527 Bacteria 1478
405 Ga0316588_1001383 3300033528 Bacteria 3951
406 Ga0316596_1001165 3300033541 Bacteria 5156
407 Ga0316214_1010086 3300033545 Bacteria 1278
408 Ga0373928_0083708 3300035084 Bacteria 808
409 Ga0373934_0090262 3300035086 Bacteria 1235
410 Ga0373949_0153564 3300035090 Bacteria 667
411 Ga0373923_0019383 3300035111 Bacteria 2634
412 Ga0373953_0006693 3300035117 Bacteria 3814
413 Ga0373953_0162063 3300035117 Unclassified 961
414 Ga0373954_0032376 3300035118 Bacteria 2417
415 Ga0373956_0017451 3300035119 Bacteria 3025
416 Ga0373957_0067648 3300035120 Bacteria 1393
417 Ga0373960_0288849 3300035121 Bacteria 606
418 Ga0373955_0037147 3300035172 Bacteria 2589
419 Ga0373961_0080981 3300035241 Bacteria 1022
420 Ga0373962_0026994 3300035242 Bacteria 1551
421 Ga0373962_0067231 3300035242 Bacteria 1064
422 Ga0373924_0113135 3300035410 Bacteria 1174
423 Ga0373931_0014158 3300035691 Bacteria 3895
424 Ga0373931_0147562 3300035691 Bacteria 1368
425 Ga0373935_0286418 3300035692 Bacteria 1161
426 Ga0373933_0002784 3300035724 Bacteria 9759
427 Ga0373933_0016238 3300035724 Bacteria 4160
428 Ga0373933_0044251 3300035724 Bacteria 2637
429 Ga0373933_0345567 3300035724 Bacteria 966
430 Ga0373947_0008668 3300035725 Bacteria 5851
431 Ga0373947_0457156 3300035725 Bacteria 865
432 Ga0373937_0000015 3300036401 Bacteria 148228
433 Ga0373937_0031209 3300036401 Bacteria 4827
434 Ga0373937_0055013 3300036401 Bacteria 3652
435 Ga0373937_0139947 3300036401 Bacteria 2264
436 Ga0373937_0261545 3300036401 Bacteria 1632
437 Ga0373937_0304942 3300036401 Bacteria 1506
438 Ga0316582_0473648 3300036647 Bacteria 863
439 Ga0316584_0088745 3300036712 Bacteria 2315
440 Ga0373925_0105920 3300037068 Bacteria 2167
441 Ga0373925_0448659 3300037068 Bacteria 1056
442 Ga0373925_0477039 3300037068 Bacteria 1023
443 Ga0373925_0481254 3300037068 Bacteria 1018
444 Ga0395900_0539154 3300037418 Bacteria 1113
445 Ga0395898_1810449 3300037466 Bacteria 532
446 Ga0316581_0005411 3300037588 Bacteria 3323
447 Ga0400485_01551 3300038735 Bacteria 1652
448 Ga0400486_28934 3300038742 Bacteria 1687
449 Ga0436365_0727276 3300039437 Bacteria 64269
450 Ga0436363_1097911 3300039450 Bacteria 1128
451 Ga0436363_1383154 3300039450 Bacteria 4500
452 Ga0450923_006324 3300042125 Bacteria 1958
453 Ga0495603_0109354 3300046455 Bacteria 1613
454 Ga0495603_0405888 3300046455 Unclassified 781
455 Ga0495638_0006875 3300046460 Bacteria 8212
456 Ga0495651_0005817 3300046462 Bacteria 9410
457 Ga0495651_0188294 3300046462 Bacteria 1454
458 Ga0495580_0130223 3300046472 Unclassified 1745
459 Ga0495580_0510676 3300046472 Bacteria 802
460 Ga0495662_0330816 3300046476 Bacteria 749
461 Ga0495618_0078882 3300046514 Bacteria 2099
462 Ga0495628_0189729 3300046516 Bacteria 1552
463 Ga0495628_0296398 3300046516 Bacteria 1198
464 Ga0495628_0425373 3300046516 Unclassified 967
465 Ga0495630_0220409 3300046517 Bacteria 1448
466 Ga0495630_0345481 3300046517 Bacteria 1139
467 Ga0495630_0698000 3300046517 Bacteria 776
468 Ga0495632_0100628 3300046519 Bacteria 1363
469 Ga0495640_0162308 3300046533 Bacteria 1431
470 Ga0495640_0162996 3300046533 Bacteria 1427
471 Ga0495586_0665819 3300046535 Bacteria 601
472 Ga0495587_0000219 3300046536 Bacteria 42459
473 Ga0495587_0041257 3300046536 Bacteria 2754
474 Ga0495645_0001163 3300046543 Bacteria 17915
475 Ga0495667_0581612 3300046559 Bacteria 698
476 Ga0495625_0002827 3300046660 Bacteria 18279
477 Ga0495635_0063595 3300046663 Unclassified 2534
478 Ga0495599_0093509 3300046678 Bacteria 1876
479 Ga0495623_0090980 3300046679 Bacteria 1873
480 Ga0495623_0244988 3300046679 Bacteria 1011
481 Ga0495646_0122906 3300046680 Unclassified 1467
482 Ga0495669_0383581 3300046684 Bacteria 680
483 Ga0495613_0041878 3300046689 Bacteria 3390
484 Ga0495613_0283980 3300046689 Bacteria 1149
485 Ga0495613_0376463 3300046689 Bacteria 971
486 Ga0495600_0012750 3300046809 Bacteria 5264
487 Ga0495581_0351618 3300047315 Bacteria 860
488 Ga0495604_0030100 3300047317 Bacteria 4315
489 Ga0495604_0064238 3300047317 Bacteria 2798
490 Ga0495674_0859316 3300047319 Bacteria 702
491 Ga0495680_0053349 3300047322 Bacteria 3147
492 Ga0495680_0358408 3300047322 Bacteria 1014
493 Ga0495675_0001097 3300047444 Bacteria 16431
494 Ga0495684_0230143 3300047471 Bacteria 1356
495 Ga0495684_0394362 3300047471 Bacteria 973
496 Ga0495602_0000206 3300048088 Bacteria 54913
497 Ga0495602_0080475 3300048088 Bacteria 2744
498 Ga0496100_0005125 3300048903 Bacteria 7024
499 Ga0496100_0276401 3300048903 Bacteria 1250
500 Ga0496100_0382101 3300048903 Bacteria 1070
501 Ga0496101_0001893 3300048904 Bacteria 12638
502 Ga0496101_0104180 3300048904 Bacteria 2127
503 Ga0496101_0202464 3300048904 Bacteria 1535
504 Ga0496102_0015717 3300048905 Bacteria 6594
505 Ga0496102_0132003 3300048905 Bacteria 2339
506 Ga0496102_1449739 3300048905 Bacteria 605
507 Ga0496103_0049012 3300048906 Bacteria 2611
508 Ga0496103_0320145 3300048906 Bacteria 997
509 Ga0496103_0469832 3300048906 Bacteria 806
510 Ga0496104_0059705 3300048907 Bacteria 3610
511 Ga0496104_0411474 3300048907 Bacteria 1264
512 Ga0496105_0007553 3300048908 Bacteria 8422
513 Ga0496105_0058866 3300048908 Bacteria 3170
514 Ga0496105_0207283 3300048908 Bacteria 1599
515 Ga0496106_0009062 3300048909 Bacteria 7356
516 Ga0496106_0017862 3300048909 Bacteria 5245
517 Ga0496107_0008324 3300048910 Bacteria 7174
518 Ga0496107_0026595 3300048910 Bacteria 4102
519 Ga0496107_0050542 3300048910 Bacteria 2997
520 Ga0496107_0640021 3300048910 Bacteria 784
521 Ga0496108_0016792 3300048911 Bacteria 5980
522 Ga0496108_0033905 3300048911 Bacteria 4240
523 Ga0496109_0061915 3300048912 Bacteria 3422
524 Ga0496109_0068799 3300048912 Bacteria 3245
525 Ga0496109_0078049 3300048912 Bacteria 3048
526 Ga0496109_0215061 3300048912 Bacteria 1807
527 Ga0496109_0452743 3300048912 Bacteria 1212
528 Ga0496110_0048322 3300048913 Bacteria 3729
529 Ga0496111_0031303 3300048914 Bacteria 3789
530 Ga0496111_0284031 3300048914 Bacteria 1227
531 Ga0496112_0010926 3300048915 Bacteria 8268
532 Ga0496112_0018578 3300048915 Bacteria 6550
533 Ga0496112_0237663 3300048915 Bacteria 1775
534 Ga0496112_0350550 3300048915 Bacteria 1418
535 Ga0496112_0402900 3300048915 Bacteria 1308
536 Ga0496113_0003818 3300048916 Bacteria 9116
537 Ga0496113_0056366 3300048916 Bacteria 2950
538 Ga0496113_0189367 3300048916 Bacteria 1633
539 Ga0496113_0259290 3300048916 Bacteria 1389
540 Ga0496114_0001346 3300048917 Bacteria 18615
541 Ga0496114_0009187 3300048917 Bacteria 7838
542 Ga0496115_0005692 3300048918 Bacteria 9072
543 Ga0496115_0016931 3300048918 Bacteria 5560
544 Ga0496115_0272821 3300048918 Bacteria 1389
545 Ga0501031_0207411 3300049568 Bacteria 1278
546 Ga0501032_0251252 3300049569 Bacteria 1148
547 Ga0501032_0448185 3300049569 Bacteria 827
548 Ga0501034_0001321 3300049571 Bacteria 33531
549 Ga0501036_0048606 3300049572 Bacteria 3592
550 Ga0501036_0244803 3300049572 Bacteria 1503
551 Ga0501036_0541255 3300049572 Bacteria 968
552 Ga0501037_0119993 3300049573 Bacteria 1891
553 Ga0501038_0281063 3300049574 Bacteria 1310
554 Ga0501038_0350647 3300049574 Bacteria 1149
555 Ga0501038_0370607 3300049574 Bacteria 1112
556 Ga0501038_0564483 3300049574 Bacteria 864
557 Ga0501039_0040919 3300049575 Bacteria 3578
558 Ga0501039_0178870 3300049575 Bacteria 1668
559 Ga0501039_1173632 3300049575 Bacteria 594
560 Ga0501040_0024388 3300049576 Bacteria 4059
561 Ga0501040_0048788 3300049576 Bacteria 2894
562 Ga0501040_0086191 3300049576 Bacteria 2180
563 Ga0501040_0219856 3300049576 Bacteria 1351
564 Ga0501041_0043223 3300049577 Bacteria 2739
565 Ga0501041_0080038 3300049577 Bacteria 2011
566 Ga0501041_0217621 3300049577 Bacteria 1198
567 Ga0501042_0030673 3300049578 Bacteria 3799
568 Ga0501042_0157480 3300049578 Bacteria 1638
569 Ga0501042_0265696 3300049578 Bacteria 1239
570 Ga0501043_0033445 3300049579 Bacteria 4046
571 Ga0501046_0145845 3300049580 Bacteria 1788
572 Ga0501048_0024801 3300049582 Bacteria 4374
573 Ga0501048_0386469 3300049582 Bacteria 1000
574 Ga0501048_0726809 3300049582 Bacteria 713
575 Ga0501067_0122570 3300049583 Bacteria 1447
576 Ga0501068_0019681 3300049584 Bacteria 3923
577 Ga0501068_0132331 3300049584 Bacteria 1560
578 Ga0501068_0203870 3300049584 Bacteria 1255
579 Ga0501068_0345448 3300049584 Bacteria 956
580 Ga0501069_0155722 3300049585 Bacteria 1314
581 Ga0501069_0390484 3300049585 Bacteria 823
582 Ga0501070_0088916 3300049586 Bacteria 2556
583 Ga0501070_0384210 3300049586 Bacteria 1137
584 Ga0501070_0731826 3300049586 Bacteria 781
585 Ga0501071_0013681 3300049587 Bacteria 5534
586 Ga0501071_0135334 3300049587 Bacteria 1833
587 Ga0501071_0480137 3300049587 Bacteria 953
588 Ga0501072_0027722 3300049588 Bacteria 4418
589 Ga0501072_0135146 3300049588 Bacteria 1966
590 Ga0501072_0169220 3300049588 Bacteria 1744
591 Ga0501072_0189985 3300049588 Bacteria 1638
592 Ga0501072_0202070 3300049588 Bacteria 1584
593 Ga0501073_0096334 3300049589 Bacteria 2055
594 Ga0501073_0170054 3300049589 Bacteria 1509
595 Ga0501074_0034186 3300049590 Bacteria 3685
596 Ga0501074_0053833 3300049590 Bacteria 2903
597 Ga0501074_0074625 3300049590 Bacteria 2435
598 Ga0501074_0144260 3300049590 Bacteria 1703
599 Ga0501074_0414554 3300049590 Bacteria 955
600 Ga0501075_0049908 3300049591 Bacteria 3145
601 Ga0501075_0153568 3300049591 Bacteria 1755
602 Ga0501075_0155406 3300049591 Bacteria 1744
603 Ga0501075_0185357 3300049591 Bacteria 1587
604 Ga0501075_0489062 3300049591 Bacteria 939
605 Ga0501075_0628530 3300049591 Bacteria 819
606 Ga0501076_0054516 3300049592 Bacteria 3169
607 Ga0501076_0082714 3300049592 Bacteria 2577
608 Ga0501076_0109907 3300049592 Bacteria 2228
609 Ga0501076_0128252 3300049592 Bacteria 2056
610 Ga0501077_0021699 3300049593 Bacteria 4065
611 Ga0501077_0196766 3300049593 Bacteria 1280
612 Ga0501077_0481386 3300049593 Bacteria 795
613 Ga0501077_0689104 3300049593 Bacteria 657
614 Ga0501223_016413 3300049663 Bacteria 1463
615 Ga0501257_000049 3300049686 Bacteria 33138
616 Ga0501079_0023514 3300049741 Bacteria 4729
617 Ga0501079_0051324 3300049741 Bacteria 3184
618 Ga0501079_0189395 3300049741 Bacteria 1605
619 Ga0501079_0219683 3300049741 Bacteria 1485
620 Ga0501079_0483561 3300049741 Bacteria 973
621 Ga0501080_0479382 3300049742 Bacteria 1113
622 Ga0501080_0494272 3300049742 Bacteria 1094
623 Ga0501081_0014256 3300049743 Bacteria 5241
624 Ga0501081_0049240 3300049743 Bacteria 2902
625 Ga0501081_0142454 3300049743 Bacteria 1718
626 Ga0501081_0430447 3300049743 Bacteria 979
627 Ga0501083_0122823 3300049744 Bacteria 1703
628 Ga0501083_0167354 3300049744 Bacteria 1437
629 Ga0501280_003193 3300049776 Bacteria 2556
630 Ga0501035_0049109 3300049822 Bacteria 3782
631 Ga0501035_1312255 3300049822 Bacteria 557
632 Ga0501045_0068718 3300049824 Bacteria 2603
633 Ga0501045_0108826 3300049824 Bacteria 2054
634 Ga0501045_0129989 3300049824 Bacteria 1872
635 nmdc:mga05p37_1308991_c1 3300050507 Bacteria 738
636 nmdc:mga05p37_68872_c1 3300050507 Bacteria 4351
637 nmdc:mga05p37_985001_c1 3300050507 Bacteria 898
638 nmdc:mga0qj67_344807_c1 3300050509 Bacteria 1205
639 nmdc:mga0qj67_714133_c1 3300050509 Unclassified 797
640 nmdc:mga06r32_151484_c1 3300050510 Bacteria 2298
641 nmdc:mga08y16_606268_c1 3300050511 Bacteria 1103
642 nmdc:mga0n895_1201169_c1 3300050512 Bacteria 732
643 nmdc:mga0rr50_73643_c1 3300050513 Bacteria 2612
644 nmdc:mga0rr50_91258_c1 3300050513 Bacteria 2372
645 nmdc:mga08x19_272838_c1 3300050514 Bacteria 1171
646 nmdc:mga0a205_449614_c1 3300050515 Bacteria 1148
647 Ga0495595_0222568 3300053084 Bacteria 942
648 Ga0495619_0349760 3300053085 Unclassified 1022
649 Ga0500625_012248 3300053729 Bacteria 3918
650 Ga0501084_0016279 3300054114 Bacteria 6175
651 Ga0501084_0028319 3300054114 Bacteria 4682
652 Ga0501084_0089771 3300054114 Bacteria 2579
653 Ga0501084_0105129 3300054114 Bacteria 2371
654 Ga0501084_0237332 3300054114 Bacteria 1539
655 Ga0501084_0630396 3300054114 Bacteria 905
656 Ga0501084_1114708 3300054114 Bacteria 662
657 Ga0590077_012928 3300059426 Bacteria 1733
658 Ga0501082_0103385 3300060353 Bacteria 2464
659 Ga0501082_0182484 3300060353 Bacteria 1825
660 Ga0530510_0011636 3300061734 Bacteria 6174
661 Ga0530510_0020861 3300061734 Bacteria 4660
662 Ga0530510_0119994 3300061734 Bacteria 1930
663 Ga0530510_0139243 3300061734 Bacteria 1787
664 Ga0530510_0406922 3300061734 Bacteria 1026

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100117138 Ga0070669_1001171382 162
2 3300005530 Ga0070679_100985603 Ga0070679_1009856031 162
3 3300005539 Ga0068853_100054633 Ga0068853_1000546331 162
4 3300005546 Ga0070696_101016533 Ga0070696_1010165331 162
5 3300005563 Ga0068855_100194090 Ga0068855_1001940902 162
6 3300005577 Ga0068857_100392284 Ga0068857_1003922842 162
7 3300005578 Ga0068854_100014348 Ga0068854_1000143486 162
8 3300005614 Ga0068856_100227853 Ga0068856_1002278533 162
9 3300005842 Ga0068858_100099514 Ga0068858_1000995144 162
10 3300006237 Ga0097621_100160698 Ga0097621_1001606982 162
11 3300009545 Ga0105237_10286040 Ga0105237_102860402 162
12 3300009551 Ga0105238_10013074 Ga0105238_100130744 162
13 3300046678 Ga0495599_0093509 Ga0495599_0093509_975_1511 162
14 3300003322 rootL2_10344107 rootL2_103441072 163
15 3300005290 Ga0065712_10429642 Ga0065712_104296422 163
16 3300005338 Ga0068868_100016942 Ga0068868_1000169423 163
17 3300005344 Ga0070661_100815913 Ga0070661_1008159131 163
18 3300005366 Ga0070659_100757801 Ga0070659_1007578012 163
19 3300005434 Ga0070709_10114986 Ga0070709_101149863 163
20 3300005434 Ga0070709_10120264 Ga0070709_101202642 163
21 3300005436 Ga0070713_100030941 Ga0070713_1000309415 163
22 3300005436 Ga0070713_100259934 Ga0070713_1002599342 163
23 3300005458 Ga0070681_10001396 Ga0070681_1000139624 163
24 3300005458 Ga0070681_10603144 Ga0070681_106031441 163
25 3300005466 Ga0070685_10011013 Ga0070685_100110132 163
26 3300005467 Ga0070706_100136654 Ga0070706_1001366542 163
27 3300005530 Ga0070679_100100744 Ga0070679_1001007443 163
28 3300005539 Ga0068853_100098948 Ga0068853_1000989483 163
29 3300005563 Ga0068855_100694659 Ga0068855_1006946592 163
30 3300005617 Ga0068859_100273747 Ga0068859_1002737472 163
31 3300005719 Ga0068861_100112150 Ga0068861_1001121502 163
32 3300005841 Ga0068863_100374286 Ga0068863_1003742862 163
33 3300005842 Ga0068858_100045051 Ga0068858_1000450515 163
34 3300005842 Ga0068858_100086579 Ga0068858_1000865792 163
35 3300005843 Ga0068860_100017469 Ga0068860_1000174693 163
36 3300005844 Ga0068862_100029227 Ga0068862_1000292272 163
37 3300006237 Ga0097621_101038306 Ga0097621_1010383062 163
38 3300006852 Ga0075433_11305720 Ga0075433_113057201 163
39 3300006931 Ga0097620_100273785 Ga0097620_1002737852 163
40 3300007076 Ga0075435_100097938 Ga0075435_1000979382 163
41 3300009177 Ga0105248_10072270 Ga0105248_100722702 163
42 3300009553 Ga0105249_10222956 Ga0105249_102229562 163
43 3300010375 Ga0105239_10003994 Ga0105239_1000399411 163
44 3300013296 Ga0157374_10003797 Ga0157374_100037974 163
45 3300013306 Ga0163162_10003369 Ga0163162_1000336913 163
46 3300013308 Ga0157375_10020734 Ga0157375_100207343 163
47 3300014745 Ga0157377_10037195 Ga0157377_100371953 163
48 3300014968 Ga0157379_10365860 Ga0157379_103658602 163
49 3300024225 Ga0224572_1014422 Ga0224572_10144222 163
50 3300024227 Ga0228598_1000036 Ga0228598_100003615 163
51 3300025904 Ga0207647_10002142 Ga0207647_1000214211 163
52 3300025906 Ga0207699_10184570 Ga0207699_101845702 163
53 3300025910 Ga0207684_10070391 Ga0207684_100703913 163
54 3300025912 Ga0207707_10026912 Ga0207707_100269127 163
55 3300025913 Ga0207695_10372007 Ga0207695_103720072 163
56 3300025914 Ga0207671_10289178 Ga0207671_102891782 163
57 3300025921 Ga0207652_10019036 Ga0207652_100190362 163
58 3300025928 Ga0207700_10282369 Ga0207700_102823692 163
59 3300025938 Ga0207704_10014366 Ga0207704_100143662 163
60 3300025941 Ga0207711_10042219 Ga0207711_100422192 163
61 3300025942 Ga0207689_10002538 Ga0207689_100025382 163
62 3300025942 Ga0207689_10329021 Ga0207689_103290212 163
63 3300025949 Ga0207667_10664085 Ga0207667_106640852 163
64 3300026023 Ga0207677_10159158 Ga0207677_101591582 163
65 3300026035 Ga0207703_10014360 Ga0207703_100143607 163
66 3300026088 Ga0207641_10275211 Ga0207641_102752112 163
67 3300026118 Ga0207675_100210807 Ga0207675_1002108073 163
68 3300026142 Ga0207698_11380723 Ga0207698_113807232 163
69 3300027671 Ga0209588_1038707 Ga0209588_10387072 163
70 3300028380 Ga0268265_10011728 Ga0268265_100117282 163
71 3300028381 Ga0268264_10120950 Ga0268264_101209502 163
72 3300028381 Ga0268264_10316219 Ga0268264_103162192 163
73 3300031090 Ga0265760_10073663 Ga0265760_100736631 163
74 3300031235 Ga0265330_10103468 Ga0265330_101034682 163
75 3300031241 Ga0265325_10033553 Ga0265325_100335532 163
76 3300031242 Ga0265329_10166070 Ga0265329_101660702 163
77 3300031247 Ga0265340_10036071 Ga0265340_100360712 163
78 3300031247 Ga0265340_10041819 Ga0265340_100418192 163
79 3300031247 Ga0265340_10124740 Ga0265340_101247401 163
80 3300031247 Ga0265340_10125731 Ga0265340_101257312 163
81 3300031251 Ga0265327_10001788 Ga0265327_1000178820 163
82 3300031344 Ga0265316_10020689 Ga0265316_100206895 163
83 3300031344 Ga0265316_10199146 Ga0265316_101991462 163
84 3300031712 Ga0265342_10059659 Ga0265342_100596592 163
85 3300035090 Ga0373949_0153564 Ga0373949_0153564_129_620 163
86 3300035118 Ga0373954_0032376 Ga0373954_0032376_1647_2171 163
87 3300035120 Ga0373957_0067648 Ga0373957_0067648_809_1333 163
88 3300035172 Ga0373955_0037147 Ga0373955_0037147_1312_1836 163
89 3300035410 Ga0373924_0113135 Ga0373924_0113135_210_734 163
90 3300035724 Ga0373933_0002784 Ga0373933_0002784_5252_5776 163
91 3300036401 Ga0373937_0000015 Ga0373937_0000015_15897_16421 163
92 3300036401 Ga0373937_0031209 Ga0373937_0031209_4165_4656 163
93 3300036401 Ga0373937_0139947 Ga0373937_0139947_1584_2075 163
94 3300037068 Ga0373925_0105920 Ga0373925_0105920_1427_1918 163
95 3300037068 Ga0373925_0477039 Ga0373925_0477039_455_946 163
96 3300037418 Ga0395900_0539154 Ga0395900_0539154_345_836 163
97 3300037466 Ga0395898_1810449 Ga0395898_1810449_28_519 163
98 3300046455 Ga0495603_0109354 Ga0495603_0109354_1052_1543 163
99 3300046462 Ga0495651_0005817 Ga0495651_0005817_8354_8878 163
100 3300046462 Ga0495651_0188294 Ga0495651_0188294_477_968 163
101 3300046472 Ga0495580_0130223 Ga0495580_0130223_1125_1616 163
102 3300046476 Ga0495662_0330816 Ga0495662_0330816_248_739 163
103 3300046514 Ga0495618_0078882 Ga0495618_0078882_1576_2067 163
104 3300046516 Ga0495628_0189729 Ga0495628_0189729_582_1073 163
105 3300046517 Ga0495630_0220409 Ga0495630_0220409_453_944 163
106 3300046533 Ga0495640_0162996 Ga0495640_0162996_739_1230 163
107 3300046536 Ga0495587_0000219 Ga0495587_0000219_3726_4250 163
108 3300046536 Ga0495587_0041257 Ga0495587_0041257_1748_2239 163
109 3300046543 Ga0495645_0001163 Ga0495645_0001163_8410_8901 163
110 3300046663 Ga0495635_0063595 Ga0495635_0063595_1853_2344 163
111 3300046679 Ga0495623_0244988 Ga0495623_0244988_332_823 163
112 3300046680 Ga0495646_0122906 Ga0495646_0122906_395_886 163
113 3300046689 Ga0495613_0041878 Ga0495613_0041878_2415_2906 163
114 3300046689 Ga0495613_0283980 Ga0495613_0283980_151_642 163
115 3300046809 Ga0495600_0012750 Ga0495600_0012750_1977_2468 163
116 3300047315 Ga0495581_0351618 Ga0495581_0351618_74_565 163
117 3300047317 Ga0495604_0030100 Ga0495604_0030100_3620_4144 163
118 3300047317 Ga0495604_0064238 Ga0495604_0064238_709_1200 163
119 3300047319 Ga0495674_0859316 Ga0495674_0859316_153_644 163
120 3300047322 Ga0495680_0358408 Ga0495680_0358408_70_561 163
121 3300047444 Ga0495675_0001097 Ga0495675_0001097_9111_9635 163
122 3300047471 Ga0495684_0230143 Ga0495684_0230143_542_1033 163
123 3300048088 Ga0495602_0000206 Ga0495602_0000206_16627_17151 163
124 3300048088 Ga0495602_0080475 Ga0495602_0080475_652_1143 163
125 3300048915 Ga0496112_0010926 Ga0496112_0010926_2122_2613 163
126 3300048915 Ga0496112_0018578 Ga0496112_0018578_3374_3865 163
127 3300048916 Ga0496113_0189367 Ga0496113_0189367_864_1355 163
128 3300050513 nmdc:mga0rr50_73643_c1 nmdc:mga0rr50_73643_c1_204_695 163
129 3300050513 nmdc:mga0rr50_91258_c1 nmdc:mga0rr50_91258_c1_1186_1677 163
130 3300050514 nmdc:mga08x19_272838_c1 nmdc:mga08x19_272838_c1_101_592 163
131 3300050515 nmdc:mga0a205_449614_c1 nmdc:mga0a205_449614_c1_154_645 163
132 3300053085 Ga0495619_0349760 Ga0495619_0349760_468_959 163
133 3300059426 Ga0590077_012928 Ga0590077_012928_1196_1699 163
134 3300005614 Ga0068856_100955104 Ga0068856_1009551042 164
135 3300005841 Ga0068863_100394536 Ga0068863_1003945363 164
136 3300009148 Ga0105243_10586939 Ga0105243_105869393 164
137 3300026088 Ga0207641_10279996 Ga0207641_102799961 164
138 3300032002 Ga0307416_102856053 Ga0307416_1028560531 164
139 3300032126 Ga0307415_101266766 Ga0307415_1012667662 164
140 3300035086 Ga0373934_0090262 Ga0373934_0090262_582_1076 164
141 3300035111 Ga0373923_0019383 Ga0373923_0019383_2105_2599 164
142 3300035117 Ga0373953_0162063 Ga0373953_0162063_118_612 164
143 3300035724 Ga0373933_0016238 Ga0373933_0016238_2262_2756 164
144 3300036401 Ga0373937_0055013 Ga0373937_0055013_124_618 164
145 3300046516 Ga0495628_0425373 Ga0495628_0425373_10_504 164
146 3300046679 Ga0495623_0090980 Ga0495623_0090980_425_919 164
147 3300050512 nmdc:mga0n895_1201169_c1 nmdc:mga0n895_1201169_c1_118_612 164
148 3300005548 Ga0070665_100203815 Ga0070665_1002038152 165
149 3300009553 Ga0105249_11278729 Ga0105249_112787291 165
150 3300014325 Ga0163163_12097697 Ga0163163_120976971 165
151 3300025925 Ga0207650_10173050 Ga0207650_101730502 165
152 3300026089 Ga0207648_10546126 Ga0207648_105461262 165
153 3300028379 Ga0268266_10049671 Ga0268266_100496719 165
154 3300028380 Ga0268265_10427913 Ga0268265_104279132 165
155 3300038735 Ga0400485_01551 Ga0400485_01551_572_1072 165
156 3300038742 Ga0400486_28934 Ga0400486_28934_629_1129 165
157 3300046455 Ga0495603_0405888 Ga0495603_0405888_227_724 165
158 3300048918 Ga0496115_0272821 Ga0496115_0272821_304_801 165
159 3300049571 Ga0501034_0001321 Ga0501034_0001321_12637_13137 165
160 3300049572 Ga0501036_0541255 Ga0501036_0541255_147_647 165
161 3300049588 Ga0501072_0027722 Ga0501072_0027722_887_1387 165
162 3300053729 Ga0500625_012248 Ga0500625_012248_588_1085 165
163 iso_pu_bacteria 2838074704 2838076903 165
164 iso_pu_bacteria 2920760137 2920761574 165
165 3300002239 JGI24034J26672_10020594 JGI24034J26672_100205942 166
166 3300005295 Ga0065707_10365715 Ga0065707_103657151 166
167 3300005331 Ga0070670_100006332 Ga0070670_1000063326 166
168 3300005335 Ga0070666_10000184 Ga0070666_1000018436 166
169 3300005347 Ga0070668_100065828 Ga0070668_1000658282 166
170 3300005353 Ga0070669_100000008 Ga0070669_10000000859 166
171 3300005355 Ga0070671_100000015 Ga0070671_100000015152 166
172 3300005367 Ga0070667_100125738 Ga0070667_1001257382 166
173 3300005435 Ga0070714_100112156 Ga0070714_1001121564 166
174 3300005436 Ga0070713_100066254 Ga0070713_1000662542 166
175 3300005445 Ga0070708_100064225 Ga0070708_1000642254 166
176 3300005548 Ga0070665_100097361 Ga0070665_1000973614 166
177 3300005615 Ga0070702_100667327 Ga0070702_1006673271 166
178 3300005617 Ga0068859_100002375 Ga0068859_10000237514 166
179 3300005618 Ga0068864_100003703 Ga0068864_10000370312 166
180 3300005719 Ga0068861_100001851 Ga0068861_10000185111 166
181 3300005841 Ga0068863_100003742 Ga0068863_1000037429 166
182 3300005842 Ga0068858_100019432 Ga0068858_1000194328 166
183 3300005843 Ga0068860_100001081 Ga0068860_1000010814 166
184 3300005844 Ga0068862_100006641 Ga0068862_1000066412 166
185 3300006028 Ga0070717_10508525 Ga0070717_105085252 166
186 3300006931 Ga0097620_100002375 Ga0097620_10000237514 166
187 3300009101 Ga0105247_10001891 Ga0105247_100018916 166
188 3300009177 Ga0105248_10054850 Ga0105248_100548506 166
189 3300009553 Ga0105249_10003539 Ga0105249_1000353913 166
190 3300013306 Ga0163162_10007327 Ga0163162_100073278 166
191 3300014325 Ga0163163_10013796 Ga0163163_100137963 166
192 3300014326 Ga0157380_10323625 Ga0157380_103236252 166
193 3300014968 Ga0157379_10011989 Ga0157379_100119894 166
194 3300017792 Ga0163161_10098109 Ga0163161_100981093 166
195 3300025315 Ga0207697_10000274 Ga0207697_1000027410 166
196 3300025900 Ga0207710_10023544 Ga0207710_100235443 166
197 3300025906 Ga0207699_10008743 Ga0207699_100087433 166
198 3300025914 Ga0207671_10418887 Ga0207671_104188872 166
199 3300025915 Ga0207693_10565027 Ga0207693_105650272 166
200 3300025923 Ga0207681_10000002 Ga0207681_10000002151 166
201 3300025925 Ga0207650_10009399 Ga0207650_100093996 166
202 3300025928 Ga0207700_10053074 Ga0207700_100530742 166
203 3300025929 Ga0207664_10100539 Ga0207664_101005393 166
204 3300025931 Ga0207644_10000002 Ga0207644_10000002150 166
205 3300025941 Ga0207711_10032876 Ga0207711_100328766 166
206 3300025961 Ga0207712_10072127 Ga0207712_100721273 166
207 3300025972 Ga0207668_10002116 Ga0207668_100021168 166
208 3300025986 Ga0207658_10008007 Ga0207658_100080072 166
209 3300026035 Ga0207703_10021210 Ga0207703_100212105 166
210 3300026088 Ga0207641_10004155 Ga0207641_100041556 166
211 3300026095 Ga0207676_10019455 Ga0207676_100194555 166
212 3300026118 Ga0207675_100000358 Ga0207675_10000035819 166
213 3300028380 Ga0268265_10000285 Ga0268265_1000028553 166
214 3300028381 Ga0268264_10000010 Ga0268264_10000010368 166
215 3300031995 Ga0307409_100718908 Ga0307409_1007189082 166
216 3300046472 Ga0495580_0510676 Ga0495580_0510676_140_679 166
217 3300046535 Ga0495586_0665819 Ga0495586_0665819_75_584 166
218 3300049588 Ga0501072_0169220 Ga0501072_0169220_1212_1715 166
219 3300054114 Ga0501084_1114708 Ga0501084_1114708_15_518 166
220 3300009148 Ga0105243_10241823 Ga0105243_102418231 167
221 3300014326 Ga0157380_10805219 Ga0157380_108052192 167
222 3300025928 Ga0207700_10958806 Ga0207700_109588061 167
223 3300028800 Ga0265338_10449290 Ga0265338_104492902 167
224 3300031711 Ga0265314_10257373 Ga0265314_102573732 167
225 3300046460 Ga0495638_0006875 Ga0495638_0006875_4868_5374 167
226 3300046660 Ga0495625_0002827 Ga0495625_0002827_10998_11504 167
227 3300049663 Ga0501223_016413 Ga0501223_016413_880_1386 167
228 3300049686 Ga0501257_000049 Ga0501257_000049_11015_11521 167
229 3300049776 Ga0501280_003193 Ga0501280_003193_979_1485 167
230 3300046684 Ga0495669_0383581 Ga0495669_0383581_40_549 168
231 3300049574 Ga0501038_0350647 Ga0501038_0350647_237_743 168
232 3300049578 Ga0501042_0030673 Ga0501042_0030673_3283_3789 168
233 3300049578 Ga0501042_0265696 Ga0501042_0265696_717_1226 168
234 3300049579 Ga0501043_0033445 Ga0501043_0033445_2035_2541 168
235 3300049584 Ga0501068_0019681 Ga0501068_0019681_2570_3076 168
236 3300049590 Ga0501074_0034186 Ga0501074_0034186_2964_3470 168
237 3300049742 Ga0501080_0494272 Ga0501080_0494272_395_901 168
238 3300049743 Ga0501081_0014256 Ga0501081_0014256_2256_2762 168
239 3300049744 Ga0501083_0167354 Ga0501083_0167354_557_1063 168
240 3300050507 nmdc:mga05p37_1308991_c1 nmdc:mga05p37_1308991_c1_128_637 168
241 3300054114 Ga0501084_0089771 Ga0501084_0089771_566_1072 168
242 3300003316 rootH1_10098898 rootH1_100988982 169
243 3300005983 Ga0081540_1006477 Ga0081540_10064772 169
244 3300006844 Ga0075428_100647968 Ga0075428_1006479682 169
245 3300006846 Ga0075430_100169822 Ga0075430_1001698223 169
246 3300009147 Ga0114129_10533555 Ga0114129_105335552 169
247 3300010159 Ga0099796_10102754 Ga0099796_101027542 169
248 3300019188 Ga0184599_122713 Ga0184599_1227132 169
249 3300022730 Ga0224570_100713 Ga0224570_1007132 169
250 3300022734 Ga0224571_108185 Ga0224571_1081852 169
251 3300024225 Ga0224572_1001411 Ga0224572_10014112 169
252 3300028017 Ga0265356_1000106 Ga0265356_100010613 169
253 3300030760 Ga0265762_1000561 Ga0265762_10005616 169
254 3300031090 Ga0265760_10000138 Ga0265760_1000013817 169
255 3300033545 Ga0316214_1010086 Ga0316214_10100862 169
256 3300050507 nmdc:mga05p37_985001_c1 nmdc:mga05p37_985001_c1_197_718 169
257 3300050509 nmdc:mga0qj67_344807_c1 nmdc:mga0qj67_344807_c1_670_1191 169
258 3300050510 nmdc:mga06r32_151484_c1 nmdc:mga06r32_151484_c1_1044_1565 169
259 3300005544 Ga0070686_100067493 Ga0070686_1000674932 170
260 3300028800 Ga0265338_10409311 Ga0265338_104093112 170
261 3300031548 Ga0307408_100315091 Ga0307408_1003150912 170
262 3300031731 Ga0307405_10106792 Ga0307405_101067923 170
263 3300031824 Ga0307413_10158479 Ga0307413_101584793 170
264 3300032002 Ga0307416_100040997 Ga0307416_1000409974 170
265 3300032126 Ga0307415_100920003 Ga0307415_1009200032 170
266 3300035117 Ga0373953_0006693 Ga0373953_0006693_2772_3299 170
267 3300035119 Ga0373956_0017451 Ga0373956_0017451_860_1387 170
268 3300035692 Ga0373935_0286418 Ga0373935_0286418_231_758 170
269 3300035724 Ga0373933_0044251 Ga0373933_0044251_1475_2002 170
270 3300035725 Ga0373947_0457156 Ga0373947_0457156_10_537 170
271 3300037068 Ga0373925_0448659 Ga0373925_0448659_156_683 170
272 3300042125 Ga0450923_006324 Ga0450923_006324_80_595 170
273 3300046516 Ga0495628_0296398 Ga0495628_0296398_179_706 170
274 3300046517 Ga0495630_0698000 Ga0495630_0698000_34_561 170
275 3300046559 Ga0495667_0581612 Ga0495667_0581612_25_552 170
276 3300046689 Ga0495613_0376463 Ga0495613_0376463_78_605 170
277 3300047471 Ga0495684_0394362 Ga0495684_0394362_191_718 170
278 3300005353 Ga0070669_100458512 Ga0070669_1004585122 171
279 3300005365 Ga0070688_100416387 Ga0070688_1004163872 171
280 3300005441 Ga0070700_100047121 Ga0070700_1000471212 171
281 3300005719 Ga0068861_100355457 Ga0068861_1003554573 171
282 3300009147 Ga0114129_10489451 Ga0114129_104894513 171
283 3300021377 Ga0213874_10012055 Ga0213874_100120552 171
284 3300021384 Ga0213876_10000170 Ga0213876_1000017051 171
285 3300025917 Ga0207660_10042023 Ga0207660_100420233 171
286 3300025928 Ga0207700_10746004 Ga0207700_107460041 171
287 3300026075 Ga0207708_10004449 Ga0207708_100044497 171
288 3300039437 Ga0436365_0727276 Ga0436365_0727276_11966_12481 171
289 3300039450 Ga0436363_1383154 Ga0436363_1383154_1276_1791 171
290 3300005366 Ga0070659_100377510 Ga0070659_1003775102 172
291 3300049586 Ga0501070_0088916 Ga0501070_0088916_1880_2401 172
292 3300049593 Ga0501077_0481386 Ga0501077_0481386_130_654 172
293 3300049822 Ga0501035_1312255 Ga0501035_1312255_18_539 172
294 3300009553 Ga0105249_10548810 Ga0105249_105488102 173
295 3300031691 Ga0316579_10007419 Ga0316579_100074193 173
296 3300031733 Ga0316577_10070205 Ga0316577_100702053 173
297 3300032137 Ga0316585_10066050 Ga0316585_100660502 173
298 3300035725 Ga0373947_0008668 Ga0373947_0008668_3727_4254 173
299 3300037068 Ga0373925_0481254 Ga0373925_0481254_250_777 173
300 3300039450 Ga0436363_1097911 Ga0436363_1097911_219_746 173
301 3300046517 Ga0495630_0345481 Ga0495630_0345481_336_863 173
302 3300046533 Ga0495640_0162308 Ga0495640_0162308_569_1096 173
303 3300047322 Ga0495680_0053349 Ga0495680_0053349_1131_1658 173
304 3300050509 nmdc:mga0qj67_714133_c1 nmdc:mga0qj67_714133_c1_142_699 173
305 3300005937 Ga0081455_10002652 Ga0081455_100026524 174
306 3300005937 Ga0081455_10022381 Ga0081455_100223812 174
307 3300031247 Ga0265340_10284351 Ga0265340_102843511 174
308 3300048908 Ga0496105_0007553 Ga0496105_0007553_2612_3139 174
309 3300049569 Ga0501032_0448185 Ga0501032_0448185_143_670 174
310 3300049574 Ga0501038_0281063 Ga0501038_0281063_582_1109 174
311 3300049575 Ga0501039_0178870 Ga0501039_0178870_408_935 174
312 3300049576 Ga0501040_0048788 Ga0501040_0048788_2021_2548 174
313 3300049580 Ga0501046_0145845 Ga0501046_0145845_600_1127 174
314 3300049582 Ga0501048_0024801 Ga0501048_0024801_2702_3229 174
315 3300049583 Ga0501067_0122570 Ga0501067_0122570_175_699 174
316 3300049585 Ga0501069_0390484 Ga0501069_0390484_108_632 174
317 3300049587 Ga0501071_0480137 Ga0501071_0480137_185_712 174
318 3300049588 Ga0501072_0189985 Ga0501072_0189985_560_1087 174
319 3300049590 Ga0501074_0053833 Ga0501074_0053833_2103_2630 174
320 3300049591 Ga0501075_0153568 Ga0501075_0153568_503_1030 174
321 3300049592 Ga0501076_0109907 Ga0501076_0109907_1383_1910 174
322 3300049593 Ga0501077_0021699 Ga0501077_0021699_1223_1750 174
323 3300049742 Ga0501080_0479382 Ga0501080_0479382_559_1086 174
324 3300049824 Ga0501045_0129989 Ga0501045_0129989_67_594 174
325 3300054114 Ga0501084_0630396 Ga0501084_0630396_329_856 174
326 3300061734 Ga0530510_0020861 Ga0530510_0020861_3817_4344 174
327 3300006175 Ga0070712_100154216 Ga0070712_1001542161 175
328 3300009147 Ga0114129_10270067 Ga0114129_102700674 175
329 3300025906 Ga0207699_10265829 Ga0207699_102658292 175
330 3300025915 Ga0207693_10303506 Ga0207693_103035062 175
331 3300025939 Ga0207665_10031996 Ga0207665_100319962 175
332 3300035724 Ga0373933_0345567 Ga0373933_0345567_175_705 175
333 3300036401 Ga0373937_0261545 Ga0373937_0261545_350_880 175
334 3300048903 Ga0496100_0382101 Ga0496100_0382101_378_908 175
335 3300048905 Ga0496102_0132003 Ga0496102_0132003_255_785 175
336 3300048906 Ga0496103_0469832 Ga0496103_0469832_145_675 175
337 3300048908 Ga0496105_0207283 Ga0496105_0207283_737_1267 175
338 3300048910 Ga0496107_0050542 Ga0496107_0050542_2094_2624 175
339 3300048912 Ga0496109_0452743 Ga0496109_0452743_178_708 175
340 3300048916 Ga0496113_0259290 Ga0496113_0259290_563_1093 175
341 3300053084 Ga0495595_0222568 Ga0495595_0222568_138_668 175
342 3300001990 JGI24737J22298_10015591 JGI24737J22298_100155915 176
343 3300001991 JGI24743J22301_10030376 JGI24743J22301_100303762 176
344 3300002070 JGI24750J21931_1001123 JGI24750J21931_10011232 176
345 3300002073 JGI24745J21846_1017478 JGI24745J21846_10174782 176
346 3300005328 Ga0070676_10001040 Ga0070676_1000104012 176
347 3300005329 Ga0070683_100079541 Ga0070683_1000795413 176
348 3300005330 Ga0070690_100060456 Ga0070690_1000604563 176
349 3300005331 Ga0070670_100003994 Ga0070670_1000039944 176
350 3300005334 Ga0068869_100877632 Ga0068869_1008776321 176
351 3300005335 Ga0070666_10372063 Ga0070666_103720632 176
352 3300005337 Ga0070682_100014187 Ga0070682_1000141876 176
353 3300005338 Ga0068868_100011581 Ga0068868_1000115812 176
354 3300005339 Ga0070660_100015280 Ga0070660_1000152805 176
355 3300005340 Ga0070689_100000219 Ga0070689_10000021914 176
356 3300005340 Ga0070689_100022362 Ga0070689_1000223625 176
357 3300005341 Ga0070691_10000775 Ga0070691_100007756 176
358 3300005344 Ga0070661_100000383 Ga0070661_10000038315 176
359 3300005345 Ga0070692_10000953 Ga0070692_100009532 176
360 3300005347 Ga0070668_100002203 Ga0070668_10000220313 176
361 3300005347 Ga0070668_100774343 Ga0070668_1007743431 176
362 3300005353 Ga0070669_100003604 Ga0070669_10000360413 176
363 3300005354 Ga0070675_100005782 Ga0070675_1000057823 176
364 3300005355 Ga0070671_100001149 Ga0070671_10000114912 176
365 3300005356 Ga0070674_100017247 Ga0070674_1000172473 176
366 3300005364 Ga0070673_100233477 Ga0070673_1002334772 176
367 3300005365 Ga0070688_100001435 Ga0070688_10000143514 176
368 3300005366 Ga0070659_100549679 Ga0070659_1005496791 176
369 3300005366 Ga0070659_100807902 Ga0070659_1008079021 176
370 3300005367 Ga0070667_100006317 Ga0070667_1000063172 176
371 3300005406 Ga0070703_10013427 Ga0070703_100134272 176
372 3300005434 Ga0070709_10017423 Ga0070709_100174235 176
373 3300005435 Ga0070714_100003382 Ga0070714_1000033822 176
374 3300005437 Ga0070710_10006473 Ga0070710_100064734 176
375 3300005438 Ga0070701_10001291 Ga0070701_100012917 176
376 3300005439 Ga0070711_100000201 Ga0070711_10000020128 176
377 3300005439 Ga0070711_100263488 Ga0070711_1002634882 176
378 3300005440 Ga0070705_100001686 Ga0070705_10000168620 176
379 3300005444 Ga0070694_100015238 Ga0070694_1000152381 176
380 3300005455 Ga0070663_100000190 Ga0070663_10000019014 176
381 3300005455 Ga0070663_100397458 Ga0070663_1003974582 176
382 3300005456 Ga0070678_100002392 Ga0070678_1000023925 176
383 3300005457 Ga0070662_100553074 Ga0070662_1005530742 176
384 3300005458 Ga0070681_10086875 Ga0070681_100868753 176
385 3300005459 Ga0068867_100043246 Ga0068867_1000432464 176
386 3300005466 Ga0070685_10004770 Ga0070685_100047705 176
387 3300005518 Ga0070699_100042983 Ga0070699_1000429835 176
388 3300005535 Ga0070684_100031953 Ga0070684_1000319537 176
389 3300005536 Ga0070697_100003155 Ga0070697_1000031556 176
390 3300005539 Ga0068853_100000460 Ga0068853_10000046019 176
391 3300005543 Ga0070672_100000564 Ga0070672_1000005642 176
392 3300005543 Ga0070672_100279077 Ga0070672_1002790772 176
393 3300005544 Ga0070686_100000306 Ga0070686_10000030628 176
394 3300005545 Ga0070695_100002867 Ga0070695_10000286717 176
395 3300005545 Ga0070695_100269421 Ga0070695_1002694213 176
396 3300005546 Ga0070696_100010206 Ga0070696_1000102066 176
397 3300005547 Ga0070693_100002707 Ga0070693_1000027071 176
398 3300005548 Ga0070665_100060733 Ga0070665_1000607331 176
399 3300005549 Ga0070704_100001638 Ga0070704_10000163820 176
400 3300005563 Ga0068855_100004155 Ga0068855_10000415515 176
401 3300005564 Ga0070664_100063935 Ga0070664_1000639353 176
402 3300005577 Ga0068857_100000318 Ga0068857_1000003186 176
403 3300005578 Ga0068854_100034996 Ga0068854_1000349963 176
404 3300005578 Ga0068854_100235688 Ga0068854_1002356882 176
405 3300005614 Ga0068856_100030353 Ga0068856_1000303533 176
406 3300005615 Ga0070702_100004629 Ga0070702_1000046292 176
407 3300005616 Ga0068852_100107155 Ga0068852_1001071551 176
408 3300005617 Ga0068859_100004533 Ga0068859_10000453310 176
409 3300005617 Ga0068859_100538034 Ga0068859_1005380342 176
410 3300005618 Ga0068864_100211910 Ga0068864_1002119102 176
411 3300005718 Ga0068866_10000636 Ga0068866_1000063612 176
412 3300005718 Ga0068866_10052166 Ga0068866_100521662 176
413 3300005719 Ga0068861_100000277 Ga0068861_10000027724 176
414 3300005719 Ga0068861_100085472 Ga0068861_1000854722 176
415 3300005719 Ga0068861_100611348 Ga0068861_1006113481 176
416 3300005834 Ga0068851_10034206 Ga0068851_100342063 176
417 3300005841 Ga0068863_100000968 Ga0068863_10000096824 176
418 3300005842 Ga0068858_100006243 Ga0068858_1000062435 176
419 3300005842 Ga0068858_100038583 Ga0068858_1000385836 176
420 3300005843 Ga0068860_100027086 Ga0068860_1000270867 176
421 3300005844 Ga0068862_100022138 Ga0068862_1000221382 176
422 3300005844 Ga0068862_100723671 Ga0068862_1007236711 176
423 3300006163 Ga0070715_10001080 Ga0070715_1000108012 176
424 3300006173 Ga0070716_100007391 Ga0070716_1000073919 176
425 3300006175 Ga0070712_100000840 Ga0070712_10000084010 176
426 3300006237 Ga0097621_100032862 Ga0097621_1000328623 176
427 3300006881 Ga0068865_100018469 Ga0068865_1000184696 176
428 3300006881 Ga0068865_100097171 Ga0068865_1000971712 176
429 3300006931 Ga0097620_100004533 Ga0097620_10000453310 176
430 3300006931 Ga0097620_100538056 Ga0097620_1005380562 176
431 3300009092 Ga0105250_10004823 Ga0105250_100048235 176
432 3300009093 Ga0105240_10072847 Ga0105240_100728472 176
433 3300009098 Ga0105245_10004696 Ga0105245_1000469617 176
434 3300009101 Ga0105247_10000361 Ga0105247_1000036135 176
435 3300009101 Ga0105247_10066081 Ga0105247_100660812 176
436 3300009147 Ga0114129_10193369 Ga0114129_101933692 176
437 3300009147 Ga0114129_12478275 Ga0114129_124782751 176
438 3300009148 Ga0105243_10001606 Ga0105243_100016063 176
439 3300009148 Ga0105243_10055222 Ga0105243_100552224 176
440 3300009148 Ga0105243_10262925 Ga0105243_102629252 176
441 3300009174 Ga0105241_10001291 Ga0105241_100012918 176
442 3300009176 Ga0105242_10020157 Ga0105242_100201577 176
443 3300009177 Ga0105248_10000586 Ga0105248_1000058610 176
444 3300009177 Ga0105248_10146582 Ga0105248_101465823 176
445 3300009545 Ga0105237_10003139 Ga0105237_100031392 176
446 3300009551 Ga0105238_10118083 Ga0105238_101180833 176
447 3300009553 Ga0105249_10181812 Ga0105249_101818122 176
448 3300010375 Ga0105239_10107980 Ga0105239_101079802 176
449 3300011119 Ga0105246_10000208 Ga0105246_100002086 176
450 3300011119 Ga0105246_10152973 Ga0105246_101529733 176
451 3300013102 Ga0157371_10007923 Ga0157371_100079237 176
452 3300013105 Ga0157369_10021041 Ga0157369_100210417 176
453 3300013296 Ga0157374_10034884 Ga0157374_100348843 176
454 3300013297 Ga0157378_10000452 Ga0157378_1000045227 176
455 3300013297 Ga0157378_10048564 Ga0157378_100485644 176
456 3300013297 Ga0157378_10062694 Ga0157378_100626944 176
457 3300013306 Ga0163162_10002876 Ga0163162_100028766 176
458 3300013307 Ga0157372_10000529 Ga0157372_1000052915 176
459 3300013307 Ga0157372_10391804 Ga0157372_103918042 176
460 3300013308 Ga0157375_10001554 Ga0157375_1000155410 176
461 3300013308 Ga0157375_10002784 Ga0157375_1000278414 176
462 3300014325 Ga0163163_10009295 Ga0163163_100092952 176
463 3300014326 Ga0157380_10019453 Ga0157380_100194533 176
464 3300014326 Ga0157380_10178296 Ga0157380_101782962 176
465 3300014326 Ga0157380_10770853 Ga0157380_107708532 176
466 3300014745 Ga0157377_10159268 Ga0157377_101592683 176
467 3300014968 Ga0157379_10020462 Ga0157379_100204625 176
468 3300014968 Ga0157379_10048156 Ga0157379_100481562 176
469 3300014969 Ga0157376_10517878 Ga0157376_105178782 176
470 3300014969 Ga0157376_10668246 Ga0157376_106682462 176
471 3300017792 Ga0163161_10000549 Ga0163161_1000054933 176
472 3300017792 Ga0163161_10168203 Ga0163161_101682032 176
473 3300025315 Ga0207697_10153956 Ga0207697_101539562 176
474 3300025321 Ga0207656_10071398 Ga0207656_100713982 176
475 3300025885 Ga0207653_10044388 Ga0207653_100443882 176
476 3300025898 Ga0207692_10007121 Ga0207692_100071217 176
477 3300025899 Ga0207642_10012479 Ga0207642_100124793 176
478 3300025900 Ga0207710_10299210 Ga0207710_102992102 176
479 3300025901 Ga0207688_10017490 Ga0207688_100174903 176
480 3300025901 Ga0207688_10270112 Ga0207688_102701122 176
481 3300025905 Ga0207685_10013786 Ga0207685_100137863 176
482 3300025906 Ga0207699_10014321 Ga0207699_100143211 176
483 3300025907 Ga0207645_10009805 Ga0207645_100098052 176
484 3300025908 Ga0207643_10236117 Ga0207643_102361172 176
485 3300025911 Ga0207654_10031516 Ga0207654_100315162 176
486 3300025912 Ga0207707_10331884 Ga0207707_103318841 176
487 3300025915 Ga0207693_10000247 Ga0207693_1000024742 176
488 3300025916 Ga0207663_10002489 Ga0207663_100024897 176
489 3300025916 Ga0207663_10156668 Ga0207663_101566683 176
490 3300025916 Ga0207663_10325658 Ga0207663_103256581 176
491 3300025919 Ga0207657_10000257 Ga0207657_1000025753 176
492 3300025919 Ga0207657_10478530 Ga0207657_104785302 176
493 3300025920 Ga0207649_10010986 Ga0207649_100109861 176
494 3300025923 Ga0207681_10021983 Ga0207681_100219832 176
495 3300025925 Ga0207650_10807430 Ga0207650_108074301 176
496 3300025927 Ga0207687_10166359 Ga0207687_101663591 176
497 3300025929 Ga0207664_10086794 Ga0207664_100867944 176
498 3300025931 Ga0207644_10006496 Ga0207644_100064967 176
499 3300025932 Ga0207690_10001995 Ga0207690_1000199512 176
500 3300025933 Ga0207706_10000691 Ga0207706_1000069124 176
501 3300025934 Ga0207686_10812250 Ga0207686_108122502 176
502 3300025935 Ga0207709_10300832 Ga0207709_103008322 176
503 3300025936 Ga0207670_10377552 Ga0207670_103775521 176
504 3300025936 Ga0207670_11168598 Ga0207670_111685981 176
505 3300025937 Ga0207669_10135004 Ga0207669_101350041 176
506 3300025938 Ga0207704_10127650 Ga0207704_101276503 176
507 3300025938 Ga0207704_10513086 Ga0207704_105130862 176
508 3300025938 Ga0207704_11103402 Ga0207704_111034021 176
509 3300025939 Ga0207665_10001185 Ga0207665_100011858 176
510 3300025940 Ga0207691_10000483 Ga0207691_1000048324 176
511 3300025941 Ga0207711_10039646 Ga0207711_100396464 176
512 3300025941 Ga0207711_10691037 Ga0207711_106910371 176
513 3300025941 Ga0207711_10846935 Ga0207711_108469352 176
514 3300025942 Ga0207689_10218204 Ga0207689_102182042 176
515 3300025944 Ga0207661_10104705 Ga0207661_101047052 176
516 3300025949 Ga0207667_10006761 Ga0207667_100067612 176
517 3300025960 Ga0207651_10001838 Ga0207651_100018385 176
518 3300025961 Ga0207712_10152496 Ga0207712_101524962 176
519 3300025961 Ga0207712_10226545 Ga0207712_102265451 176
520 3300025961 Ga0207712_10317048 Ga0207712_103170481 176
521 3300025972 Ga0207668_10673288 Ga0207668_106732881 176
522 3300025981 Ga0207640_10004266 Ga0207640_100042663 176
523 3300025986 Ga0207658_10354415 Ga0207658_103544152 176
524 3300026023 Ga0207677_10018797 Ga0207677_100187975 176
525 3300026035 Ga0207703_10041614 Ga0207703_100416142 176
526 3300026041 Ga0207639_10002595 Ga0207639_100025956 176
527 3300026067 Ga0207678_10000401 Ga0207678_1000040142 176
528 3300026067 Ga0207678_10248453 Ga0207678_102484531 176
529 3300026075 Ga0207708_10000809 Ga0207708_100008093 176
530 3300026075 Ga0207708_10117281 Ga0207708_101172812 176
531 3300026078 Ga0207702_10350748 Ga0207702_103507482 176
532 3300026088 Ga0207641_10009456 Ga0207641_100094562 176
533 3300026095 Ga0207676_10157705 Ga0207676_101577053 176
534 3300026116 Ga0207674_10000524 Ga0207674_1000052456 176
535 3300026118 Ga0207675_100000908 Ga0207675_10000090827 176
536 3300026121 Ga0207683_10000416 Ga0207683_1000041637 176
537 3300026121 Ga0207683_10495966 Ga0207683_104959661 176
538 3300026142 Ga0207698_10003521 Ga0207698_100035212 176
539 3300027876 Ga0209974_10135792 Ga0209974_101357922 176
540 3300028379 Ga0268266_10013221 Ga0268266_100132214 176
541 3300028379 Ga0268266_10704654 Ga0268266_107046542 176
542 3300028380 Ga0268265_10114864 Ga0268265_101148643 176
543 3300028380 Ga0268265_11071370 Ga0268265_110713701 176
544 3300031727 Ga0316576_10045262 Ga0316576_100452621 176
545 3300031733 Ga0316577_10023237 Ga0316577_100232372 176
546 3300032137 Ga0316585_10148503 Ga0316585_101485031 176
547 3300032139 Ga0316580_10051043 Ga0316580_100510433 176
548 3300032168 Ga0316593_10004898 Ga0316593_100048982 176
549 3300033524 Ga0316592_1007181 Ga0316592_10071812 176
550 3300033527 Ga0316586_1009168 Ga0316586_10091682 176
551 3300033528 Ga0316588_1001383 Ga0316588_10013832 176
552 3300033541 Ga0316596_1001165 Ga0316596_10011652 176
553 3300035084 Ga0373928_0083708 Ga0373928_0083708_165_695 176
554 3300035121 Ga0373960_0288849 Ga0373960_0288849_35_565 176
555 3300035241 Ga0373961_0080981 Ga0373961_0080981_195_728 176
556 3300035242 Ga0373962_0026994 Ga0373962_0026994_869_1399 176
557 3300035242 Ga0373962_0067231 Ga0373962_0067231_462_995 176
558 3300035691 Ga0373931_0014158 Ga0373931_0014158_1828_2361 176
559 3300035691 Ga0373931_0147562 Ga0373931_0147562_674_1204 176
560 3300036401 Ga0373937_0304942 Ga0373937_0304942_609_1142 176
561 3300036647 Ga0316582_0473648 Ga0316582_0473648_161_694 176
562 3300036712 Ga0316584_0088745 Ga0316584_0088745_1392_1970 176
563 3300037588 Ga0316581_0005411 Ga0316581_0005411_49_582 176
564 3300046519 Ga0495632_0100628 Ga0495632_0100628_592_1125 176
565 3300048903 Ga0496100_0005125 Ga0496100_0005125_2975_3511 176
566 3300048903 Ga0496100_0276401 Ga0496100_0276401_341_871 176
567 3300048904 Ga0496101_0001893 Ga0496101_0001893_2010_2546 176
568 3300048904 Ga0496101_0104180 Ga0496101_0104180_1558_2088 176
569 3300048904 Ga0496101_0202464 Ga0496101_0202464_831_1364 176
570 3300048905 Ga0496102_0015717 Ga0496102_0015717_5103_5633 176
571 3300048905 Ga0496102_1449739 Ga0496102_1449739_21_554 176
572 3300048906 Ga0496103_0049012 Ga0496103_0049012_470_1000 176
573 3300048906 Ga0496103_0320145 Ga0496103_0320145_356_892 176
574 3300048907 Ga0496104_0059705 Ga0496104_0059705_280_816 176
575 3300048907 Ga0496104_0411474 Ga0496104_0411474_316_846 176
576 3300048908 Ga0496105_0058866 Ga0496105_0058866_2110_2640 176
577 3300048909 Ga0496106_0009062 Ga0496106_0009062_1703_2239 176
578 3300048909 Ga0496106_0017862 Ga0496106_0017862_1090_1620 176
579 3300048910 Ga0496107_0008324 Ga0496107_0008324_1558_2088 176
580 3300048910 Ga0496107_0026595 Ga0496107_0026595_1185_1721 176
581 3300048910 Ga0496107_0640021 Ga0496107_0640021_56_589 176
582 3300048911 Ga0496108_0016792 Ga0496108_0016792_5348_5884 176
583 3300048911 Ga0496108_0033905 Ga0496108_0033905_3671_4201 176
584 3300048912 Ga0496109_0061915 Ga0496109_0061915_2847_3380 176
585 3300048912 Ga0496109_0068799 Ga0496109_0068799_1541_2077 176
586 3300048912 Ga0496109_0078049 Ga0496109_0078049_722_1261 176
587 3300048912 Ga0496109_0215061 Ga0496109_0215061_188_718 176
588 3300048913 Ga0496110_0048322 Ga0496110_0048322_1090_1620 176
589 3300048914 Ga0496111_0031303 Ga0496111_0031303_3040_3573 176
590 3300048914 Ga0496111_0284031 Ga0496111_0284031_531_1061 176
591 3300048915 Ga0496112_0237663 Ga0496112_0237663_406_945 176
592 3300048915 Ga0496112_0350550 Ga0496112_0350550_419_949 176
593 3300048915 Ga0496112_0402900 Ga0496112_0402900_296_829 176
594 3300048916 Ga0496113_0003818 Ga0496113_0003818_6605_7135 176
595 3300048916 Ga0496113_0056366 Ga0496113_0056366_1215_1754 176
596 3300048917 Ga0496114_0001346 Ga0496114_0001346_7310_7840 176
597 3300048917 Ga0496114_0009187 Ga0496114_0009187_3379_3915 176
598 3300048918 Ga0496115_0005692 Ga0496115_0005692_2710_3246 176
599 3300048918 Ga0496115_0016931 Ga0496115_0016931_4515_5045 176
600 3300049568 Ga0501031_0207411 Ga0501031_0207411_523_1056 176
601 3300049569 Ga0501032_0251252 Ga0501032_0251252_205_738 176
602 3300049572 Ga0501036_0048606 Ga0501036_0048606_1451_1984 176
603 3300049572 Ga0501036_0244803 Ga0501036_0244803_550_1089 176
604 3300049573 Ga0501037_0119993 Ga0501037_0119993_128_661 176
605 3300049574 Ga0501038_0370607 Ga0501038_0370607_149_688 176
606 3300049574 Ga0501038_0564483 Ga0501038_0564483_210_743 176
607 3300049575 Ga0501039_0040919 Ga0501039_0040919_2288_2827 176
608 3300049575 Ga0501039_1173632 Ga0501039_1173632_10_543 176
609 3300049576 Ga0501040_0024388 Ga0501040_0024388_420_953 176
610 3300049576 Ga0501040_0086191 Ga0501040_0086191_823_1362 176
611 3300049576 Ga0501040_0219856 Ga0501040_0219856_487_1020 176
612 3300049577 Ga0501041_0043223 Ga0501041_0043223_74_607 176
613 3300049577 Ga0501041_0080038 Ga0501041_0080038_924_1457 176
614 3300049577 Ga0501041_0217621 Ga0501041_0217621_112_645 176
615 3300049578 Ga0501042_0157480 Ga0501042_0157480_743_1276 176
616 3300049582 Ga0501048_0386469 Ga0501048_0386469_421_954 176
617 3300049582 Ga0501048_0726809 Ga0501048_0726809_77_661 176
618 3300049584 Ga0501068_0132331 Ga0501068_0132331_297_830 176
619 3300049584 Ga0501068_0203870 Ga0501068_0203870_250_780 176
620 3300049584 Ga0501068_0345448 Ga0501068_0345448_315_854 176
621 3300049585 Ga0501069_0155722 Ga0501069_0155722_96_629 176
622 3300049586 Ga0501070_0384210 Ga0501070_0384210_406_939 176
623 3300049586 Ga0501070_0731826 Ga0501070_0731826_45_656 176
624 3300049587 Ga0501071_0013681 Ga0501071_0013681_984_1517 176
625 3300049587 Ga0501071_0135334 Ga0501071_0135334_367_906 176
626 3300049588 Ga0501072_0135146 Ga0501072_0135146_658_1191 176
627 3300049588 Ga0501072_0202070 Ga0501072_0202070_847_1380 176
628 3300049589 Ga0501073_0096334 Ga0501073_0096334_1105_1644 176
629 3300049589 Ga0501073_0170054 Ga0501073_0170054_804_1337 176
630 3300049590 Ga0501074_0074625 Ga0501074_0074625_1220_1753 176
631 3300049590 Ga0501074_0144260 Ga0501074_0144260_695_1234 176
632 3300049590 Ga0501074_0414554 Ga0501074_0414554_70_603 176
633 3300049591 Ga0501075_0049908 Ga0501075_0049908_251_784 176
634 3300049591 Ga0501075_0155406 Ga0501075_0155406_571_1104 176
635 3300049591 Ga0501075_0185357 Ga0501075_0185357_374_907 176
636 3300049591 Ga0501075_0489062 Ga0501075_0489062_351_881 176
637 3300049591 Ga0501075_0628530 Ga0501075_0628530_22_558 176
638 3300049592 Ga0501076_0054516 Ga0501076_0054516_121_654 176
639 3300049592 Ga0501076_0082714 Ga0501076_0082714_129_662 176
640 3300049592 Ga0501076_0128252 Ga0501076_0128252_644_1183 176
641 3300049593 Ga0501077_0196766 Ga0501077_0196766_546_1079 176
642 3300049593 Ga0501077_0689104 Ga0501077_0689104_70_603 176
643 3300049741 Ga0501079_0023514 Ga0501079_0023514_1785_2318 176
644 3300049741 Ga0501079_0051324 Ga0501079_0051324_1623_2156 176
645 3300049741 Ga0501079_0189395 Ga0501079_0189395_322_855 176
646 3300049741 Ga0501079_0219683 Ga0501079_0219683_777_1313 176
647 3300049741 Ga0501079_0483561 Ga0501079_0483561_380_916 176
648 3300049743 Ga0501081_0049240 Ga0501081_0049240_273_806 176
649 3300049743 Ga0501081_0142454 Ga0501081_0142454_1076_1609 176
650 3300049743 Ga0501081_0430447 Ga0501081_0430447_123_656 176
651 3300049744 Ga0501083_0122823 Ga0501083_0122823_606_1139 176
652 3300049822 Ga0501035_0049109 Ga0501035_0049109_1398_1931 176
653 3300049824 Ga0501045_0068718 Ga0501045_0068718_1292_1831 176
654 3300049824 Ga0501045_0108826 Ga0501045_0108826_985_1518 176
655 3300050507 nmdc:mga05p37_68872_c1 nmdc:mga05p37_68872_c1_1894_2427 176
656 3300050511 nmdc:mga08y16_606268_c1 nmdc:mga08y16_606268_c1_362_895 176
657 3300054114 Ga0501084_0016279 Ga0501084_0016279_4480_5013 176
658 3300054114 Ga0501084_0028319 Ga0501084_0028319_354_887 176
659 3300054114 Ga0501084_0105129 Ga0501084_0105129_1349_1888 176
660 3300054114 Ga0501084_0237332 Ga0501084_0237332_238_771 176
661 3300060353 Ga0501082_0103385 Ga0501082_0103385_483_1016 176
662 3300060353 Ga0501082_0182484 Ga0501082_0182484_930_1463 176
663 3300061734 Ga0530510_0011636 Ga0530510_0011636_4844_5377 176
664 3300061734 Ga0530510_0119994 Ga0530510_0119994_406_939 176
665 3300061734 Ga0530510_0139243 Ga0530510_0139243_486_1025 176
666 3300061734 Ga0530510_0406922 Ga0530510_0406922_243_776 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

7

139

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9478 9 147
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9272 9 146
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9271 9 147
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.8992 9 147
1z2d-assembly1.cif.gz_A solution structure of bacillus subtilis arsc in reduced state 0.8953 8 145
ID Description Score Start End Superfamily
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8911 8 145 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8796 10 145 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8609 8 145 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8585 11 147 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8456 11 147 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A434U3P1-F1-model_v4 Arsenate reductase ArsC 0.9905 8 166 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A1F4ARG2-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9883 8 170 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A6G6WN77-F1-model_v4 Arsenate reductase ArsC 0.9881 5 167 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A1Q3JQI2-F1-model_v4 ArsR family transcriptional regulator 0.988 8 148 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A1X6ZFU8-F1-model_v4 Protein ArsC (EC 3.1.3.48) 0.9878 8 168 GO:0004726
GO:0030946
GO:0046685
GO:0140793

Feature Viewer

pLDDT pTM Quality
88.47 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map