F473757
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 666 | 343 | 664 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300003316|rootH1_10098898|rootH1_100988982 |
| Length | 181 |
| Sequence | VSDSFNILFLCTANSARSILAEAILSRLGGDRFRAFSAGSFPRGQVNPVAIELLHSLGYETSAFRSKSWDVFAAEGAPRIDLVVTVCDNAAGEICPIWPGHPLKAHWGIEDPASADGMGKRDAFLKAYRYLSAKIGRLVALPVETMDSAALRAELVAIGRSEGATELAGASEPFAAARGPE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 2 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 125 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 126 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 127 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 205 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 211 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 212 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 215 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 216 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 222 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 230 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 241 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 246 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 247 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 248 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 249 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 250 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 251 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 321 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 322 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 340 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 342 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.35 |
| Metatranscriptomes | 1.35 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 7.06 |
| Rhizosphere | 90.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10015591 | 3300001990 | Bacteria | 2460 |
| 2 | JGI24743J22301_10030376 | 3300001991 | Bacteria | 1062 |
| 3 | JGI24750J21931_1001123 | 3300002070 | Bacteria | 3447 |
| 4 | JGI24745J21846_1017478 | 3300002073 | Bacteria | 835 |
| 5 | JGI24034J26672_10020594 | 3300002239 | Bacteria | 1034 |
| 6 | rootH1_10098898 | 3300003316 | Bacteria | 1968 |
| 7 | rootL2_10344107 | 3300003322 | Bacteria | 1082 |
| 8 | Ga0065712_10429642 | 3300005290 | Bacteria | 704 |
| 9 | Ga0065707_10365715 | 3300005295 | Bacteria | 897 |
| 10 | Ga0070676_10001040 | 3300005328 | Bacteria | 13814 |
| 11 | Ga0070683_100079541 | 3300005329 | Bacteria | 3068 |
| 12 | Ga0070690_100060456 | 3300005330 | Bacteria | 2438 |
| 13 | Ga0070670_100003994 | 3300005331 | Bacteria | 12312 |
| 14 | Ga0070670_100006332 | 3300005331 | Bacteria | 10018 |
| 15 | Ga0068869_100877632 | 3300005334 | Bacteria | 775 |
| 16 | Ga0070666_10000184 | 3300005335 | Bacteria | 42807 |
| 17 | Ga0070666_10372063 | 3300005335 | Bacteria | 1025 |
| 18 | Ga0070682_100014187 | 3300005337 | Bacteria | 4602 |
| 19 | Ga0068868_100011581 | 3300005338 | Bacteria | 6424 |
| 20 | Ga0068868_100016942 | 3300005338 | Bacteria | 5422 |
| 21 | Ga0070660_100015280 | 3300005339 | Bacteria | 5539 |
| 22 | Ga0070689_100000219 | 3300005340 | Bacteria | 34066 |
| 23 | Ga0070689_100022362 | 3300005340 | Bacteria | 4721 |
| 24 | Ga0070691_10000775 | 3300005341 | Bacteria | 12670 |
| 25 | Ga0070661_100000383 | 3300005344 | Bacteria | 34710 |
| 26 | Ga0070661_100815913 | 3300005344 | Bacteria | 766 |
| 27 | Ga0070692_10000953 | 3300005345 | Bacteria | 9837 |
| 28 | Ga0070668_100002203 | 3300005347 | Bacteria | 14300 |
| 29 | Ga0070668_100065828 | 3300005347 | Bacteria | 2811 |
| 30 | Ga0070668_100774343 | 3300005347 | Bacteria | 851 |
| 31 | Ga0070669_100000008 | 3300005353 | Bacteria | 226764 |
| 32 | Ga0070669_100003604 | 3300005353 | Bacteria | 11179 |
| 33 | Ga0070669_100117138 | 3300005353 | Bacteria | 2028 |
| 34 | Ga0070669_100458512 | 3300005353 | Bacteria | 1052 |
| 35 | Ga0070675_100005782 | 3300005354 | Bacteria | 9462 |
| 36 | Ga0070671_100000015 | 3300005355 | Bacteria | 166132 |
| 37 | Ga0070671_100001149 | 3300005355 | Bacteria | 19672 |
| 38 | Ga0070674_100017247 | 3300005356 | Bacteria | 4538 |
| 39 | Ga0070673_100233477 | 3300005364 | Bacteria | 1596 |
| 40 | Ga0070688_100001435 | 3300005365 | Bacteria | 11859 |
| 41 | Ga0070688_100416387 | 3300005365 | Bacteria | 998 |
| 42 | Ga0070659_100377510 | 3300005366 | Bacteria | 1193 |
| 43 | Ga0070659_100549679 | 3300005366 | Bacteria | 988 |
| 44 | Ga0070659_100757801 | 3300005366 | Bacteria | 842 |
| 45 | Ga0070659_100807902 | 3300005366 | Bacteria | 816 |
| 46 | Ga0070667_100006317 | 3300005367 | Bacteria | 9847 |
| 47 | Ga0070667_100125738 | 3300005367 | Bacteria | 2234 |
| 48 | Ga0070703_10013427 | 3300005406 | Bacteria | 2326 |
| 49 | Ga0070709_10017423 | 3300005434 | Bacteria | 4120 |
| 50 | Ga0070709_10114986 | 3300005434 | Bacteria | 1814 |
| 51 | Ga0070709_10120264 | 3300005434 | Bacteria | 1779 |
| 52 | Ga0070714_100003382 | 3300005435 | Bacteria | 11889 |
| 53 | Ga0070714_100112156 | 3300005435 | Bacteria | 2416 |
| 54 | Ga0070713_100030941 | 3300005436 | Bacteria | 4256 |
| 55 | Ga0070713_100066254 | 3300005436 | Bacteria | 3037 |
| 56 | Ga0070713_100259934 | 3300005436 | Bacteria | 1586 |
| 57 | Ga0070710_10006473 | 3300005437 | Bacteria | 5628 |
| 58 | Ga0070701_10001291 | 3300005438 | Bacteria | 9205 |
| 59 | Ga0070711_100000201 | 3300005439 | Bacteria | 31559 |
| 60 | Ga0070711_100263488 | 3300005439 | Bacteria | 1357 |
| 61 | Ga0070705_100001686 | 3300005440 | Bacteria | 11568 |
| 62 | Ga0070700_100047121 | 3300005441 | Bacteria | 2666 |
| 63 | Ga0070694_100015238 | 3300005444 | Bacteria | 4823 |
| 64 | Ga0070708_100064225 | 3300005445 | Bacteria | 3289 |
| 65 | Ga0070663_100000190 | 3300005455 | Bacteria | 30948 |
| 66 | Ga0070663_100397458 | 3300005455 | Bacteria | 1126 |
| 67 | Ga0070678_100002392 | 3300005456 | Bacteria | 10265 |
| 68 | Ga0070662_100553074 | 3300005457 | Bacteria | 964 |
| 69 | Ga0070681_10001396 | 3300005458 | Bacteria | 21186 |
| 70 | Ga0070681_10086875 | 3300005458 | Bacteria | 3081 |
| 71 | Ga0070681_10603144 | 3300005458 | Unclassified | 1012 |
| 72 | Ga0068867_100043246 | 3300005459 | Bacteria | 3298 |
| 73 | Ga0070685_10004770 | 3300005466 | Bacteria | 6864 |
| 74 | Ga0070685_10011013 | 3300005466 | Bacteria | 4719 |
| 75 | Ga0070706_100136654 | 3300005467 | Bacteria | 2288 |
| 76 | Ga0070699_100042983 | 3300005518 | Bacteria | 3912 |
| 77 | Ga0070679_100100744 | 3300005530 | Bacteria | 2875 |
| 78 | Ga0070679_100985603 | 3300005530 | Unclassified | 787 |
| 79 | Ga0070684_100031953 | 3300005535 | Bacteria | 4483 |
| 80 | Ga0070697_100003155 | 3300005536 | Bacteria | 12663 |
| 81 | Ga0068853_100000460 | 3300005539 | Bacteria | 27825 |
| 82 | Ga0068853_100054633 | 3300005539 | Bacteria | 3442 |
| 83 | Ga0068853_100098948 | 3300005539 | Bacteria | 2576 |
| 84 | Ga0070672_100000564 | 3300005543 | Bacteria | 21723 |
| 85 | Ga0070672_100279077 | 3300005543 | Bacteria | 1412 |
| 86 | Ga0070686_100000306 | 3300005544 | Bacteria | 32359 |
| 87 | Ga0070686_100067493 | 3300005544 | Bacteria | 2330 |
| 88 | Ga0070695_100002867 | 3300005545 | Bacteria | 10032 |
| 89 | Ga0070695_100269421 | 3300005545 | Bacteria | 1247 |
| 90 | Ga0070696_100010206 | 3300005546 | Bacteria | 6285 |
| 91 | Ga0070696_101016533 | 3300005546 | Unclassified | 693 |
| 92 | Ga0070693_100002707 | 3300005547 | Bacteria | 8147 |
| 93 | Ga0070665_100060733 | 3300005548 | Bacteria | 3789 |
| 94 | Ga0070665_100097361 | 3300005548 | Bacteria | 2947 |
| 95 | Ga0070665_100203815 | 3300005548 | Bacteria | 1978 |
| 96 | Ga0070704_100001638 | 3300005549 | Bacteria | 12135 |
| 97 | Ga0068855_100004155 | 3300005563 | Bacteria | 17666 |
| 98 | Ga0068855_100194090 | 3300005563 | Bacteria | 2288 |
| 99 | Ga0068855_100694659 | 3300005563 | Bacteria | 1089 |
| 100 | Ga0070664_100063935 | 3300005564 | Bacteria | 3138 |
| 101 | Ga0068857_100000318 | 3300005577 | Bacteria | 33240 |
| 102 | Ga0068857_100392284 | 3300005577 | Bacteria | 1291 |
| 103 | Ga0068854_100014348 | 3300005578 | Bacteria | 5221 |
| 104 | Ga0068854_100034996 | 3300005578 | Bacteria | 3513 |
| 105 | Ga0068854_100235688 | 3300005578 | Bacteria | 1455 |
| 106 | Ga0068856_100030353 | 3300005614 | Bacteria | 5284 |
| 107 | Ga0068856_100227853 | 3300005614 | Bacteria | 1879 |
| 108 | Ga0068856_100955104 | 3300005614 | Bacteria | 876 |
| 109 | Ga0070702_100004629 | 3300005615 | Bacteria | 6307 |
| 110 | Ga0070702_100667327 | 3300005615 | Bacteria | 788 |
| 111 | Ga0068852_100107155 | 3300005616 | Bacteria | 2534 |
| 112 | Ga0068859_100002375 | 3300005617 | Bacteria | 19171 |
| 113 | Ga0068859_100004533 | 3300005617 | Bacteria | 14167 |
| 114 | Ga0068859_100273747 | 3300005617 | Bacteria | 1781 |
| 115 | Ga0068859_100538034 | 3300005617 | Bacteria | 1263 |
| 116 | Ga0068864_100003703 | 3300005618 | Bacteria | 12622 |
| 117 | Ga0068864_100211910 | 3300005618 | Bacteria | 1784 |
| 118 | Ga0068866_10000636 | 3300005718 | Bacteria | 15906 |
| 119 | Ga0068866_10052166 | 3300005718 | Bacteria | 2086 |
| 120 | Ga0068861_100000277 | 3300005719 | Bacteria | 28797 |
| 121 | Ga0068861_100001851 | 3300005719 | Bacteria | 13614 |
| 122 | Ga0068861_100085472 | 3300005719 | Bacteria | 2478 |
| 123 | Ga0068861_100112150 | 3300005719 | Bacteria | 2186 |
| 124 | Ga0068861_100355457 | 3300005719 | Bacteria | 1287 |
| 125 | Ga0068861_100611348 | 3300005719 | Bacteria | 1002 |
| 126 | Ga0068851_10034206 | 3300005834 | Bacteria | 2536 |
| 127 | Ga0068863_100000968 | 3300005841 | Bacteria | 28879 |
| 128 | Ga0068863_100003742 | 3300005841 | Bacteria | 15049 |
| 129 | Ga0068863_100374286 | 3300005841 | Bacteria | 1390 |
| 130 | Ga0068863_100394536 | 3300005841 | Bacteria | 1353 |
| 131 | Ga0068858_100006243 | 3300005842 | Bacteria | 11612 |
| 132 | Ga0068858_100019432 | 3300005842 | Bacteria | 6354 |
| 133 | Ga0068858_100038583 | 3300005842 | Bacteria | 4431 |
| 134 | Ga0068858_100045051 | 3300005842 | Bacteria | 4088 |
| 135 | Ga0068858_100086579 | 3300005842 | Bacteria | 2914 |
| 136 | Ga0068858_100099514 | 3300005842 | Bacteria | 2711 |
| 137 | Ga0068860_100001081 | 3300005843 | Bacteria | 30047 |
| 138 | Ga0068860_100017469 | 3300005843 | Bacteria | 6990 |
| 139 | Ga0068860_100027086 | 3300005843 | Bacteria | 5522 |
| 140 | Ga0068862_100006641 | 3300005844 | Bacteria | 9596 |
| 141 | Ga0068862_100022138 | 3300005844 | Bacteria | 5319 |
| 142 | Ga0068862_100029227 | 3300005844 | Bacteria | 4644 |
| 143 | Ga0068862_100723671 | 3300005844 | Bacteria | 966 |
| 144 | Ga0081455_10002652 | 3300005937 | Bacteria | 21173 |
| 145 | Ga0081455_10022381 | 3300005937 | Bacteria | 5908 |
| 146 | Ga0081540_1006477 | 3300005983 | Bacteria | 8519 |
| 147 | Ga0070717_10508525 | 3300006028 | Bacteria | 1089 |
| 148 | Ga0070715_10001080 | 3300006163 | Bacteria | 7721 |
| 149 | Ga0070716_100007391 | 3300006173 | Bacteria | 5405 |
| 150 | Ga0070712_100000840 | 3300006175 | Bacteria | 18252 |
| 151 | Ga0070712_100154216 | 3300006175 | Bacteria | 1767 |
| 152 | Ga0097621_100032862 | 3300006237 | Bacteria | 4127 |
| 153 | Ga0097621_100160698 | 3300006237 | Bacteria | 1931 |
| 154 | Ga0097621_101038306 | 3300006237 | Bacteria | 768 |
| 155 | Ga0075428_100647968 | 3300006844 | Bacteria | 1127 |
| 156 | Ga0075430_100169822 | 3300006846 | Bacteria | 1814 |
| 157 | Ga0075433_11305720 | 3300006852 | Bacteria | 629 |
| 158 | Ga0068865_100018469 | 3300006881 | Bacteria | 4500 |
| 159 | Ga0068865_100097171 | 3300006881 | Bacteria | 2149 |
| 160 | Ga0097620_100002375 | 3300006931 | Bacteria | 19171 |
| 161 | Ga0097620_100004533 | 3300006931 | Bacteria | 14167 |
| 162 | Ga0097620_100273785 | 3300006931 | Bacteria | 1781 |
| 163 | Ga0097620_100538056 | 3300006931 | Bacteria | 1263 |
| 164 | Ga0075435_100097938 | 3300007076 | Bacteria | 2428 |
| 165 | Ga0105250_10004823 | 3300009092 | Bacteria | 6140 |
| 166 | Ga0105240_10072847 | 3300009093 | Bacteria | 4244 |
| 167 | Ga0105245_10004696 | 3300009098 | Bacteria | 12076 |
| 168 | Ga0105247_10000361 | 3300009101 | Bacteria | 38770 |
| 169 | Ga0105247_10001891 | 3300009101 | Bacteria | 14614 |
| 170 | Ga0105247_10066081 | 3300009101 | Bacteria | 2251 |
| 171 | Ga0114129_10193369 | 3300009147 | Bacteria | 2761 |
| 172 | Ga0114129_10270067 | 3300009147 | Bacteria | 2276 |
| 173 | Ga0114129_10489451 | 3300009147 | Bacteria | 1608 |
| 174 | Ga0114129_10533555 | 3300009147 | Bacteria | 1528 |
| 175 | Ga0114129_12478275 | 3300009147 | Bacteria | 620 |
| 176 | Ga0105243_10001606 | 3300009148 | Bacteria | 19702 |
| 177 | Ga0105243_10055222 | 3300009148 | Bacteria | 3155 |
| 178 | Ga0105243_10241823 | 3300009148 | Bacteria | 1607 |
| 179 | Ga0105243_10262925 | 3300009148 | Bacteria | 1546 |
| 180 | Ga0105243_10586939 | 3300009148 | Bacteria | 1070 |
| 181 | Ga0105241_10001291 | 3300009174 | Bacteria | 19082 |
| 182 | Ga0105242_10020157 | 3300009176 | Bacteria | 5227 |
| 183 | Ga0105248_10000586 | 3300009177 | Bacteria | 41465 |
| 184 | Ga0105248_10054850 | 3300009177 | Bacteria | 4471 |
| 185 | Ga0105248_10072270 | 3300009177 | Bacteria | 3877 |
| 186 | Ga0105248_10146582 | 3300009177 | Bacteria | 2664 |
| 187 | Ga0105237_10003139 | 3300009545 | Bacteria | 19874 |
| 188 | Ga0105237_10286040 | 3300009545 | Bacteria | 1651 |
| 189 | Ga0105238_10013074 | 3300009551 | Bacteria | 8374 |
| 190 | Ga0105238_10118083 | 3300009551 | Bacteria | 2633 |
| 191 | Ga0105249_10003539 | 3300009553 | Bacteria | 13507 |
| 192 | Ga0105249_10181812 | 3300009553 | Bacteria | 2046 |
| 193 | Ga0105249_10222956 | 3300009553 | Bacteria | 1856 |
| 194 | Ga0105249_10548810 | 3300009553 | Bacteria | 1206 |
| 195 | Ga0105249_11278729 | 3300009553 | Bacteria | 805 |
| 196 | Ga0099796_10102754 | 3300010159 | Bacteria | 1077 |
| 197 | Ga0105239_10003994 | 3300010375 | Bacteria | 17864 |
| 198 | Ga0105239_10107980 | 3300010375 | Bacteria | 3083 |
| 199 | Ga0105246_10000208 | 3300011119 | Bacteria | 29695 |
| 200 | Ga0105246_10152973 | 3300011119 | Bacteria | 1748 |
| 201 | Ga0157371_10007923 | 3300013102 | Bacteria | 8524 |
| 202 | Ga0157369_10021041 | 3300013105 | Bacteria | 7292 |
| 203 | Ga0157374_10003797 | 3300013296 | Bacteria | 12710 |
| 204 | Ga0157374_10034884 | 3300013296 | Bacteria | 4600 |
| 205 | Ga0157378_10000452 | 3300013297 | Bacteria | 39237 |
| 206 | Ga0157378_10048564 | 3300013297 | Bacteria | 3774 |
| 207 | Ga0157378_10062694 | 3300013297 | Bacteria | 3320 |
| 208 | Ga0163162_10002876 | 3300013306 | Bacteria | 16391 |
| 209 | Ga0163162_10003369 | 3300013306 | Bacteria | 15291 |
| 210 | Ga0163162_10007327 | 3300013306 | Bacteria | 10725 |
| 211 | Ga0157372_10000529 | 3300013307 | Bacteria | 42341 |
| 212 | Ga0157372_10391804 | 3300013307 | Bacteria | 1619 |
| 213 | Ga0157375_10001554 | 3300013308 | Bacteria | 19762 |
| 214 | Ga0157375_10002784 | 3300013308 | Bacteria | 15121 |
| 215 | Ga0157375_10020734 | 3300013308 | Bacteria | 6013 |
| 216 | Ga0163163_10009295 | 3300014325 | Bacteria | 8769 |
| 217 | Ga0163163_10013796 | 3300014325 | Bacteria | 7409 |
| 218 | Ga0163163_12097697 | 3300014325 | Bacteria | 625 |
| 219 | Ga0157380_10019453 | 3300014326 | Bacteria | 5060 |
| 220 | Ga0157380_10178296 | 3300014326 | Bacteria | 1864 |
| 221 | Ga0157380_10323625 | 3300014326 | Bacteria | 1431 |
| 222 | Ga0157380_10770853 | 3300014326 | Bacteria | 976 |
| 223 | Ga0157380_10805219 | 3300014326 | Bacteria | 957 |
| 224 | Ga0157377_10037195 | 3300014745 | Bacteria | 2681 |
| 225 | Ga0157377_10159268 | 3300014745 | Bacteria | 1402 |
| 226 | Ga0157379_10011989 | 3300014968 | Bacteria | 7572 |
| 227 | Ga0157379_10020462 | 3300014968 | Bacteria | 5851 |
| 228 | Ga0157379_10048156 | 3300014968 | Bacteria | 3805 |
| 229 | Ga0157379_10365860 | 3300014968 | Bacteria | 1322 |
| 230 | Ga0157376_10517878 | 3300014969 | Bacteria | 1175 |
| 231 | Ga0157376_10668246 | 3300014969 | Bacteria | 1041 |
| 232 | Ga0163161_10000549 | 3300017792 | Bacteria | 30479 |
| 233 | Ga0163161_10098109 | 3300017792 | Bacteria | 2177 |
| 234 | Ga0163161_10168203 | 3300017792 | Bacteria | 1675 |
| 235 | Ga0184599_122713 | 3300019188 | Bacteria | 854 |
| 236 | Ga0213874_10012055 | 3300021377 | Bacteria | 2208 |
| 237 | Ga0213876_10000170 | 3300021384 | Bacteria | 68004 |
| 238 | Ga0224570_100713 | 3300022730 | Bacteria | 2648 |
| 239 | Ga0224571_108185 | 3300022734 | Bacteria | 709 |
| 240 | Ga0224572_1001411 | 3300024225 | Bacteria | 3543 |
| 241 | Ga0224572_1014422 | 3300024225 | Bacteria | 1510 |
| 242 | Ga0228598_1000036 | 3300024227 | Bacteria | 18755 |
| 243 | Ga0207697_10000274 | 3300025315 | Bacteria | 28418 |
| 244 | Ga0207697_10153956 | 3300025315 | Bacteria | 1001 |
| 245 | Ga0207656_10071398 | 3300025321 | Bacteria | 1543 |
| 246 | Ga0207653_10044388 | 3300025885 | Bacteria | 1465 |
| 247 | Ga0207692_10007121 | 3300025898 | Bacteria | 4571 |
| 248 | Ga0207642_10012479 | 3300025899 | Bacteria | 3068 |
| 249 | Ga0207710_10023544 | 3300025900 | Bacteria | 2647 |
| 250 | Ga0207710_10299210 | 3300025900 | Bacteria | 813 |
| 251 | Ga0207688_10017490 | 3300025901 | Bacteria | 3896 |
| 252 | Ga0207688_10270112 | 3300025901 | Bacteria | 1034 |
| 253 | Ga0207647_10002142 | 3300025904 | Bacteria | 15083 |
| 254 | Ga0207685_10013786 | 3300025905 | Bacteria | 2511 |
| 255 | Ga0207699_10008743 | 3300025906 | Bacteria | 5011 |
| 256 | Ga0207699_10014321 | 3300025906 | Bacteria | 4085 |
| 257 | Ga0207699_10184570 | 3300025906 | Bacteria | 1404 |
| 258 | Ga0207699_10265829 | 3300025906 | Bacteria | 1187 |
| 259 | Ga0207645_10009805 | 3300025907 | Bacteria | 6605 |
| 260 | Ga0207643_10236117 | 3300025908 | Bacteria | 1123 |
| 261 | Ga0207684_10070391 | 3300025910 | Bacteria | 2973 |
| 262 | Ga0207654_10031516 | 3300025911 | Bacteria | 2921 |
| 263 | Ga0207707_10026912 | 3300025912 | Bacteria | 5026 |
| 264 | Ga0207707_10331884 | 3300025912 | Bacteria | 1312 |
| 265 | Ga0207695_10372007 | 3300025913 | Bacteria | 1315 |
| 266 | Ga0207671_10289178 | 3300025914 | Bacteria | 1294 |
| 267 | Ga0207671_10418887 | 3300025914 | Bacteria | 1065 |
| 268 | Ga0207693_10000247 | 3300025915 | Bacteria | 50003 |
| 269 | Ga0207693_10303506 | 3300025915 | Bacteria | 1250 |
| 270 | Ga0207693_10565027 | 3300025915 | Bacteria | 887 |
| 271 | Ga0207663_10002489 | 3300025916 | Bacteria | 8872 |
| 272 | Ga0207663_10156668 | 3300025916 | Bacteria | 1603 |
| 273 | Ga0207663_10325658 | 3300025916 | Bacteria | 1156 |
| 274 | Ga0207660_10042023 | 3300025917 | Bacteria | 3207 |
| 275 | Ga0207657_10000257 | 3300025919 | Bacteria | 56368 |
| 276 | Ga0207657_10478530 | 3300025919 | Bacteria | 976 |
| 277 | Ga0207649_10010986 | 3300025920 | Bacteria | 4980 |
| 278 | Ga0207652_10019036 | 3300025921 | Bacteria | 5638 |
| 279 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 280 | Ga0207681_10021983 | 3300025923 | Bacteria | 4062 |
| 281 | Ga0207650_10009399 | 3300025925 | Bacteria | 6683 |
| 282 | Ga0207650_10173050 | 3300025925 | Bacteria | 1717 |
| 283 | Ga0207650_10807430 | 3300025925 | Bacteria | 795 |
| 284 | Ga0207687_10166359 | 3300025927 | Bacteria | 1697 |
| 285 | Ga0207700_10053074 | 3300025928 | Bacteria | 3035 |
| 286 | Ga0207700_10282369 | 3300025928 | Bacteria | 1428 |
| 287 | Ga0207700_10746004 | 3300025928 | Bacteria | 875 |
| 288 | Ga0207700_10958806 | 3300025928 | Bacteria | 766 |
| 289 | Ga0207664_10086794 | 3300025929 | Bacteria | 2557 |
| 290 | Ga0207664_10100539 | 3300025929 | Bacteria | 2388 |
| 291 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 292 | Ga0207644_10006496 | 3300025931 | Bacteria | 7622 |
| 293 | Ga0207690_10001995 | 3300025932 | Bacteria | 12503 |
| 294 | Ga0207706_10000691 | 3300025933 | Bacteria | 35258 |
| 295 | Ga0207686_10812250 | 3300025934 | Bacteria | 750 |
| 296 | Ga0207709_10300832 | 3300025935 | Bacteria | 1193 |
| 297 | Ga0207670_10377552 | 3300025936 | Bacteria | 1128 |
| 298 | Ga0207670_11168598 | 3300025936 | Bacteria | 651 |
| 299 | Ga0207669_10135004 | 3300025937 | Bacteria | 1702 |
| 300 | Ga0207704_10014366 | 3300025938 | Bacteria | 3996 |
| 301 | Ga0207704_10127650 | 3300025938 | Bacteria | 1754 |
| 302 | Ga0207704_10513086 | 3300025938 | Bacteria | 968 |
| 303 | Ga0207704_11103402 | 3300025938 | Bacteria | 674 |
| 304 | Ga0207665_10001185 | 3300025939 | Bacteria | 17548 |
| 305 | Ga0207665_10031996 | 3300025939 | Bacteria | 3483 |
| 306 | Ga0207691_10000483 | 3300025940 | Bacteria | 39447 |
| 307 | Ga0207711_10032876 | 3300025941 | Bacteria | 4388 |
| 308 | Ga0207711_10039646 | 3300025941 | Bacteria | 4008 |
| 309 | Ga0207711_10042219 | 3300025941 | Bacteria | 3886 |
| 310 | Ga0207711_10691037 | 3300025941 | Bacteria | 951 |
| 311 | Ga0207711_10846935 | 3300025941 | Bacteria | 851 |
| 312 | Ga0207689_10002538 | 3300025942 | Bacteria | 16946 |
| 313 | Ga0207689_10218204 | 3300025942 | Bacteria | 1576 |
| 314 | Ga0207689_10329021 | 3300025942 | Bacteria | 1269 |
| 315 | Ga0207661_10104705 | 3300025944 | Bacteria | 2383 |
| 316 | Ga0207667_10006761 | 3300025949 | Bacteria | 13845 |
| 317 | Ga0207667_10664085 | 3300025949 | Bacteria | 1047 |
| 318 | Ga0207651_10001838 | 3300025960 | Bacteria | 9903 |
| 319 | Ga0207712_10072127 | 3300025961 | Bacteria | 2486 |
| 320 | Ga0207712_10152496 | 3300025961 | Bacteria | 1787 |
| 321 | Ga0207712_10226545 | 3300025961 | Bacteria | 1498 |
| 322 | Ga0207712_10317048 | 3300025961 | Bacteria | 1285 |
| 323 | Ga0207668_10002116 | 3300025972 | Bacteria | 11591 |
| 324 | Ga0207668_10673288 | 3300025972 | Bacteria | 907 |
| 325 | Ga0207640_10004266 | 3300025981 | Bacteria | 7739 |
| 326 | Ga0207658_10008007 | 3300025986 | Bacteria | 7197 |
| 327 | Ga0207658_10354415 | 3300025986 | Bacteria | 1278 |
| 328 | Ga0207677_10018797 | 3300026023 | Bacteria | 4156 |
| 329 | Ga0207677_10159158 | 3300026023 | Bacteria | 1752 |
| 330 | Ga0207703_10014360 | 3300026035 | Bacteria | 6177 |
| 331 | Ga0207703_10021210 | 3300026035 | Bacteria | 5084 |
| 332 | Ga0207703_10041614 | 3300026035 | Bacteria | 3682 |
| 333 | Ga0207639_10002595 | 3300026041 | Bacteria | 12127 |
| 334 | Ga0207678_10000401 | 3300026067 | Bacteria | 39431 |
| 335 | Ga0207678_10248453 | 3300026067 | Bacteria | 1523 |
| 336 | Ga0207708_10000809 | 3300026075 | Bacteria | 23494 |
| 337 | Ga0207708_10004449 | 3300026075 | Bacteria | 10332 |
| 338 | Ga0207708_10117281 | 3300026075 | Bacteria | 2072 |
| 339 | Ga0207702_10350748 | 3300026078 | Bacteria | 1412 |
| 340 | Ga0207641_10004155 | 3300026088 | Bacteria | 12616 |
| 341 | Ga0207641_10009456 | 3300026088 | Bacteria | 8032 |
| 342 | Ga0207641_10275211 | 3300026088 | Bacteria | 1581 |
| 343 | Ga0207641_10279996 | 3300026088 | Bacteria | 1568 |
| 344 | Ga0207648_10546126 | 3300026089 | Bacteria | 1064 |
| 345 | Ga0207676_10019455 | 3300026095 | Bacteria | 4954 |
| 346 | Ga0207676_10157705 | 3300026095 | Bacteria | 1962 |
| 347 | Ga0207674_10000524 | 3300026116 | Bacteria | 50350 |
| 348 | Ga0207675_100000358 | 3300026118 | Bacteria | 43765 |
| 349 | Ga0207675_100000908 | 3300026118 | Bacteria | 29576 |
| 350 | Ga0207675_100210807 | 3300026118 | Bacteria | 1868 |
| 351 | Ga0207683_10000416 | 3300026121 | Bacteria | 39377 |
| 352 | Ga0207683_10495966 | 3300026121 | Bacteria | 1128 |
| 353 | Ga0207698_10003521 | 3300026142 | Bacteria | 9440 |
| 354 | Ga0207698_11380723 | 3300026142 | Bacteria | 719 |
| 355 | Ga0209588_1038707 | 3300027671 | Bacteria | 1537 |
| 356 | Ga0209974_10135792 | 3300027876 | Bacteria | 879 |
| 357 | Ga0265356_1000106 | 3300028017 | Bacteria | 14350 |
| 358 | Ga0268266_10013221 | 3300028379 | Bacteria | 7115 |
| 359 | Ga0268266_10049671 | 3300028379 | Bacteria | 3598 |
| 360 | Ga0268266_10704654 | 3300028379 | Bacteria | 973 |
| 361 | Ga0268265_10000285 | 3300028380 | Bacteria | 57084 |
| 362 | Ga0268265_10011728 | 3300028380 | Bacteria | 5928 |
| 363 | Ga0268265_10114864 | 3300028380 | Bacteria | 2205 |
| 364 | Ga0268265_10427913 | 3300028380 | Bacteria | 1231 |
| 365 | Ga0268265_11071370 | 3300028380 | Bacteria | 799 |
| 366 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 367 | Ga0268264_10120950 | 3300028381 | Bacteria | 2307 |
| 368 | Ga0268264_10316219 | 3300028381 | Bacteria | 1475 |
| 369 | Ga0265338_10409311 | 3300028800 | Bacteria | 966 |
| 370 | Ga0265338_10449290 | 3300028800 | Unclassified | 913 |
| 371 | Ga0265762_1000561 | 3300030760 | Bacteria | 6516 |
| 372 | Ga0265760_10000138 | 3300031090 | Bacteria | 18344 |
| 373 | Ga0265760_10073663 | 3300031090 | Bacteria | 1050 |
| 374 | Ga0265330_10103468 | 3300031235 | Bacteria | 1218 |
| 375 | Ga0265325_10033553 | 3300031241 | Bacteria | 2736 |
| 376 | Ga0265329_10166070 | 3300031242 | Bacteria | 719 |
| 377 | Ga0265340_10036071 | 3300031247 | Bacteria | 2453 |
| 378 | Ga0265340_10041819 | 3300031247 | Bacteria | 2252 |
| 379 | Ga0265340_10124740 | 3300031247 | Bacteria | 1183 |
| 380 | Ga0265340_10125731 | 3300031247 | Bacteria | 1178 |
| 381 | Ga0265340_10284351 | 3300031247 | Bacteria | 734 |
| 382 | Ga0265327_10001788 | 3300031251 | Bacteria | 25267 |
| 383 | Ga0265316_10020689 | 3300031344 | Bacteria | 5594 |
| 384 | Ga0265316_10199146 | 3300031344 | Bacteria | 1485 |
| 385 | Ga0307408_100315091 | 3300031548 | Bacteria | 1316 |
| 386 | Ga0316579_10007419 | 3300031691 | Bacteria | 4528 |
| 387 | Ga0265314_10257373 | 3300031711 | Bacteria | 998 |
| 388 | Ga0265342_10059659 | 3300031712 | Bacteria | 2253 |
| 389 | Ga0316576_10045262 | 3300031727 | Bacteria | 3181 |
| 390 | Ga0307405_10106792 | 3300031731 | Bacteria | 1889 |
| 391 | Ga0316577_10023237 | 3300031733 | Bacteria | 3442 |
| 392 | Ga0316577_10070205 | 3300031733 | Bacteria | 1956 |
| 393 | Ga0307413_10158479 | 3300031824 | Bacteria | 1587 |
| 394 | Ga0307409_100718908 | 3300031995 | Bacteria | 1000 |
| 395 | Ga0307416_100040997 | 3300032002 | Bacteria | 3603 |
| 396 | Ga0307416_102856053 | 3300032002 | Bacteria | 578 |
| 397 | Ga0307415_100920003 | 3300032126 | Bacteria | 807 |
| 398 | Ga0307415_101266766 | 3300032126 | Bacteria | 697 |
| 399 | Ga0316585_10066050 | 3300032137 | Bacteria | 1172 |
| 400 | Ga0316585_10148503 | 3300032137 | Bacteria | 773 |
| 401 | Ga0316580_10051043 | 3300032139 | Bacteria | 1274 |
| 402 | Ga0316593_10004898 | 3300032168 | Bacteria | 3482 |
| 403 | Ga0316592_1007181 | 3300033524 | Bacteria | 2170 |
| 404 | Ga0316586_1009168 | 3300033527 | Bacteria | 1478 |
| 405 | Ga0316588_1001383 | 3300033528 | Bacteria | 3951 |
| 406 | Ga0316596_1001165 | 3300033541 | Bacteria | 5156 |
| 407 | Ga0316214_1010086 | 3300033545 | Bacteria | 1278 |
| 408 | Ga0373928_0083708 | 3300035084 | Bacteria | 808 |
| 409 | Ga0373934_0090262 | 3300035086 | Bacteria | 1235 |
| 410 | Ga0373949_0153564 | 3300035090 | Bacteria | 667 |
| 411 | Ga0373923_0019383 | 3300035111 | Bacteria | 2634 |
| 412 | Ga0373953_0006693 | 3300035117 | Bacteria | 3814 |
| 413 | Ga0373953_0162063 | 3300035117 | Unclassified | 961 |
| 414 | Ga0373954_0032376 | 3300035118 | Bacteria | 2417 |
| 415 | Ga0373956_0017451 | 3300035119 | Bacteria | 3025 |
| 416 | Ga0373957_0067648 | 3300035120 | Bacteria | 1393 |
| 417 | Ga0373960_0288849 | 3300035121 | Bacteria | 606 |
| 418 | Ga0373955_0037147 | 3300035172 | Bacteria | 2589 |
| 419 | Ga0373961_0080981 | 3300035241 | Bacteria | 1022 |
| 420 | Ga0373962_0026994 | 3300035242 | Bacteria | 1551 |
| 421 | Ga0373962_0067231 | 3300035242 | Bacteria | 1064 |
| 422 | Ga0373924_0113135 | 3300035410 | Bacteria | 1174 |
| 423 | Ga0373931_0014158 | 3300035691 | Bacteria | 3895 |
| 424 | Ga0373931_0147562 | 3300035691 | Bacteria | 1368 |
| 425 | Ga0373935_0286418 | 3300035692 | Bacteria | 1161 |
| 426 | Ga0373933_0002784 | 3300035724 | Bacteria | 9759 |
| 427 | Ga0373933_0016238 | 3300035724 | Bacteria | 4160 |
| 428 | Ga0373933_0044251 | 3300035724 | Bacteria | 2637 |
| 429 | Ga0373933_0345567 | 3300035724 | Bacteria | 966 |
| 430 | Ga0373947_0008668 | 3300035725 | Bacteria | 5851 |
| 431 | Ga0373947_0457156 | 3300035725 | Bacteria | 865 |
| 432 | Ga0373937_0000015 | 3300036401 | Bacteria | 148228 |
| 433 | Ga0373937_0031209 | 3300036401 | Bacteria | 4827 |
| 434 | Ga0373937_0055013 | 3300036401 | Bacteria | 3652 |
| 435 | Ga0373937_0139947 | 3300036401 | Bacteria | 2264 |
| 436 | Ga0373937_0261545 | 3300036401 | Bacteria | 1632 |
| 437 | Ga0373937_0304942 | 3300036401 | Bacteria | 1506 |
| 438 | Ga0316582_0473648 | 3300036647 | Bacteria | 863 |
| 439 | Ga0316584_0088745 | 3300036712 | Bacteria | 2315 |
| 440 | Ga0373925_0105920 | 3300037068 | Bacteria | 2167 |
| 441 | Ga0373925_0448659 | 3300037068 | Bacteria | 1056 |
| 442 | Ga0373925_0477039 | 3300037068 | Bacteria | 1023 |
| 443 | Ga0373925_0481254 | 3300037068 | Bacteria | 1018 |
| 444 | Ga0395900_0539154 | 3300037418 | Bacteria | 1113 |
| 445 | Ga0395898_1810449 | 3300037466 | Bacteria | 532 |
| 446 | Ga0316581_0005411 | 3300037588 | Bacteria | 3323 |
| 447 | Ga0400485_01551 | 3300038735 | Bacteria | 1652 |
| 448 | Ga0400486_28934 | 3300038742 | Bacteria | 1687 |
| 449 | Ga0436365_0727276 | 3300039437 | Bacteria | 64269 |
| 450 | Ga0436363_1097911 | 3300039450 | Bacteria | 1128 |
| 451 | Ga0436363_1383154 | 3300039450 | Bacteria | 4500 |
| 452 | Ga0450923_006324 | 3300042125 | Bacteria | 1958 |
| 453 | Ga0495603_0109354 | 3300046455 | Bacteria | 1613 |
| 454 | Ga0495603_0405888 | 3300046455 | Unclassified | 781 |
| 455 | Ga0495638_0006875 | 3300046460 | Bacteria | 8212 |
| 456 | Ga0495651_0005817 | 3300046462 | Bacteria | 9410 |
| 457 | Ga0495651_0188294 | 3300046462 | Bacteria | 1454 |
| 458 | Ga0495580_0130223 | 3300046472 | Unclassified | 1745 |
| 459 | Ga0495580_0510676 | 3300046472 | Bacteria | 802 |
| 460 | Ga0495662_0330816 | 3300046476 | Bacteria | 749 |
| 461 | Ga0495618_0078882 | 3300046514 | Bacteria | 2099 |
| 462 | Ga0495628_0189729 | 3300046516 | Bacteria | 1552 |
| 463 | Ga0495628_0296398 | 3300046516 | Bacteria | 1198 |
| 464 | Ga0495628_0425373 | 3300046516 | Unclassified | 967 |
| 465 | Ga0495630_0220409 | 3300046517 | Bacteria | 1448 |
| 466 | Ga0495630_0345481 | 3300046517 | Bacteria | 1139 |
| 467 | Ga0495630_0698000 | 3300046517 | Bacteria | 776 |
| 468 | Ga0495632_0100628 | 3300046519 | Bacteria | 1363 |
| 469 | Ga0495640_0162308 | 3300046533 | Bacteria | 1431 |
| 470 | Ga0495640_0162996 | 3300046533 | Bacteria | 1427 |
| 471 | Ga0495586_0665819 | 3300046535 | Bacteria | 601 |
| 472 | Ga0495587_0000219 | 3300046536 | Bacteria | 42459 |
| 473 | Ga0495587_0041257 | 3300046536 | Bacteria | 2754 |
| 474 | Ga0495645_0001163 | 3300046543 | Bacteria | 17915 |
| 475 | Ga0495667_0581612 | 3300046559 | Bacteria | 698 |
| 476 | Ga0495625_0002827 | 3300046660 | Bacteria | 18279 |
| 477 | Ga0495635_0063595 | 3300046663 | Unclassified | 2534 |
| 478 | Ga0495599_0093509 | 3300046678 | Bacteria | 1876 |
| 479 | Ga0495623_0090980 | 3300046679 | Bacteria | 1873 |
| 480 | Ga0495623_0244988 | 3300046679 | Bacteria | 1011 |
| 481 | Ga0495646_0122906 | 3300046680 | Unclassified | 1467 |
| 482 | Ga0495669_0383581 | 3300046684 | Bacteria | 680 |
| 483 | Ga0495613_0041878 | 3300046689 | Bacteria | 3390 |
| 484 | Ga0495613_0283980 | 3300046689 | Bacteria | 1149 |
| 485 | Ga0495613_0376463 | 3300046689 | Bacteria | 971 |
| 486 | Ga0495600_0012750 | 3300046809 | Bacteria | 5264 |
| 487 | Ga0495581_0351618 | 3300047315 | Bacteria | 860 |
| 488 | Ga0495604_0030100 | 3300047317 | Bacteria | 4315 |
| 489 | Ga0495604_0064238 | 3300047317 | Bacteria | 2798 |
| 490 | Ga0495674_0859316 | 3300047319 | Bacteria | 702 |
| 491 | Ga0495680_0053349 | 3300047322 | Bacteria | 3147 |
| 492 | Ga0495680_0358408 | 3300047322 | Bacteria | 1014 |
| 493 | Ga0495675_0001097 | 3300047444 | Bacteria | 16431 |
| 494 | Ga0495684_0230143 | 3300047471 | Bacteria | 1356 |
| 495 | Ga0495684_0394362 | 3300047471 | Bacteria | 973 |
| 496 | Ga0495602_0000206 | 3300048088 | Bacteria | 54913 |
| 497 | Ga0495602_0080475 | 3300048088 | Bacteria | 2744 |
| 498 | Ga0496100_0005125 | 3300048903 | Bacteria | 7024 |
| 499 | Ga0496100_0276401 | 3300048903 | Bacteria | 1250 |
| 500 | Ga0496100_0382101 | 3300048903 | Bacteria | 1070 |
| 501 | Ga0496101_0001893 | 3300048904 | Bacteria | 12638 |
| 502 | Ga0496101_0104180 | 3300048904 | Bacteria | 2127 |
| 503 | Ga0496101_0202464 | 3300048904 | Bacteria | 1535 |
| 504 | Ga0496102_0015717 | 3300048905 | Bacteria | 6594 |
| 505 | Ga0496102_0132003 | 3300048905 | Bacteria | 2339 |
| 506 | Ga0496102_1449739 | 3300048905 | Bacteria | 605 |
| 507 | Ga0496103_0049012 | 3300048906 | Bacteria | 2611 |
| 508 | Ga0496103_0320145 | 3300048906 | Bacteria | 997 |
| 509 | Ga0496103_0469832 | 3300048906 | Bacteria | 806 |
| 510 | Ga0496104_0059705 | 3300048907 | Bacteria | 3610 |
| 511 | Ga0496104_0411474 | 3300048907 | Bacteria | 1264 |
| 512 | Ga0496105_0007553 | 3300048908 | Bacteria | 8422 |
| 513 | Ga0496105_0058866 | 3300048908 | Bacteria | 3170 |
| 514 | Ga0496105_0207283 | 3300048908 | Bacteria | 1599 |
| 515 | Ga0496106_0009062 | 3300048909 | Bacteria | 7356 |
| 516 | Ga0496106_0017862 | 3300048909 | Bacteria | 5245 |
| 517 | Ga0496107_0008324 | 3300048910 | Bacteria | 7174 |
| 518 | Ga0496107_0026595 | 3300048910 | Bacteria | 4102 |
| 519 | Ga0496107_0050542 | 3300048910 | Bacteria | 2997 |
| 520 | Ga0496107_0640021 | 3300048910 | Bacteria | 784 |
| 521 | Ga0496108_0016792 | 3300048911 | Bacteria | 5980 |
| 522 | Ga0496108_0033905 | 3300048911 | Bacteria | 4240 |
| 523 | Ga0496109_0061915 | 3300048912 | Bacteria | 3422 |
| 524 | Ga0496109_0068799 | 3300048912 | Bacteria | 3245 |
| 525 | Ga0496109_0078049 | 3300048912 | Bacteria | 3048 |
| 526 | Ga0496109_0215061 | 3300048912 | Bacteria | 1807 |
| 527 | Ga0496109_0452743 | 3300048912 | Bacteria | 1212 |
| 528 | Ga0496110_0048322 | 3300048913 | Bacteria | 3729 |
| 529 | Ga0496111_0031303 | 3300048914 | Bacteria | 3789 |
| 530 | Ga0496111_0284031 | 3300048914 | Bacteria | 1227 |
| 531 | Ga0496112_0010926 | 3300048915 | Bacteria | 8268 |
| 532 | Ga0496112_0018578 | 3300048915 | Bacteria | 6550 |
| 533 | Ga0496112_0237663 | 3300048915 | Bacteria | 1775 |
| 534 | Ga0496112_0350550 | 3300048915 | Bacteria | 1418 |
| 535 | Ga0496112_0402900 | 3300048915 | Bacteria | 1308 |
| 536 | Ga0496113_0003818 | 3300048916 | Bacteria | 9116 |
| 537 | Ga0496113_0056366 | 3300048916 | Bacteria | 2950 |
| 538 | Ga0496113_0189367 | 3300048916 | Bacteria | 1633 |
| 539 | Ga0496113_0259290 | 3300048916 | Bacteria | 1389 |
| 540 | Ga0496114_0001346 | 3300048917 | Bacteria | 18615 |
| 541 | Ga0496114_0009187 | 3300048917 | Bacteria | 7838 |
| 542 | Ga0496115_0005692 | 3300048918 | Bacteria | 9072 |
| 543 | Ga0496115_0016931 | 3300048918 | Bacteria | 5560 |
| 544 | Ga0496115_0272821 | 3300048918 | Bacteria | 1389 |
| 545 | Ga0501031_0207411 | 3300049568 | Bacteria | 1278 |
| 546 | Ga0501032_0251252 | 3300049569 | Bacteria | 1148 |
| 547 | Ga0501032_0448185 | 3300049569 | Bacteria | 827 |
| 548 | Ga0501034_0001321 | 3300049571 | Bacteria | 33531 |
| 549 | Ga0501036_0048606 | 3300049572 | Bacteria | 3592 |
| 550 | Ga0501036_0244803 | 3300049572 | Bacteria | 1503 |
| 551 | Ga0501036_0541255 | 3300049572 | Bacteria | 968 |
| 552 | Ga0501037_0119993 | 3300049573 | Bacteria | 1891 |
| 553 | Ga0501038_0281063 | 3300049574 | Bacteria | 1310 |
| 554 | Ga0501038_0350647 | 3300049574 | Bacteria | 1149 |
| 555 | Ga0501038_0370607 | 3300049574 | Bacteria | 1112 |
| 556 | Ga0501038_0564483 | 3300049574 | Bacteria | 864 |
| 557 | Ga0501039_0040919 | 3300049575 | Bacteria | 3578 |
| 558 | Ga0501039_0178870 | 3300049575 | Bacteria | 1668 |
| 559 | Ga0501039_1173632 | 3300049575 | Bacteria | 594 |
| 560 | Ga0501040_0024388 | 3300049576 | Bacteria | 4059 |
| 561 | Ga0501040_0048788 | 3300049576 | Bacteria | 2894 |
| 562 | Ga0501040_0086191 | 3300049576 | Bacteria | 2180 |
| 563 | Ga0501040_0219856 | 3300049576 | Bacteria | 1351 |
| 564 | Ga0501041_0043223 | 3300049577 | Bacteria | 2739 |
| 565 | Ga0501041_0080038 | 3300049577 | Bacteria | 2011 |
| 566 | Ga0501041_0217621 | 3300049577 | Bacteria | 1198 |
| 567 | Ga0501042_0030673 | 3300049578 | Bacteria | 3799 |
| 568 | Ga0501042_0157480 | 3300049578 | Bacteria | 1638 |
| 569 | Ga0501042_0265696 | 3300049578 | Bacteria | 1239 |
| 570 | Ga0501043_0033445 | 3300049579 | Bacteria | 4046 |
| 571 | Ga0501046_0145845 | 3300049580 | Bacteria | 1788 |
| 572 | Ga0501048_0024801 | 3300049582 | Bacteria | 4374 |
| 573 | Ga0501048_0386469 | 3300049582 | Bacteria | 1000 |
| 574 | Ga0501048_0726809 | 3300049582 | Bacteria | 713 |
| 575 | Ga0501067_0122570 | 3300049583 | Bacteria | 1447 |
| 576 | Ga0501068_0019681 | 3300049584 | Bacteria | 3923 |
| 577 | Ga0501068_0132331 | 3300049584 | Bacteria | 1560 |
| 578 | Ga0501068_0203870 | 3300049584 | Bacteria | 1255 |
| 579 | Ga0501068_0345448 | 3300049584 | Bacteria | 956 |
| 580 | Ga0501069_0155722 | 3300049585 | Bacteria | 1314 |
| 581 | Ga0501069_0390484 | 3300049585 | Bacteria | 823 |
| 582 | Ga0501070_0088916 | 3300049586 | Bacteria | 2556 |
| 583 | Ga0501070_0384210 | 3300049586 | Bacteria | 1137 |
| 584 | Ga0501070_0731826 | 3300049586 | Bacteria | 781 |
| 585 | Ga0501071_0013681 | 3300049587 | Bacteria | 5534 |
| 586 | Ga0501071_0135334 | 3300049587 | Bacteria | 1833 |
| 587 | Ga0501071_0480137 | 3300049587 | Bacteria | 953 |
| 588 | Ga0501072_0027722 | 3300049588 | Bacteria | 4418 |
| 589 | Ga0501072_0135146 | 3300049588 | Bacteria | 1966 |
| 590 | Ga0501072_0169220 | 3300049588 | Bacteria | 1744 |
| 591 | Ga0501072_0189985 | 3300049588 | Bacteria | 1638 |
| 592 | Ga0501072_0202070 | 3300049588 | Bacteria | 1584 |
| 593 | Ga0501073_0096334 | 3300049589 | Bacteria | 2055 |
| 594 | Ga0501073_0170054 | 3300049589 | Bacteria | 1509 |
| 595 | Ga0501074_0034186 | 3300049590 | Bacteria | 3685 |
| 596 | Ga0501074_0053833 | 3300049590 | Bacteria | 2903 |
| 597 | Ga0501074_0074625 | 3300049590 | Bacteria | 2435 |
| 598 | Ga0501074_0144260 | 3300049590 | Bacteria | 1703 |
| 599 | Ga0501074_0414554 | 3300049590 | Bacteria | 955 |
| 600 | Ga0501075_0049908 | 3300049591 | Bacteria | 3145 |
| 601 | Ga0501075_0153568 | 3300049591 | Bacteria | 1755 |
| 602 | Ga0501075_0155406 | 3300049591 | Bacteria | 1744 |
| 603 | Ga0501075_0185357 | 3300049591 | Bacteria | 1587 |
| 604 | Ga0501075_0489062 | 3300049591 | Bacteria | 939 |
| 605 | Ga0501075_0628530 | 3300049591 | Bacteria | 819 |
| 606 | Ga0501076_0054516 | 3300049592 | Bacteria | 3169 |
| 607 | Ga0501076_0082714 | 3300049592 | Bacteria | 2577 |
| 608 | Ga0501076_0109907 | 3300049592 | Bacteria | 2228 |
| 609 | Ga0501076_0128252 | 3300049592 | Bacteria | 2056 |
| 610 | Ga0501077_0021699 | 3300049593 | Bacteria | 4065 |
| 611 | Ga0501077_0196766 | 3300049593 | Bacteria | 1280 |
| 612 | Ga0501077_0481386 | 3300049593 | Bacteria | 795 |
| 613 | Ga0501077_0689104 | 3300049593 | Bacteria | 657 |
| 614 | Ga0501223_016413 | 3300049663 | Bacteria | 1463 |
| 615 | Ga0501257_000049 | 3300049686 | Bacteria | 33138 |
| 616 | Ga0501079_0023514 | 3300049741 | Bacteria | 4729 |
| 617 | Ga0501079_0051324 | 3300049741 | Bacteria | 3184 |
| 618 | Ga0501079_0189395 | 3300049741 | Bacteria | 1605 |
| 619 | Ga0501079_0219683 | 3300049741 | Bacteria | 1485 |
| 620 | Ga0501079_0483561 | 3300049741 | Bacteria | 973 |
| 621 | Ga0501080_0479382 | 3300049742 | Bacteria | 1113 |
| 622 | Ga0501080_0494272 | 3300049742 | Bacteria | 1094 |
| 623 | Ga0501081_0014256 | 3300049743 | Bacteria | 5241 |
| 624 | Ga0501081_0049240 | 3300049743 | Bacteria | 2902 |
| 625 | Ga0501081_0142454 | 3300049743 | Bacteria | 1718 |
| 626 | Ga0501081_0430447 | 3300049743 | Bacteria | 979 |
| 627 | Ga0501083_0122823 | 3300049744 | Bacteria | 1703 |
| 628 | Ga0501083_0167354 | 3300049744 | Bacteria | 1437 |
| 629 | Ga0501280_003193 | 3300049776 | Bacteria | 2556 |
| 630 | Ga0501035_0049109 | 3300049822 | Bacteria | 3782 |
| 631 | Ga0501035_1312255 | 3300049822 | Bacteria | 557 |
| 632 | Ga0501045_0068718 | 3300049824 | Bacteria | 2603 |
| 633 | Ga0501045_0108826 | 3300049824 | Bacteria | 2054 |
| 634 | Ga0501045_0129989 | 3300049824 | Bacteria | 1872 |
| 635 | nmdc:mga05p37_1308991_c1 | 3300050507 | Bacteria | 738 |
| 636 | nmdc:mga05p37_68872_c1 | 3300050507 | Bacteria | 4351 |
| 637 | nmdc:mga05p37_985001_c1 | 3300050507 | Bacteria | 898 |
| 638 | nmdc:mga0qj67_344807_c1 | 3300050509 | Bacteria | 1205 |
| 639 | nmdc:mga0qj67_714133_c1 | 3300050509 | Unclassified | 797 |
| 640 | nmdc:mga06r32_151484_c1 | 3300050510 | Bacteria | 2298 |
| 641 | nmdc:mga08y16_606268_c1 | 3300050511 | Bacteria | 1103 |
| 642 | nmdc:mga0n895_1201169_c1 | 3300050512 | Bacteria | 732 |
| 643 | nmdc:mga0rr50_73643_c1 | 3300050513 | Bacteria | 2612 |
| 644 | nmdc:mga0rr50_91258_c1 | 3300050513 | Bacteria | 2372 |
| 645 | nmdc:mga08x19_272838_c1 | 3300050514 | Bacteria | 1171 |
| 646 | nmdc:mga0a205_449614_c1 | 3300050515 | Bacteria | 1148 |
| 647 | Ga0495595_0222568 | 3300053084 | Bacteria | 942 |
| 648 | Ga0495619_0349760 | 3300053085 | Unclassified | 1022 |
| 649 | Ga0500625_012248 | 3300053729 | Bacteria | 3918 |
| 650 | Ga0501084_0016279 | 3300054114 | Bacteria | 6175 |
| 651 | Ga0501084_0028319 | 3300054114 | Bacteria | 4682 |
| 652 | Ga0501084_0089771 | 3300054114 | Bacteria | 2579 |
| 653 | Ga0501084_0105129 | 3300054114 | Bacteria | 2371 |
| 654 | Ga0501084_0237332 | 3300054114 | Bacteria | 1539 |
| 655 | Ga0501084_0630396 | 3300054114 | Bacteria | 905 |
| 656 | Ga0501084_1114708 | 3300054114 | Bacteria | 662 |
| 657 | Ga0590077_012928 | 3300059426 | Bacteria | 1733 |
| 658 | Ga0501082_0103385 | 3300060353 | Bacteria | 2464 |
| 659 | Ga0501082_0182484 | 3300060353 | Bacteria | 1825 |
| 660 | Ga0530510_0011636 | 3300061734 | Bacteria | 6174 |
| 661 | Ga0530510_0020861 | 3300061734 | Bacteria | 4660 |
| 662 | Ga0530510_0119994 | 3300061734 | Bacteria | 1930 |
| 663 | Ga0530510_0139243 | 3300061734 | Bacteria | 1787 |
| 664 | Ga0530510_0406922 | 3300061734 | Bacteria | 1026 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005353 | Ga0070669_100117138 | Ga0070669_1001171382 | 162 |
| 2 | 3300005530 | Ga0070679_100985603 | Ga0070679_1009856031 | 162 |
| 3 | 3300005539 | Ga0068853_100054633 | Ga0068853_1000546331 | 162 |
| 4 | 3300005546 | Ga0070696_101016533 | Ga0070696_1010165331 | 162 |
| 5 | 3300005563 | Ga0068855_100194090 | Ga0068855_1001940902 | 162 |
| 6 | 3300005577 | Ga0068857_100392284 | Ga0068857_1003922842 | 162 |
| 7 | 3300005578 | Ga0068854_100014348 | Ga0068854_1000143486 | 162 |
| 8 | 3300005614 | Ga0068856_100227853 | Ga0068856_1002278533 | 162 |
| 9 | 3300005842 | Ga0068858_100099514 | Ga0068858_1000995144 | 162 |
| 10 | 3300006237 | Ga0097621_100160698 | Ga0097621_1001606982 | 162 |
| 11 | 3300009545 | Ga0105237_10286040 | Ga0105237_102860402 | 162 |
| 12 | 3300009551 | Ga0105238_10013074 | Ga0105238_100130744 | 162 |
| 13 | 3300046678 | Ga0495599_0093509 | Ga0495599_0093509_975_1511 | 162 |
| 14 | 3300003322 | rootL2_10344107 | rootL2_103441072 | 163 |
| 15 | 3300005290 | Ga0065712_10429642 | Ga0065712_104296422 | 163 |
| 16 | 3300005338 | Ga0068868_100016942 | Ga0068868_1000169423 | 163 |
| 17 | 3300005344 | Ga0070661_100815913 | Ga0070661_1008159131 | 163 |
| 18 | 3300005366 | Ga0070659_100757801 | Ga0070659_1007578012 | 163 |
| 19 | 3300005434 | Ga0070709_10114986 | Ga0070709_101149863 | 163 |
| 20 | 3300005434 | Ga0070709_10120264 | Ga0070709_101202642 | 163 |
| 21 | 3300005436 | Ga0070713_100030941 | Ga0070713_1000309415 | 163 |
| 22 | 3300005436 | Ga0070713_100259934 | Ga0070713_1002599342 | 163 |
| 23 | 3300005458 | Ga0070681_10001396 | Ga0070681_1000139624 | 163 |
| 24 | 3300005458 | Ga0070681_10603144 | Ga0070681_106031441 | 163 |
| 25 | 3300005466 | Ga0070685_10011013 | Ga0070685_100110132 | 163 |
| 26 | 3300005467 | Ga0070706_100136654 | Ga0070706_1001366542 | 163 |
| 27 | 3300005530 | Ga0070679_100100744 | Ga0070679_1001007443 | 163 |
| 28 | 3300005539 | Ga0068853_100098948 | Ga0068853_1000989483 | 163 |
| 29 | 3300005563 | Ga0068855_100694659 | Ga0068855_1006946592 | 163 |
| 30 | 3300005617 | Ga0068859_100273747 | Ga0068859_1002737472 | 163 |
| 31 | 3300005719 | Ga0068861_100112150 | Ga0068861_1001121502 | 163 |
| 32 | 3300005841 | Ga0068863_100374286 | Ga0068863_1003742862 | 163 |
| 33 | 3300005842 | Ga0068858_100045051 | Ga0068858_1000450515 | 163 |
| 34 | 3300005842 | Ga0068858_100086579 | Ga0068858_1000865792 | 163 |
| 35 | 3300005843 | Ga0068860_100017469 | Ga0068860_1000174693 | 163 |
| 36 | 3300005844 | Ga0068862_100029227 | Ga0068862_1000292272 | 163 |
| 37 | 3300006237 | Ga0097621_101038306 | Ga0097621_1010383062 | 163 |
| 38 | 3300006852 | Ga0075433_11305720 | Ga0075433_113057201 | 163 |
| 39 | 3300006931 | Ga0097620_100273785 | Ga0097620_1002737852 | 163 |
| 40 | 3300007076 | Ga0075435_100097938 | Ga0075435_1000979382 | 163 |
| 41 | 3300009177 | Ga0105248_10072270 | Ga0105248_100722702 | 163 |
| 42 | 3300009553 | Ga0105249_10222956 | Ga0105249_102229562 | 163 |
| 43 | 3300010375 | Ga0105239_10003994 | Ga0105239_1000399411 | 163 |
| 44 | 3300013296 | Ga0157374_10003797 | Ga0157374_100037974 | 163 |
| 45 | 3300013306 | Ga0163162_10003369 | Ga0163162_1000336913 | 163 |
| 46 | 3300013308 | Ga0157375_10020734 | Ga0157375_100207343 | 163 |
| 47 | 3300014745 | Ga0157377_10037195 | Ga0157377_100371953 | 163 |
| 48 | 3300014968 | Ga0157379_10365860 | Ga0157379_103658602 | 163 |
| 49 | 3300024225 | Ga0224572_1014422 | Ga0224572_10144222 | 163 |
| 50 | 3300024227 | Ga0228598_1000036 | Ga0228598_100003615 | 163 |
| 51 | 3300025904 | Ga0207647_10002142 | Ga0207647_1000214211 | 163 |
| 52 | 3300025906 | Ga0207699_10184570 | Ga0207699_101845702 | 163 |
| 53 | 3300025910 | Ga0207684_10070391 | Ga0207684_100703913 | 163 |
| 54 | 3300025912 | Ga0207707_10026912 | Ga0207707_100269127 | 163 |
| 55 | 3300025913 | Ga0207695_10372007 | Ga0207695_103720072 | 163 |
| 56 | 3300025914 | Ga0207671_10289178 | Ga0207671_102891782 | 163 |
| 57 | 3300025921 | Ga0207652_10019036 | Ga0207652_100190362 | 163 |
| 58 | 3300025928 | Ga0207700_10282369 | Ga0207700_102823692 | 163 |
| 59 | 3300025938 | Ga0207704_10014366 | Ga0207704_100143662 | 163 |
| 60 | 3300025941 | Ga0207711_10042219 | Ga0207711_100422192 | 163 |
| 61 | 3300025942 | Ga0207689_10002538 | Ga0207689_100025382 | 163 |
| 62 | 3300025942 | Ga0207689_10329021 | Ga0207689_103290212 | 163 |
| 63 | 3300025949 | Ga0207667_10664085 | Ga0207667_106640852 | 163 |
| 64 | 3300026023 | Ga0207677_10159158 | Ga0207677_101591582 | 163 |
| 65 | 3300026035 | Ga0207703_10014360 | Ga0207703_100143607 | 163 |
| 66 | 3300026088 | Ga0207641_10275211 | Ga0207641_102752112 | 163 |
| 67 | 3300026118 | Ga0207675_100210807 | Ga0207675_1002108073 | 163 |
| 68 | 3300026142 | Ga0207698_11380723 | Ga0207698_113807232 | 163 |
| 69 | 3300027671 | Ga0209588_1038707 | Ga0209588_10387072 | 163 |
| 70 | 3300028380 | Ga0268265_10011728 | Ga0268265_100117282 | 163 |
| 71 | 3300028381 | Ga0268264_10120950 | Ga0268264_101209502 | 163 |
| 72 | 3300028381 | Ga0268264_10316219 | Ga0268264_103162192 | 163 |
| 73 | 3300031090 | Ga0265760_10073663 | Ga0265760_100736631 | 163 |
| 74 | 3300031235 | Ga0265330_10103468 | Ga0265330_101034682 | 163 |
| 75 | 3300031241 | Ga0265325_10033553 | Ga0265325_100335532 | 163 |
| 76 | 3300031242 | Ga0265329_10166070 | Ga0265329_101660702 | 163 |
| 77 | 3300031247 | Ga0265340_10036071 | Ga0265340_100360712 | 163 |
| 78 | 3300031247 | Ga0265340_10041819 | Ga0265340_100418192 | 163 |
| 79 | 3300031247 | Ga0265340_10124740 | Ga0265340_101247401 | 163 |
| 80 | 3300031247 | Ga0265340_10125731 | Ga0265340_101257312 | 163 |
| 81 | 3300031251 | Ga0265327_10001788 | Ga0265327_1000178820 | 163 |
| 82 | 3300031344 | Ga0265316_10020689 | Ga0265316_100206895 | 163 |
| 83 | 3300031344 | Ga0265316_10199146 | Ga0265316_101991462 | 163 |
| 84 | 3300031712 | Ga0265342_10059659 | Ga0265342_100596592 | 163 |
| 85 | 3300035090 | Ga0373949_0153564 | Ga0373949_0153564_129_620 | 163 |
| 86 | 3300035118 | Ga0373954_0032376 | Ga0373954_0032376_1647_2171 | 163 |
| 87 | 3300035120 | Ga0373957_0067648 | Ga0373957_0067648_809_1333 | 163 |
| 88 | 3300035172 | Ga0373955_0037147 | Ga0373955_0037147_1312_1836 | 163 |
| 89 | 3300035410 | Ga0373924_0113135 | Ga0373924_0113135_210_734 | 163 |
| 90 | 3300035724 | Ga0373933_0002784 | Ga0373933_0002784_5252_5776 | 163 |
| 91 | 3300036401 | Ga0373937_0000015 | Ga0373937_0000015_15897_16421 | 163 |
| 92 | 3300036401 | Ga0373937_0031209 | Ga0373937_0031209_4165_4656 | 163 |
| 93 | 3300036401 | Ga0373937_0139947 | Ga0373937_0139947_1584_2075 | 163 |
| 94 | 3300037068 | Ga0373925_0105920 | Ga0373925_0105920_1427_1918 | 163 |
| 95 | 3300037068 | Ga0373925_0477039 | Ga0373925_0477039_455_946 | 163 |
| 96 | 3300037418 | Ga0395900_0539154 | Ga0395900_0539154_345_836 | 163 |
| 97 | 3300037466 | Ga0395898_1810449 | Ga0395898_1810449_28_519 | 163 |
| 98 | 3300046455 | Ga0495603_0109354 | Ga0495603_0109354_1052_1543 | 163 |
| 99 | 3300046462 | Ga0495651_0005817 | Ga0495651_0005817_8354_8878 | 163 |
| 100 | 3300046462 | Ga0495651_0188294 | Ga0495651_0188294_477_968 | 163 |
| 101 | 3300046472 | Ga0495580_0130223 | Ga0495580_0130223_1125_1616 | 163 |
| 102 | 3300046476 | Ga0495662_0330816 | Ga0495662_0330816_248_739 | 163 |
| 103 | 3300046514 | Ga0495618_0078882 | Ga0495618_0078882_1576_2067 | 163 |
| 104 | 3300046516 | Ga0495628_0189729 | Ga0495628_0189729_582_1073 | 163 |
| 105 | 3300046517 | Ga0495630_0220409 | Ga0495630_0220409_453_944 | 163 |
| 106 | 3300046533 | Ga0495640_0162996 | Ga0495640_0162996_739_1230 | 163 |
| 107 | 3300046536 | Ga0495587_0000219 | Ga0495587_0000219_3726_4250 | 163 |
| 108 | 3300046536 | Ga0495587_0041257 | Ga0495587_0041257_1748_2239 | 163 |
| 109 | 3300046543 | Ga0495645_0001163 | Ga0495645_0001163_8410_8901 | 163 |
| 110 | 3300046663 | Ga0495635_0063595 | Ga0495635_0063595_1853_2344 | 163 |
| 111 | 3300046679 | Ga0495623_0244988 | Ga0495623_0244988_332_823 | 163 |
| 112 | 3300046680 | Ga0495646_0122906 | Ga0495646_0122906_395_886 | 163 |
| 113 | 3300046689 | Ga0495613_0041878 | Ga0495613_0041878_2415_2906 | 163 |
| 114 | 3300046689 | Ga0495613_0283980 | Ga0495613_0283980_151_642 | 163 |
| 115 | 3300046809 | Ga0495600_0012750 | Ga0495600_0012750_1977_2468 | 163 |
| 116 | 3300047315 | Ga0495581_0351618 | Ga0495581_0351618_74_565 | 163 |
| 117 | 3300047317 | Ga0495604_0030100 | Ga0495604_0030100_3620_4144 | 163 |
| 118 | 3300047317 | Ga0495604_0064238 | Ga0495604_0064238_709_1200 | 163 |
| 119 | 3300047319 | Ga0495674_0859316 | Ga0495674_0859316_153_644 | 163 |
| 120 | 3300047322 | Ga0495680_0358408 | Ga0495680_0358408_70_561 | 163 |
| 121 | 3300047444 | Ga0495675_0001097 | Ga0495675_0001097_9111_9635 | 163 |
| 122 | 3300047471 | Ga0495684_0230143 | Ga0495684_0230143_542_1033 | 163 |
| 123 | 3300048088 | Ga0495602_0000206 | Ga0495602_0000206_16627_17151 | 163 |
| 124 | 3300048088 | Ga0495602_0080475 | Ga0495602_0080475_652_1143 | 163 |
| 125 | 3300048915 | Ga0496112_0010926 | Ga0496112_0010926_2122_2613 | 163 |
| 126 | 3300048915 | Ga0496112_0018578 | Ga0496112_0018578_3374_3865 | 163 |
| 127 | 3300048916 | Ga0496113_0189367 | Ga0496113_0189367_864_1355 | 163 |
| 128 | 3300050513 | nmdc:mga0rr50_73643_c1 | nmdc:mga0rr50_73643_c1_204_695 | 163 |
| 129 | 3300050513 | nmdc:mga0rr50_91258_c1 | nmdc:mga0rr50_91258_c1_1186_1677 | 163 |
| 130 | 3300050514 | nmdc:mga08x19_272838_c1 | nmdc:mga08x19_272838_c1_101_592 | 163 |
| 131 | 3300050515 | nmdc:mga0a205_449614_c1 | nmdc:mga0a205_449614_c1_154_645 | 163 |
| 132 | 3300053085 | Ga0495619_0349760 | Ga0495619_0349760_468_959 | 163 |
| 133 | 3300059426 | Ga0590077_012928 | Ga0590077_012928_1196_1699 | 163 |
| 134 | 3300005614 | Ga0068856_100955104 | Ga0068856_1009551042 | 164 |
| 135 | 3300005841 | Ga0068863_100394536 | Ga0068863_1003945363 | 164 |
| 136 | 3300009148 | Ga0105243_10586939 | Ga0105243_105869393 | 164 |
| 137 | 3300026088 | Ga0207641_10279996 | Ga0207641_102799961 | 164 |
| 138 | 3300032002 | Ga0307416_102856053 | Ga0307416_1028560531 | 164 |
| 139 | 3300032126 | Ga0307415_101266766 | Ga0307415_1012667662 | 164 |
| 140 | 3300035086 | Ga0373934_0090262 | Ga0373934_0090262_582_1076 | 164 |
| 141 | 3300035111 | Ga0373923_0019383 | Ga0373923_0019383_2105_2599 | 164 |
| 142 | 3300035117 | Ga0373953_0162063 | Ga0373953_0162063_118_612 | 164 |
| 143 | 3300035724 | Ga0373933_0016238 | Ga0373933_0016238_2262_2756 | 164 |
| 144 | 3300036401 | Ga0373937_0055013 | Ga0373937_0055013_124_618 | 164 |
| 145 | 3300046516 | Ga0495628_0425373 | Ga0495628_0425373_10_504 | 164 |
| 146 | 3300046679 | Ga0495623_0090980 | Ga0495623_0090980_425_919 | 164 |
| 147 | 3300050512 | nmdc:mga0n895_1201169_c1 | nmdc:mga0n895_1201169_c1_118_612 | 164 |
| 148 | 3300005548 | Ga0070665_100203815 | Ga0070665_1002038152 | 165 |
| 149 | 3300009553 | Ga0105249_11278729 | Ga0105249_112787291 | 165 |
| 150 | 3300014325 | Ga0163163_12097697 | Ga0163163_120976971 | 165 |
| 151 | 3300025925 | Ga0207650_10173050 | Ga0207650_101730502 | 165 |
| 152 | 3300026089 | Ga0207648_10546126 | Ga0207648_105461262 | 165 |
| 153 | 3300028379 | Ga0268266_10049671 | Ga0268266_100496719 | 165 |
| 154 | 3300028380 | Ga0268265_10427913 | Ga0268265_104279132 | 165 |
| 155 | 3300038735 | Ga0400485_01551 | Ga0400485_01551_572_1072 | 165 |
| 156 | 3300038742 | Ga0400486_28934 | Ga0400486_28934_629_1129 | 165 |
| 157 | 3300046455 | Ga0495603_0405888 | Ga0495603_0405888_227_724 | 165 |
| 158 | 3300048918 | Ga0496115_0272821 | Ga0496115_0272821_304_801 | 165 |
| 159 | 3300049571 | Ga0501034_0001321 | Ga0501034_0001321_12637_13137 | 165 |
| 160 | 3300049572 | Ga0501036_0541255 | Ga0501036_0541255_147_647 | 165 |
| 161 | 3300049588 | Ga0501072_0027722 | Ga0501072_0027722_887_1387 | 165 |
| 162 | 3300053729 | Ga0500625_012248 | Ga0500625_012248_588_1085 | 165 |
| 163 | iso_pu_bacteria | 2838074704 | 2838076903 | 165 |
| 164 | iso_pu_bacteria | 2920760137 | 2920761574 | 165 |
| 165 | 3300002239 | JGI24034J26672_10020594 | JGI24034J26672_100205942 | 166 |
| 166 | 3300005295 | Ga0065707_10365715 | Ga0065707_103657151 | 166 |
| 167 | 3300005331 | Ga0070670_100006332 | Ga0070670_1000063326 | 166 |
| 168 | 3300005335 | Ga0070666_10000184 | Ga0070666_1000018436 | 166 |
| 169 | 3300005347 | Ga0070668_100065828 | Ga0070668_1000658282 | 166 |
| 170 | 3300005353 | Ga0070669_100000008 | Ga0070669_10000000859 | 166 |
| 171 | 3300005355 | Ga0070671_100000015 | Ga0070671_100000015152 | 166 |
| 172 | 3300005367 | Ga0070667_100125738 | Ga0070667_1001257382 | 166 |
| 173 | 3300005435 | Ga0070714_100112156 | Ga0070714_1001121564 | 166 |
| 174 | 3300005436 | Ga0070713_100066254 | Ga0070713_1000662542 | 166 |
| 175 | 3300005445 | Ga0070708_100064225 | Ga0070708_1000642254 | 166 |
| 176 | 3300005548 | Ga0070665_100097361 | Ga0070665_1000973614 | 166 |
| 177 | 3300005615 | Ga0070702_100667327 | Ga0070702_1006673271 | 166 |
| 178 | 3300005617 | Ga0068859_100002375 | Ga0068859_10000237514 | 166 |
| 179 | 3300005618 | Ga0068864_100003703 | Ga0068864_10000370312 | 166 |
| 180 | 3300005719 | Ga0068861_100001851 | Ga0068861_10000185111 | 166 |
| 181 | 3300005841 | Ga0068863_100003742 | Ga0068863_1000037429 | 166 |
| 182 | 3300005842 | Ga0068858_100019432 | Ga0068858_1000194328 | 166 |
| 183 | 3300005843 | Ga0068860_100001081 | Ga0068860_1000010814 | 166 |
| 184 | 3300005844 | Ga0068862_100006641 | Ga0068862_1000066412 | 166 |
| 185 | 3300006028 | Ga0070717_10508525 | Ga0070717_105085252 | 166 |
| 186 | 3300006931 | Ga0097620_100002375 | Ga0097620_10000237514 | 166 |
| 187 | 3300009101 | Ga0105247_10001891 | Ga0105247_100018916 | 166 |
| 188 | 3300009177 | Ga0105248_10054850 | Ga0105248_100548506 | 166 |
| 189 | 3300009553 | Ga0105249_10003539 | Ga0105249_1000353913 | 166 |
| 190 | 3300013306 | Ga0163162_10007327 | Ga0163162_100073278 | 166 |
| 191 | 3300014325 | Ga0163163_10013796 | Ga0163163_100137963 | 166 |
| 192 | 3300014326 | Ga0157380_10323625 | Ga0157380_103236252 | 166 |
| 193 | 3300014968 | Ga0157379_10011989 | Ga0157379_100119894 | 166 |
| 194 | 3300017792 | Ga0163161_10098109 | Ga0163161_100981093 | 166 |
| 195 | 3300025315 | Ga0207697_10000274 | Ga0207697_1000027410 | 166 |
| 196 | 3300025900 | Ga0207710_10023544 | Ga0207710_100235443 | 166 |
| 197 | 3300025906 | Ga0207699_10008743 | Ga0207699_100087433 | 166 |
| 198 | 3300025914 | Ga0207671_10418887 | Ga0207671_104188872 | 166 |
| 199 | 3300025915 | Ga0207693_10565027 | Ga0207693_105650272 | 166 |
| 200 | 3300025923 | Ga0207681_10000002 | Ga0207681_10000002151 | 166 |
| 201 | 3300025925 | Ga0207650_10009399 | Ga0207650_100093996 | 166 |
| 202 | 3300025928 | Ga0207700_10053074 | Ga0207700_100530742 | 166 |
| 203 | 3300025929 | Ga0207664_10100539 | Ga0207664_101005393 | 166 |
| 204 | 3300025931 | Ga0207644_10000002 | Ga0207644_10000002150 | 166 |
| 205 | 3300025941 | Ga0207711_10032876 | Ga0207711_100328766 | 166 |
| 206 | 3300025961 | Ga0207712_10072127 | Ga0207712_100721273 | 166 |
| 207 | 3300025972 | Ga0207668_10002116 | Ga0207668_100021168 | 166 |
| 208 | 3300025986 | Ga0207658_10008007 | Ga0207658_100080072 | 166 |
| 209 | 3300026035 | Ga0207703_10021210 | Ga0207703_100212105 | 166 |
| 210 | 3300026088 | Ga0207641_10004155 | Ga0207641_100041556 | 166 |
| 211 | 3300026095 | Ga0207676_10019455 | Ga0207676_100194555 | 166 |
| 212 | 3300026118 | Ga0207675_100000358 | Ga0207675_10000035819 | 166 |
| 213 | 3300028380 | Ga0268265_10000285 | Ga0268265_1000028553 | 166 |
| 214 | 3300028381 | Ga0268264_10000010 | Ga0268264_10000010368 | 166 |
| 215 | 3300031995 | Ga0307409_100718908 | Ga0307409_1007189082 | 166 |
| 216 | 3300046472 | Ga0495580_0510676 | Ga0495580_0510676_140_679 | 166 |
| 217 | 3300046535 | Ga0495586_0665819 | Ga0495586_0665819_75_584 | 166 |
| 218 | 3300049588 | Ga0501072_0169220 | Ga0501072_0169220_1212_1715 | 166 |
| 219 | 3300054114 | Ga0501084_1114708 | Ga0501084_1114708_15_518 | 166 |
| 220 | 3300009148 | Ga0105243_10241823 | Ga0105243_102418231 | 167 |
| 221 | 3300014326 | Ga0157380_10805219 | Ga0157380_108052192 | 167 |
| 222 | 3300025928 | Ga0207700_10958806 | Ga0207700_109588061 | 167 |
| 223 | 3300028800 | Ga0265338_10449290 | Ga0265338_104492902 | 167 |
| 224 | 3300031711 | Ga0265314_10257373 | Ga0265314_102573732 | 167 |
| 225 | 3300046460 | Ga0495638_0006875 | Ga0495638_0006875_4868_5374 | 167 |
| 226 | 3300046660 | Ga0495625_0002827 | Ga0495625_0002827_10998_11504 | 167 |
| 227 | 3300049663 | Ga0501223_016413 | Ga0501223_016413_880_1386 | 167 |
| 228 | 3300049686 | Ga0501257_000049 | Ga0501257_000049_11015_11521 | 167 |
| 229 | 3300049776 | Ga0501280_003193 | Ga0501280_003193_979_1485 | 167 |
| 230 | 3300046684 | Ga0495669_0383581 | Ga0495669_0383581_40_549 | 168 |
| 231 | 3300049574 | Ga0501038_0350647 | Ga0501038_0350647_237_743 | 168 |
| 232 | 3300049578 | Ga0501042_0030673 | Ga0501042_0030673_3283_3789 | 168 |
| 233 | 3300049578 | Ga0501042_0265696 | Ga0501042_0265696_717_1226 | 168 |
| 234 | 3300049579 | Ga0501043_0033445 | Ga0501043_0033445_2035_2541 | 168 |
| 235 | 3300049584 | Ga0501068_0019681 | Ga0501068_0019681_2570_3076 | 168 |
| 236 | 3300049590 | Ga0501074_0034186 | Ga0501074_0034186_2964_3470 | 168 |
| 237 | 3300049742 | Ga0501080_0494272 | Ga0501080_0494272_395_901 | 168 |
| 238 | 3300049743 | Ga0501081_0014256 | Ga0501081_0014256_2256_2762 | 168 |
| 239 | 3300049744 | Ga0501083_0167354 | Ga0501083_0167354_557_1063 | 168 |
| 240 | 3300050507 | nmdc:mga05p37_1308991_c1 | nmdc:mga05p37_1308991_c1_128_637 | 168 |
| 241 | 3300054114 | Ga0501084_0089771 | Ga0501084_0089771_566_1072 | 168 |
| 242 | 3300003316 | rootH1_10098898 | rootH1_100988982 | 169 |
| 243 | 3300005983 | Ga0081540_1006477 | Ga0081540_10064772 | 169 |
| 244 | 3300006844 | Ga0075428_100647968 | Ga0075428_1006479682 | 169 |
| 245 | 3300006846 | Ga0075430_100169822 | Ga0075430_1001698223 | 169 |
| 246 | 3300009147 | Ga0114129_10533555 | Ga0114129_105335552 | 169 |
| 247 | 3300010159 | Ga0099796_10102754 | Ga0099796_101027542 | 169 |
| 248 | 3300019188 | Ga0184599_122713 | Ga0184599_1227132 | 169 |
| 249 | 3300022730 | Ga0224570_100713 | Ga0224570_1007132 | 169 |
| 250 | 3300022734 | Ga0224571_108185 | Ga0224571_1081852 | 169 |
| 251 | 3300024225 | Ga0224572_1001411 | Ga0224572_10014112 | 169 |
| 252 | 3300028017 | Ga0265356_1000106 | Ga0265356_100010613 | 169 |
| 253 | 3300030760 | Ga0265762_1000561 | Ga0265762_10005616 | 169 |
| 254 | 3300031090 | Ga0265760_10000138 | Ga0265760_1000013817 | 169 |
| 255 | 3300033545 | Ga0316214_1010086 | Ga0316214_10100862 | 169 |
| 256 | 3300050507 | nmdc:mga05p37_985001_c1 | nmdc:mga05p37_985001_c1_197_718 | 169 |
| 257 | 3300050509 | nmdc:mga0qj67_344807_c1 | nmdc:mga0qj67_344807_c1_670_1191 | 169 |
| 258 | 3300050510 | nmdc:mga06r32_151484_c1 | nmdc:mga06r32_151484_c1_1044_1565 | 169 |
| 259 | 3300005544 | Ga0070686_100067493 | Ga0070686_1000674932 | 170 |
| 260 | 3300028800 | Ga0265338_10409311 | Ga0265338_104093112 | 170 |
| 261 | 3300031548 | Ga0307408_100315091 | Ga0307408_1003150912 | 170 |
| 262 | 3300031731 | Ga0307405_10106792 | Ga0307405_101067923 | 170 |
| 263 | 3300031824 | Ga0307413_10158479 | Ga0307413_101584793 | 170 |
| 264 | 3300032002 | Ga0307416_100040997 | Ga0307416_1000409974 | 170 |
| 265 | 3300032126 | Ga0307415_100920003 | Ga0307415_1009200032 | 170 |
| 266 | 3300035117 | Ga0373953_0006693 | Ga0373953_0006693_2772_3299 | 170 |
| 267 | 3300035119 | Ga0373956_0017451 | Ga0373956_0017451_860_1387 | 170 |
| 268 | 3300035692 | Ga0373935_0286418 | Ga0373935_0286418_231_758 | 170 |
| 269 | 3300035724 | Ga0373933_0044251 | Ga0373933_0044251_1475_2002 | 170 |
| 270 | 3300035725 | Ga0373947_0457156 | Ga0373947_0457156_10_537 | 170 |
| 271 | 3300037068 | Ga0373925_0448659 | Ga0373925_0448659_156_683 | 170 |
| 272 | 3300042125 | Ga0450923_006324 | Ga0450923_006324_80_595 | 170 |
| 273 | 3300046516 | Ga0495628_0296398 | Ga0495628_0296398_179_706 | 170 |
| 274 | 3300046517 | Ga0495630_0698000 | Ga0495630_0698000_34_561 | 170 |
| 275 | 3300046559 | Ga0495667_0581612 | Ga0495667_0581612_25_552 | 170 |
| 276 | 3300046689 | Ga0495613_0376463 | Ga0495613_0376463_78_605 | 170 |
| 277 | 3300047471 | Ga0495684_0394362 | Ga0495684_0394362_191_718 | 170 |
| 278 | 3300005353 | Ga0070669_100458512 | Ga0070669_1004585122 | 171 |
| 279 | 3300005365 | Ga0070688_100416387 | Ga0070688_1004163872 | 171 |
| 280 | 3300005441 | Ga0070700_100047121 | Ga0070700_1000471212 | 171 |
| 281 | 3300005719 | Ga0068861_100355457 | Ga0068861_1003554573 | 171 |
| 282 | 3300009147 | Ga0114129_10489451 | Ga0114129_104894513 | 171 |
| 283 | 3300021377 | Ga0213874_10012055 | Ga0213874_100120552 | 171 |
| 284 | 3300021384 | Ga0213876_10000170 | Ga0213876_1000017051 | 171 |
| 285 | 3300025917 | Ga0207660_10042023 | Ga0207660_100420233 | 171 |
| 286 | 3300025928 | Ga0207700_10746004 | Ga0207700_107460041 | 171 |
| 287 | 3300026075 | Ga0207708_10004449 | Ga0207708_100044497 | 171 |
| 288 | 3300039437 | Ga0436365_0727276 | Ga0436365_0727276_11966_12481 | 171 |
| 289 | 3300039450 | Ga0436363_1383154 | Ga0436363_1383154_1276_1791 | 171 |
| 290 | 3300005366 | Ga0070659_100377510 | Ga0070659_1003775102 | 172 |
| 291 | 3300049586 | Ga0501070_0088916 | Ga0501070_0088916_1880_2401 | 172 |
| 292 | 3300049593 | Ga0501077_0481386 | Ga0501077_0481386_130_654 | 172 |
| 293 | 3300049822 | Ga0501035_1312255 | Ga0501035_1312255_18_539 | 172 |
| 294 | 3300009553 | Ga0105249_10548810 | Ga0105249_105488102 | 173 |
| 295 | 3300031691 | Ga0316579_10007419 | Ga0316579_100074193 | 173 |
| 296 | 3300031733 | Ga0316577_10070205 | Ga0316577_100702053 | 173 |
| 297 | 3300032137 | Ga0316585_10066050 | Ga0316585_100660502 | 173 |
| 298 | 3300035725 | Ga0373947_0008668 | Ga0373947_0008668_3727_4254 | 173 |
| 299 | 3300037068 | Ga0373925_0481254 | Ga0373925_0481254_250_777 | 173 |
| 300 | 3300039450 | Ga0436363_1097911 | Ga0436363_1097911_219_746 | 173 |
| 301 | 3300046517 | Ga0495630_0345481 | Ga0495630_0345481_336_863 | 173 |
| 302 | 3300046533 | Ga0495640_0162308 | Ga0495640_0162308_569_1096 | 173 |
| 303 | 3300047322 | Ga0495680_0053349 | Ga0495680_0053349_1131_1658 | 173 |
| 304 | 3300050509 | nmdc:mga0qj67_714133_c1 | nmdc:mga0qj67_714133_c1_142_699 | 173 |
| 305 | 3300005937 | Ga0081455_10002652 | Ga0081455_100026524 | 174 |
| 306 | 3300005937 | Ga0081455_10022381 | Ga0081455_100223812 | 174 |
| 307 | 3300031247 | Ga0265340_10284351 | Ga0265340_102843511 | 174 |
| 308 | 3300048908 | Ga0496105_0007553 | Ga0496105_0007553_2612_3139 | 174 |
| 309 | 3300049569 | Ga0501032_0448185 | Ga0501032_0448185_143_670 | 174 |
| 310 | 3300049574 | Ga0501038_0281063 | Ga0501038_0281063_582_1109 | 174 |
| 311 | 3300049575 | Ga0501039_0178870 | Ga0501039_0178870_408_935 | 174 |
| 312 | 3300049576 | Ga0501040_0048788 | Ga0501040_0048788_2021_2548 | 174 |
| 313 | 3300049580 | Ga0501046_0145845 | Ga0501046_0145845_600_1127 | 174 |
| 314 | 3300049582 | Ga0501048_0024801 | Ga0501048_0024801_2702_3229 | 174 |
| 315 | 3300049583 | Ga0501067_0122570 | Ga0501067_0122570_175_699 | 174 |
| 316 | 3300049585 | Ga0501069_0390484 | Ga0501069_0390484_108_632 | 174 |
| 317 | 3300049587 | Ga0501071_0480137 | Ga0501071_0480137_185_712 | 174 |
| 318 | 3300049588 | Ga0501072_0189985 | Ga0501072_0189985_560_1087 | 174 |
| 319 | 3300049590 | Ga0501074_0053833 | Ga0501074_0053833_2103_2630 | 174 |
| 320 | 3300049591 | Ga0501075_0153568 | Ga0501075_0153568_503_1030 | 174 |
| 321 | 3300049592 | Ga0501076_0109907 | Ga0501076_0109907_1383_1910 | 174 |
| 322 | 3300049593 | Ga0501077_0021699 | Ga0501077_0021699_1223_1750 | 174 |
| 323 | 3300049742 | Ga0501080_0479382 | Ga0501080_0479382_559_1086 | 174 |
| 324 | 3300049824 | Ga0501045_0129989 | Ga0501045_0129989_67_594 | 174 |
| 325 | 3300054114 | Ga0501084_0630396 | Ga0501084_0630396_329_856 | 174 |
| 326 | 3300061734 | Ga0530510_0020861 | Ga0530510_0020861_3817_4344 | 174 |
| 327 | 3300006175 | Ga0070712_100154216 | Ga0070712_1001542161 | 175 |
| 328 | 3300009147 | Ga0114129_10270067 | Ga0114129_102700674 | 175 |
| 329 | 3300025906 | Ga0207699_10265829 | Ga0207699_102658292 | 175 |
| 330 | 3300025915 | Ga0207693_10303506 | Ga0207693_103035062 | 175 |
| 331 | 3300025939 | Ga0207665_10031996 | Ga0207665_100319962 | 175 |
| 332 | 3300035724 | Ga0373933_0345567 | Ga0373933_0345567_175_705 | 175 |
| 333 | 3300036401 | Ga0373937_0261545 | Ga0373937_0261545_350_880 | 175 |
| 334 | 3300048903 | Ga0496100_0382101 | Ga0496100_0382101_378_908 | 175 |
| 335 | 3300048905 | Ga0496102_0132003 | Ga0496102_0132003_255_785 | 175 |
| 336 | 3300048906 | Ga0496103_0469832 | Ga0496103_0469832_145_675 | 175 |
| 337 | 3300048908 | Ga0496105_0207283 | Ga0496105_0207283_737_1267 | 175 |
| 338 | 3300048910 | Ga0496107_0050542 | Ga0496107_0050542_2094_2624 | 175 |
| 339 | 3300048912 | Ga0496109_0452743 | Ga0496109_0452743_178_708 | 175 |
| 340 | 3300048916 | Ga0496113_0259290 | Ga0496113_0259290_563_1093 | 175 |
| 341 | 3300053084 | Ga0495595_0222568 | Ga0495595_0222568_138_668 | 175 |
| 342 | 3300001990 | JGI24737J22298_10015591 | JGI24737J22298_100155915 | 176 |
| 343 | 3300001991 | JGI24743J22301_10030376 | JGI24743J22301_100303762 | 176 |
| 344 | 3300002070 | JGI24750J21931_1001123 | JGI24750J21931_10011232 | 176 |
| 345 | 3300002073 | JGI24745J21846_1017478 | JGI24745J21846_10174782 | 176 |
| 346 | 3300005328 | Ga0070676_10001040 | Ga0070676_1000104012 | 176 |
| 347 | 3300005329 | Ga0070683_100079541 | Ga0070683_1000795413 | 176 |
| 348 | 3300005330 | Ga0070690_100060456 | Ga0070690_1000604563 | 176 |
| 349 | 3300005331 | Ga0070670_100003994 | Ga0070670_1000039944 | 176 |
| 350 | 3300005334 | Ga0068869_100877632 | Ga0068869_1008776321 | 176 |
| 351 | 3300005335 | Ga0070666_10372063 | Ga0070666_103720632 | 176 |
| 352 | 3300005337 | Ga0070682_100014187 | Ga0070682_1000141876 | 176 |
| 353 | 3300005338 | Ga0068868_100011581 | Ga0068868_1000115812 | 176 |
| 354 | 3300005339 | Ga0070660_100015280 | Ga0070660_1000152805 | 176 |
| 355 | 3300005340 | Ga0070689_100000219 | Ga0070689_10000021914 | 176 |
| 356 | 3300005340 | Ga0070689_100022362 | Ga0070689_1000223625 | 176 |
| 357 | 3300005341 | Ga0070691_10000775 | Ga0070691_100007756 | 176 |
| 358 | 3300005344 | Ga0070661_100000383 | Ga0070661_10000038315 | 176 |
| 359 | 3300005345 | Ga0070692_10000953 | Ga0070692_100009532 | 176 |
| 360 | 3300005347 | Ga0070668_100002203 | Ga0070668_10000220313 | 176 |
| 361 | 3300005347 | Ga0070668_100774343 | Ga0070668_1007743431 | 176 |
| 362 | 3300005353 | Ga0070669_100003604 | Ga0070669_10000360413 | 176 |
| 363 | 3300005354 | Ga0070675_100005782 | Ga0070675_1000057823 | 176 |
| 364 | 3300005355 | Ga0070671_100001149 | Ga0070671_10000114912 | 176 |
| 365 | 3300005356 | Ga0070674_100017247 | Ga0070674_1000172473 | 176 |
| 366 | 3300005364 | Ga0070673_100233477 | Ga0070673_1002334772 | 176 |
| 367 | 3300005365 | Ga0070688_100001435 | Ga0070688_10000143514 | 176 |
| 368 | 3300005366 | Ga0070659_100549679 | Ga0070659_1005496791 | 176 |
| 369 | 3300005366 | Ga0070659_100807902 | Ga0070659_1008079021 | 176 |
| 370 | 3300005367 | Ga0070667_100006317 | Ga0070667_1000063172 | 176 |
| 371 | 3300005406 | Ga0070703_10013427 | Ga0070703_100134272 | 176 |
| 372 | 3300005434 | Ga0070709_10017423 | Ga0070709_100174235 | 176 |
| 373 | 3300005435 | Ga0070714_100003382 | Ga0070714_1000033822 | 176 |
| 374 | 3300005437 | Ga0070710_10006473 | Ga0070710_100064734 | 176 |
| 375 | 3300005438 | Ga0070701_10001291 | Ga0070701_100012917 | 176 |
| 376 | 3300005439 | Ga0070711_100000201 | Ga0070711_10000020128 | 176 |
| 377 | 3300005439 | Ga0070711_100263488 | Ga0070711_1002634882 | 176 |
| 378 | 3300005440 | Ga0070705_100001686 | Ga0070705_10000168620 | 176 |
| 379 | 3300005444 | Ga0070694_100015238 | Ga0070694_1000152381 | 176 |
| 380 | 3300005455 | Ga0070663_100000190 | Ga0070663_10000019014 | 176 |
| 381 | 3300005455 | Ga0070663_100397458 | Ga0070663_1003974582 | 176 |
| 382 | 3300005456 | Ga0070678_100002392 | Ga0070678_1000023925 | 176 |
| 383 | 3300005457 | Ga0070662_100553074 | Ga0070662_1005530742 | 176 |
| 384 | 3300005458 | Ga0070681_10086875 | Ga0070681_100868753 | 176 |
| 385 | 3300005459 | Ga0068867_100043246 | Ga0068867_1000432464 | 176 |
| 386 | 3300005466 | Ga0070685_10004770 | Ga0070685_100047705 | 176 |
| 387 | 3300005518 | Ga0070699_100042983 | Ga0070699_1000429835 | 176 |
| 388 | 3300005535 | Ga0070684_100031953 | Ga0070684_1000319537 | 176 |
| 389 | 3300005536 | Ga0070697_100003155 | Ga0070697_1000031556 | 176 |
| 390 | 3300005539 | Ga0068853_100000460 | Ga0068853_10000046019 | 176 |
| 391 | 3300005543 | Ga0070672_100000564 | Ga0070672_1000005642 | 176 |
| 392 | 3300005543 | Ga0070672_100279077 | Ga0070672_1002790772 | 176 |
| 393 | 3300005544 | Ga0070686_100000306 | Ga0070686_10000030628 | 176 |
| 394 | 3300005545 | Ga0070695_100002867 | Ga0070695_10000286717 | 176 |
| 395 | 3300005545 | Ga0070695_100269421 | Ga0070695_1002694213 | 176 |
| 396 | 3300005546 | Ga0070696_100010206 | Ga0070696_1000102066 | 176 |
| 397 | 3300005547 | Ga0070693_100002707 | Ga0070693_1000027071 | 176 |
| 398 | 3300005548 | Ga0070665_100060733 | Ga0070665_1000607331 | 176 |
| 399 | 3300005549 | Ga0070704_100001638 | Ga0070704_10000163820 | 176 |
| 400 | 3300005563 | Ga0068855_100004155 | Ga0068855_10000415515 | 176 |
| 401 | 3300005564 | Ga0070664_100063935 | Ga0070664_1000639353 | 176 |
| 402 | 3300005577 | Ga0068857_100000318 | Ga0068857_1000003186 | 176 |
| 403 | 3300005578 | Ga0068854_100034996 | Ga0068854_1000349963 | 176 |
| 404 | 3300005578 | Ga0068854_100235688 | Ga0068854_1002356882 | 176 |
| 405 | 3300005614 | Ga0068856_100030353 | Ga0068856_1000303533 | 176 |
| 406 | 3300005615 | Ga0070702_100004629 | Ga0070702_1000046292 | 176 |
| 407 | 3300005616 | Ga0068852_100107155 | Ga0068852_1001071551 | 176 |
| 408 | 3300005617 | Ga0068859_100004533 | Ga0068859_10000453310 | 176 |
| 409 | 3300005617 | Ga0068859_100538034 | Ga0068859_1005380342 | 176 |
| 410 | 3300005618 | Ga0068864_100211910 | Ga0068864_1002119102 | 176 |
| 411 | 3300005718 | Ga0068866_10000636 | Ga0068866_1000063612 | 176 |
| 412 | 3300005718 | Ga0068866_10052166 | Ga0068866_100521662 | 176 |
| 413 | 3300005719 | Ga0068861_100000277 | Ga0068861_10000027724 | 176 |
| 414 | 3300005719 | Ga0068861_100085472 | Ga0068861_1000854722 | 176 |
| 415 | 3300005719 | Ga0068861_100611348 | Ga0068861_1006113481 | 176 |
| 416 | 3300005834 | Ga0068851_10034206 | Ga0068851_100342063 | 176 |
| 417 | 3300005841 | Ga0068863_100000968 | Ga0068863_10000096824 | 176 |
| 418 | 3300005842 | Ga0068858_100006243 | Ga0068858_1000062435 | 176 |
| 419 | 3300005842 | Ga0068858_100038583 | Ga0068858_1000385836 | 176 |
| 420 | 3300005843 | Ga0068860_100027086 | Ga0068860_1000270867 | 176 |
| 421 | 3300005844 | Ga0068862_100022138 | Ga0068862_1000221382 | 176 |
| 422 | 3300005844 | Ga0068862_100723671 | Ga0068862_1007236711 | 176 |
| 423 | 3300006163 | Ga0070715_10001080 | Ga0070715_1000108012 | 176 |
| 424 | 3300006173 | Ga0070716_100007391 | Ga0070716_1000073919 | 176 |
| 425 | 3300006175 | Ga0070712_100000840 | Ga0070712_10000084010 | 176 |
| 426 | 3300006237 | Ga0097621_100032862 | Ga0097621_1000328623 | 176 |
| 427 | 3300006881 | Ga0068865_100018469 | Ga0068865_1000184696 | 176 |
| 428 | 3300006881 | Ga0068865_100097171 | Ga0068865_1000971712 | 176 |
| 429 | 3300006931 | Ga0097620_100004533 | Ga0097620_10000453310 | 176 |
| 430 | 3300006931 | Ga0097620_100538056 | Ga0097620_1005380562 | 176 |
| 431 | 3300009092 | Ga0105250_10004823 | Ga0105250_100048235 | 176 |
| 432 | 3300009093 | Ga0105240_10072847 | Ga0105240_100728472 | 176 |
| 433 | 3300009098 | Ga0105245_10004696 | Ga0105245_1000469617 | 176 |
| 434 | 3300009101 | Ga0105247_10000361 | Ga0105247_1000036135 | 176 |
| 435 | 3300009101 | Ga0105247_10066081 | Ga0105247_100660812 | 176 |
| 436 | 3300009147 | Ga0114129_10193369 | Ga0114129_101933692 | 176 |
| 437 | 3300009147 | Ga0114129_12478275 | Ga0114129_124782751 | 176 |
| 438 | 3300009148 | Ga0105243_10001606 | Ga0105243_100016063 | 176 |
| 439 | 3300009148 | Ga0105243_10055222 | Ga0105243_100552224 | 176 |
| 440 | 3300009148 | Ga0105243_10262925 | Ga0105243_102629252 | 176 |
| 441 | 3300009174 | Ga0105241_10001291 | Ga0105241_100012918 | 176 |
| 442 | 3300009176 | Ga0105242_10020157 | Ga0105242_100201577 | 176 |
| 443 | 3300009177 | Ga0105248_10000586 | Ga0105248_1000058610 | 176 |
| 444 | 3300009177 | Ga0105248_10146582 | Ga0105248_101465823 | 176 |
| 445 | 3300009545 | Ga0105237_10003139 | Ga0105237_100031392 | 176 |
| 446 | 3300009551 | Ga0105238_10118083 | Ga0105238_101180833 | 176 |
| 447 | 3300009553 | Ga0105249_10181812 | Ga0105249_101818122 | 176 |
| 448 | 3300010375 | Ga0105239_10107980 | Ga0105239_101079802 | 176 |
| 449 | 3300011119 | Ga0105246_10000208 | Ga0105246_100002086 | 176 |
| 450 | 3300011119 | Ga0105246_10152973 | Ga0105246_101529733 | 176 |
| 451 | 3300013102 | Ga0157371_10007923 | Ga0157371_100079237 | 176 |
| 452 | 3300013105 | Ga0157369_10021041 | Ga0157369_100210417 | 176 |
| 453 | 3300013296 | Ga0157374_10034884 | Ga0157374_100348843 | 176 |
| 454 | 3300013297 | Ga0157378_10000452 | Ga0157378_1000045227 | 176 |
| 455 | 3300013297 | Ga0157378_10048564 | Ga0157378_100485644 | 176 |
| 456 | 3300013297 | Ga0157378_10062694 | Ga0157378_100626944 | 176 |
| 457 | 3300013306 | Ga0163162_10002876 | Ga0163162_100028766 | 176 |
| 458 | 3300013307 | Ga0157372_10000529 | Ga0157372_1000052915 | 176 |
| 459 | 3300013307 | Ga0157372_10391804 | Ga0157372_103918042 | 176 |
| 460 | 3300013308 | Ga0157375_10001554 | Ga0157375_1000155410 | 176 |
| 461 | 3300013308 | Ga0157375_10002784 | Ga0157375_1000278414 | 176 |
| 462 | 3300014325 | Ga0163163_10009295 | Ga0163163_100092952 | 176 |
| 463 | 3300014326 | Ga0157380_10019453 | Ga0157380_100194533 | 176 |
| 464 | 3300014326 | Ga0157380_10178296 | Ga0157380_101782962 | 176 |
| 465 | 3300014326 | Ga0157380_10770853 | Ga0157380_107708532 | 176 |
| 466 | 3300014745 | Ga0157377_10159268 | Ga0157377_101592683 | 176 |
| 467 | 3300014968 | Ga0157379_10020462 | Ga0157379_100204625 | 176 |
| 468 | 3300014968 | Ga0157379_10048156 | Ga0157379_100481562 | 176 |
| 469 | 3300014969 | Ga0157376_10517878 | Ga0157376_105178782 | 176 |
| 470 | 3300014969 | Ga0157376_10668246 | Ga0157376_106682462 | 176 |
| 471 | 3300017792 | Ga0163161_10000549 | Ga0163161_1000054933 | 176 |
| 472 | 3300017792 | Ga0163161_10168203 | Ga0163161_101682032 | 176 |
| 473 | 3300025315 | Ga0207697_10153956 | Ga0207697_101539562 | 176 |
| 474 | 3300025321 | Ga0207656_10071398 | Ga0207656_100713982 | 176 |
| 475 | 3300025885 | Ga0207653_10044388 | Ga0207653_100443882 | 176 |
| 476 | 3300025898 | Ga0207692_10007121 | Ga0207692_100071217 | 176 |
| 477 | 3300025899 | Ga0207642_10012479 | Ga0207642_100124793 | 176 |
| 478 | 3300025900 | Ga0207710_10299210 | Ga0207710_102992102 | 176 |
| 479 | 3300025901 | Ga0207688_10017490 | Ga0207688_100174903 | 176 |
| 480 | 3300025901 | Ga0207688_10270112 | Ga0207688_102701122 | 176 |
| 481 | 3300025905 | Ga0207685_10013786 | Ga0207685_100137863 | 176 |
| 482 | 3300025906 | Ga0207699_10014321 | Ga0207699_100143211 | 176 |
| 483 | 3300025907 | Ga0207645_10009805 | Ga0207645_100098052 | 176 |
| 484 | 3300025908 | Ga0207643_10236117 | Ga0207643_102361172 | 176 |
| 485 | 3300025911 | Ga0207654_10031516 | Ga0207654_100315162 | 176 |
| 486 | 3300025912 | Ga0207707_10331884 | Ga0207707_103318841 | 176 |
| 487 | 3300025915 | Ga0207693_10000247 | Ga0207693_1000024742 | 176 |
| 488 | 3300025916 | Ga0207663_10002489 | Ga0207663_100024897 | 176 |
| 489 | 3300025916 | Ga0207663_10156668 | Ga0207663_101566683 | 176 |
| 490 | 3300025916 | Ga0207663_10325658 | Ga0207663_103256581 | 176 |
| 491 | 3300025919 | Ga0207657_10000257 | Ga0207657_1000025753 | 176 |
| 492 | 3300025919 | Ga0207657_10478530 | Ga0207657_104785302 | 176 |
| 493 | 3300025920 | Ga0207649_10010986 | Ga0207649_100109861 | 176 |
| 494 | 3300025923 | Ga0207681_10021983 | Ga0207681_100219832 | 176 |
| 495 | 3300025925 | Ga0207650_10807430 | Ga0207650_108074301 | 176 |
| 496 | 3300025927 | Ga0207687_10166359 | Ga0207687_101663591 | 176 |
| 497 | 3300025929 | Ga0207664_10086794 | Ga0207664_100867944 | 176 |
| 498 | 3300025931 | Ga0207644_10006496 | Ga0207644_100064967 | 176 |
| 499 | 3300025932 | Ga0207690_10001995 | Ga0207690_1000199512 | 176 |
| 500 | 3300025933 | Ga0207706_10000691 | Ga0207706_1000069124 | 176 |
| 501 | 3300025934 | Ga0207686_10812250 | Ga0207686_108122502 | 176 |
| 502 | 3300025935 | Ga0207709_10300832 | Ga0207709_103008322 | 176 |
| 503 | 3300025936 | Ga0207670_10377552 | Ga0207670_103775521 | 176 |
| 504 | 3300025936 | Ga0207670_11168598 | Ga0207670_111685981 | 176 |
| 505 | 3300025937 | Ga0207669_10135004 | Ga0207669_101350041 | 176 |
| 506 | 3300025938 | Ga0207704_10127650 | Ga0207704_101276503 | 176 |
| 507 | 3300025938 | Ga0207704_10513086 | Ga0207704_105130862 | 176 |
| 508 | 3300025938 | Ga0207704_11103402 | Ga0207704_111034021 | 176 |
| 509 | 3300025939 | Ga0207665_10001185 | Ga0207665_100011858 | 176 |
| 510 | 3300025940 | Ga0207691_10000483 | Ga0207691_1000048324 | 176 |
| 511 | 3300025941 | Ga0207711_10039646 | Ga0207711_100396464 | 176 |
| 512 | 3300025941 | Ga0207711_10691037 | Ga0207711_106910371 | 176 |
| 513 | 3300025941 | Ga0207711_10846935 | Ga0207711_108469352 | 176 |
| 514 | 3300025942 | Ga0207689_10218204 | Ga0207689_102182042 | 176 |
| 515 | 3300025944 | Ga0207661_10104705 | Ga0207661_101047052 | 176 |
| 516 | 3300025949 | Ga0207667_10006761 | Ga0207667_100067612 | 176 |
| 517 | 3300025960 | Ga0207651_10001838 | Ga0207651_100018385 | 176 |
| 518 | 3300025961 | Ga0207712_10152496 | Ga0207712_101524962 | 176 |
| 519 | 3300025961 | Ga0207712_10226545 | Ga0207712_102265451 | 176 |
| 520 | 3300025961 | Ga0207712_10317048 | Ga0207712_103170481 | 176 |
| 521 | 3300025972 | Ga0207668_10673288 | Ga0207668_106732881 | 176 |
| 522 | 3300025981 | Ga0207640_10004266 | Ga0207640_100042663 | 176 |
| 523 | 3300025986 | Ga0207658_10354415 | Ga0207658_103544152 | 176 |
| 524 | 3300026023 | Ga0207677_10018797 | Ga0207677_100187975 | 176 |
| 525 | 3300026035 | Ga0207703_10041614 | Ga0207703_100416142 | 176 |
| 526 | 3300026041 | Ga0207639_10002595 | Ga0207639_100025956 | 176 |
| 527 | 3300026067 | Ga0207678_10000401 | Ga0207678_1000040142 | 176 |
| 528 | 3300026067 | Ga0207678_10248453 | Ga0207678_102484531 | 176 |
| 529 | 3300026075 | Ga0207708_10000809 | Ga0207708_100008093 | 176 |
| 530 | 3300026075 | Ga0207708_10117281 | Ga0207708_101172812 | 176 |
| 531 | 3300026078 | Ga0207702_10350748 | Ga0207702_103507482 | 176 |
| 532 | 3300026088 | Ga0207641_10009456 | Ga0207641_100094562 | 176 |
| 533 | 3300026095 | Ga0207676_10157705 | Ga0207676_101577053 | 176 |
| 534 | 3300026116 | Ga0207674_10000524 | Ga0207674_1000052456 | 176 |
| 535 | 3300026118 | Ga0207675_100000908 | Ga0207675_10000090827 | 176 |
| 536 | 3300026121 | Ga0207683_10000416 | Ga0207683_1000041637 | 176 |
| 537 | 3300026121 | Ga0207683_10495966 | Ga0207683_104959661 | 176 |
| 538 | 3300026142 | Ga0207698_10003521 | Ga0207698_100035212 | 176 |
| 539 | 3300027876 | Ga0209974_10135792 | Ga0209974_101357922 | 176 |
| 540 | 3300028379 | Ga0268266_10013221 | Ga0268266_100132214 | 176 |
| 541 | 3300028379 | Ga0268266_10704654 | Ga0268266_107046542 | 176 |
| 542 | 3300028380 | Ga0268265_10114864 | Ga0268265_101148643 | 176 |
| 543 | 3300028380 | Ga0268265_11071370 | Ga0268265_110713701 | 176 |
| 544 | 3300031727 | Ga0316576_10045262 | Ga0316576_100452621 | 176 |
| 545 | 3300031733 | Ga0316577_10023237 | Ga0316577_100232372 | 176 |
| 546 | 3300032137 | Ga0316585_10148503 | Ga0316585_101485031 | 176 |
| 547 | 3300032139 | Ga0316580_10051043 | Ga0316580_100510433 | 176 |
| 548 | 3300032168 | Ga0316593_10004898 | Ga0316593_100048982 | 176 |
| 549 | 3300033524 | Ga0316592_1007181 | Ga0316592_10071812 | 176 |
| 550 | 3300033527 | Ga0316586_1009168 | Ga0316586_10091682 | 176 |
| 551 | 3300033528 | Ga0316588_1001383 | Ga0316588_10013832 | 176 |
| 552 | 3300033541 | Ga0316596_1001165 | Ga0316596_10011652 | 176 |
| 553 | 3300035084 | Ga0373928_0083708 | Ga0373928_0083708_165_695 | 176 |
| 554 | 3300035121 | Ga0373960_0288849 | Ga0373960_0288849_35_565 | 176 |
| 555 | 3300035241 | Ga0373961_0080981 | Ga0373961_0080981_195_728 | 176 |
| 556 | 3300035242 | Ga0373962_0026994 | Ga0373962_0026994_869_1399 | 176 |
| 557 | 3300035242 | Ga0373962_0067231 | Ga0373962_0067231_462_995 | 176 |
| 558 | 3300035691 | Ga0373931_0014158 | Ga0373931_0014158_1828_2361 | 176 |
| 559 | 3300035691 | Ga0373931_0147562 | Ga0373931_0147562_674_1204 | 176 |
| 560 | 3300036401 | Ga0373937_0304942 | Ga0373937_0304942_609_1142 | 176 |
| 561 | 3300036647 | Ga0316582_0473648 | Ga0316582_0473648_161_694 | 176 |
| 562 | 3300036712 | Ga0316584_0088745 | Ga0316584_0088745_1392_1970 | 176 |
| 563 | 3300037588 | Ga0316581_0005411 | Ga0316581_0005411_49_582 | 176 |
| 564 | 3300046519 | Ga0495632_0100628 | Ga0495632_0100628_592_1125 | 176 |
| 565 | 3300048903 | Ga0496100_0005125 | Ga0496100_0005125_2975_3511 | 176 |
| 566 | 3300048903 | Ga0496100_0276401 | Ga0496100_0276401_341_871 | 176 |
| 567 | 3300048904 | Ga0496101_0001893 | Ga0496101_0001893_2010_2546 | 176 |
| 568 | 3300048904 | Ga0496101_0104180 | Ga0496101_0104180_1558_2088 | 176 |
| 569 | 3300048904 | Ga0496101_0202464 | Ga0496101_0202464_831_1364 | 176 |
| 570 | 3300048905 | Ga0496102_0015717 | Ga0496102_0015717_5103_5633 | 176 |
| 571 | 3300048905 | Ga0496102_1449739 | Ga0496102_1449739_21_554 | 176 |
| 572 | 3300048906 | Ga0496103_0049012 | Ga0496103_0049012_470_1000 | 176 |
| 573 | 3300048906 | Ga0496103_0320145 | Ga0496103_0320145_356_892 | 176 |
| 574 | 3300048907 | Ga0496104_0059705 | Ga0496104_0059705_280_816 | 176 |
| 575 | 3300048907 | Ga0496104_0411474 | Ga0496104_0411474_316_846 | 176 |
| 576 | 3300048908 | Ga0496105_0058866 | Ga0496105_0058866_2110_2640 | 176 |
| 577 | 3300048909 | Ga0496106_0009062 | Ga0496106_0009062_1703_2239 | 176 |
| 578 | 3300048909 | Ga0496106_0017862 | Ga0496106_0017862_1090_1620 | 176 |
| 579 | 3300048910 | Ga0496107_0008324 | Ga0496107_0008324_1558_2088 | 176 |
| 580 | 3300048910 | Ga0496107_0026595 | Ga0496107_0026595_1185_1721 | 176 |
| 581 | 3300048910 | Ga0496107_0640021 | Ga0496107_0640021_56_589 | 176 |
| 582 | 3300048911 | Ga0496108_0016792 | Ga0496108_0016792_5348_5884 | 176 |
| 583 | 3300048911 | Ga0496108_0033905 | Ga0496108_0033905_3671_4201 | 176 |
| 584 | 3300048912 | Ga0496109_0061915 | Ga0496109_0061915_2847_3380 | 176 |
| 585 | 3300048912 | Ga0496109_0068799 | Ga0496109_0068799_1541_2077 | 176 |
| 586 | 3300048912 | Ga0496109_0078049 | Ga0496109_0078049_722_1261 | 176 |
| 587 | 3300048912 | Ga0496109_0215061 | Ga0496109_0215061_188_718 | 176 |
| 588 | 3300048913 | Ga0496110_0048322 | Ga0496110_0048322_1090_1620 | 176 |
| 589 | 3300048914 | Ga0496111_0031303 | Ga0496111_0031303_3040_3573 | 176 |
| 590 | 3300048914 | Ga0496111_0284031 | Ga0496111_0284031_531_1061 | 176 |
| 591 | 3300048915 | Ga0496112_0237663 | Ga0496112_0237663_406_945 | 176 |
| 592 | 3300048915 | Ga0496112_0350550 | Ga0496112_0350550_419_949 | 176 |
| 593 | 3300048915 | Ga0496112_0402900 | Ga0496112_0402900_296_829 | 176 |
| 594 | 3300048916 | Ga0496113_0003818 | Ga0496113_0003818_6605_7135 | 176 |
| 595 | 3300048916 | Ga0496113_0056366 | Ga0496113_0056366_1215_1754 | 176 |
| 596 | 3300048917 | Ga0496114_0001346 | Ga0496114_0001346_7310_7840 | 176 |
| 597 | 3300048917 | Ga0496114_0009187 | Ga0496114_0009187_3379_3915 | 176 |
| 598 | 3300048918 | Ga0496115_0005692 | Ga0496115_0005692_2710_3246 | 176 |
| 599 | 3300048918 | Ga0496115_0016931 | Ga0496115_0016931_4515_5045 | 176 |
| 600 | 3300049568 | Ga0501031_0207411 | Ga0501031_0207411_523_1056 | 176 |
| 601 | 3300049569 | Ga0501032_0251252 | Ga0501032_0251252_205_738 | 176 |
| 602 | 3300049572 | Ga0501036_0048606 | Ga0501036_0048606_1451_1984 | 176 |
| 603 | 3300049572 | Ga0501036_0244803 | Ga0501036_0244803_550_1089 | 176 |
| 604 | 3300049573 | Ga0501037_0119993 | Ga0501037_0119993_128_661 | 176 |
| 605 | 3300049574 | Ga0501038_0370607 | Ga0501038_0370607_149_688 | 176 |
| 606 | 3300049574 | Ga0501038_0564483 | Ga0501038_0564483_210_743 | 176 |
| 607 | 3300049575 | Ga0501039_0040919 | Ga0501039_0040919_2288_2827 | 176 |
| 608 | 3300049575 | Ga0501039_1173632 | Ga0501039_1173632_10_543 | 176 |
| 609 | 3300049576 | Ga0501040_0024388 | Ga0501040_0024388_420_953 | 176 |
| 610 | 3300049576 | Ga0501040_0086191 | Ga0501040_0086191_823_1362 | 176 |
| 611 | 3300049576 | Ga0501040_0219856 | Ga0501040_0219856_487_1020 | 176 |
| 612 | 3300049577 | Ga0501041_0043223 | Ga0501041_0043223_74_607 | 176 |
| 613 | 3300049577 | Ga0501041_0080038 | Ga0501041_0080038_924_1457 | 176 |
| 614 | 3300049577 | Ga0501041_0217621 | Ga0501041_0217621_112_645 | 176 |
| 615 | 3300049578 | Ga0501042_0157480 | Ga0501042_0157480_743_1276 | 176 |
| 616 | 3300049582 | Ga0501048_0386469 | Ga0501048_0386469_421_954 | 176 |
| 617 | 3300049582 | Ga0501048_0726809 | Ga0501048_0726809_77_661 | 176 |
| 618 | 3300049584 | Ga0501068_0132331 | Ga0501068_0132331_297_830 | 176 |
| 619 | 3300049584 | Ga0501068_0203870 | Ga0501068_0203870_250_780 | 176 |
| 620 | 3300049584 | Ga0501068_0345448 | Ga0501068_0345448_315_854 | 176 |
| 621 | 3300049585 | Ga0501069_0155722 | Ga0501069_0155722_96_629 | 176 |
| 622 | 3300049586 | Ga0501070_0384210 | Ga0501070_0384210_406_939 | 176 |
| 623 | 3300049586 | Ga0501070_0731826 | Ga0501070_0731826_45_656 | 176 |
| 624 | 3300049587 | Ga0501071_0013681 | Ga0501071_0013681_984_1517 | 176 |
| 625 | 3300049587 | Ga0501071_0135334 | Ga0501071_0135334_367_906 | 176 |
| 626 | 3300049588 | Ga0501072_0135146 | Ga0501072_0135146_658_1191 | 176 |
| 627 | 3300049588 | Ga0501072_0202070 | Ga0501072_0202070_847_1380 | 176 |
| 628 | 3300049589 | Ga0501073_0096334 | Ga0501073_0096334_1105_1644 | 176 |
| 629 | 3300049589 | Ga0501073_0170054 | Ga0501073_0170054_804_1337 | 176 |
| 630 | 3300049590 | Ga0501074_0074625 | Ga0501074_0074625_1220_1753 | 176 |
| 631 | 3300049590 | Ga0501074_0144260 | Ga0501074_0144260_695_1234 | 176 |
| 632 | 3300049590 | Ga0501074_0414554 | Ga0501074_0414554_70_603 | 176 |
| 633 | 3300049591 | Ga0501075_0049908 | Ga0501075_0049908_251_784 | 176 |
| 634 | 3300049591 | Ga0501075_0155406 | Ga0501075_0155406_571_1104 | 176 |
| 635 | 3300049591 | Ga0501075_0185357 | Ga0501075_0185357_374_907 | 176 |
| 636 | 3300049591 | Ga0501075_0489062 | Ga0501075_0489062_351_881 | 176 |
| 637 | 3300049591 | Ga0501075_0628530 | Ga0501075_0628530_22_558 | 176 |
| 638 | 3300049592 | Ga0501076_0054516 | Ga0501076_0054516_121_654 | 176 |
| 639 | 3300049592 | Ga0501076_0082714 | Ga0501076_0082714_129_662 | 176 |
| 640 | 3300049592 | Ga0501076_0128252 | Ga0501076_0128252_644_1183 | 176 |
| 641 | 3300049593 | Ga0501077_0196766 | Ga0501077_0196766_546_1079 | 176 |
| 642 | 3300049593 | Ga0501077_0689104 | Ga0501077_0689104_70_603 | 176 |
| 643 | 3300049741 | Ga0501079_0023514 | Ga0501079_0023514_1785_2318 | 176 |
| 644 | 3300049741 | Ga0501079_0051324 | Ga0501079_0051324_1623_2156 | 176 |
| 645 | 3300049741 | Ga0501079_0189395 | Ga0501079_0189395_322_855 | 176 |
| 646 | 3300049741 | Ga0501079_0219683 | Ga0501079_0219683_777_1313 | 176 |
| 647 | 3300049741 | Ga0501079_0483561 | Ga0501079_0483561_380_916 | 176 |
| 648 | 3300049743 | Ga0501081_0049240 | Ga0501081_0049240_273_806 | 176 |
| 649 | 3300049743 | Ga0501081_0142454 | Ga0501081_0142454_1076_1609 | 176 |
| 650 | 3300049743 | Ga0501081_0430447 | Ga0501081_0430447_123_656 | 176 |
| 651 | 3300049744 | Ga0501083_0122823 | Ga0501083_0122823_606_1139 | 176 |
| 652 | 3300049822 | Ga0501035_0049109 | Ga0501035_0049109_1398_1931 | 176 |
| 653 | 3300049824 | Ga0501045_0068718 | Ga0501045_0068718_1292_1831 | 176 |
| 654 | 3300049824 | Ga0501045_0108826 | Ga0501045_0108826_985_1518 | 176 |
| 655 | 3300050507 | nmdc:mga05p37_68872_c1 | nmdc:mga05p37_68872_c1_1894_2427 | 176 |
| 656 | 3300050511 | nmdc:mga08y16_606268_c1 | nmdc:mga08y16_606268_c1_362_895 | 176 |
| 657 | 3300054114 | Ga0501084_0016279 | Ga0501084_0016279_4480_5013 | 176 |
| 658 | 3300054114 | Ga0501084_0028319 | Ga0501084_0028319_354_887 | 176 |
| 659 | 3300054114 | Ga0501084_0105129 | Ga0501084_0105129_1349_1888 | 176 |
| 660 | 3300054114 | Ga0501084_0237332 | Ga0501084_0237332_238_771 | 176 |
| 661 | 3300060353 | Ga0501082_0103385 | Ga0501082_0103385_483_1016 | 176 |
| 662 | 3300060353 | Ga0501082_0182484 | Ga0501082_0182484_930_1463 | 176 |
| 663 | 3300061734 | Ga0530510_0011636 | Ga0530510_0011636_4844_5377 | 176 |
| 664 | 3300061734 | Ga0530510_0119994 | Ga0530510_0119994_406_939 | 176 |
| 665 | 3300061734 | Ga0530510_0139243 | Ga0530510_0139243_486_1025 | 176 |
| 666 | 3300061734 | Ga0530510_0406922 | Ga0530510_0406922_243_776 | 176 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8p6m-assembly1.cif.gz_B | arsenate reductase (arsc2) from deinococcus indicus | 0.9478 | 9 | 147 |
| 8p6m-assembly1.cif.gz_A | arsenate reductase (arsc2) from deinococcus indicus | 0.9272 | 9 | 146 |
| 8p6m-assembly1.cif.gz_B | arsenate reductase (arsc2) from deinococcus indicus | 0.9271 | 9 | 147 |
| 8p5n-assembly2.cif.gz_B | arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate | 0.8992 | 9 | 147 |
| 1z2d-assembly1.cif.gz_A | solution structure of bacillus subtilis arsc in reduced state | 0.8953 | 8 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jl3B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8911 | 8 | 145 | 3.40.50.2300 |
| 1jl3C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8796 | 10 | 145 | 3.40.50.2300 |
| 1jl3B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8609 | 8 | 145 | 3.40.50.2300 |
| 1y1lA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8585 | 11 | 147 | 3.40.50.2300 |
| 1y1lA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8456 | 11 | 147 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A434U3P1-F1-model_v4 | Arsenate reductase ArsC | 0.9905 | 8 | 166 |
GO:0004726
GO:0030946 GO:0046685 GO:0140793 |
| AF-A0A1F4ARG2-F1-model_v4 | Phosphotyrosine protein phosphatase I domain-containing protein | 0.9883 | 8 | 170 |
GO:0004726
GO:0030946 GO:0046685 GO:0140793 |
| AF-A0A6G6WN77-F1-model_v4 | Arsenate reductase ArsC | 0.9881 | 5 | 167 |
GO:0004726
GO:0030946 GO:0046685 GO:0140793 |
| AF-A0A1Q3JQI2-F1-model_v4 | ArsR family transcriptional regulator | 0.988 | 8 | 148 |
GO:0004726
GO:0030946 GO:0046685 GO:0140793 |
| AF-A0A1X6ZFU8-F1-model_v4 | Protein ArsC (EC 3.1.3.48) | 0.9878 | 8 | 168 |
GO:0004726
GO:0030946 GO:0046685 GO:0140793 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar