F474015

General Info

Members Datasets Scaffolds Average Seq Length
669 295 668 286

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10199094|Ga0207678_101990942
Length 328
Sequence MHTTISSPAKTVTIGHDQPFAIIGERINPTGRAKFQRQLRDGDLSRIEIDVAQQVAGGAMLLDVNMGAPLADEAELMVRAVTLIQGLTDLPLVIDSSIPAVLEAGLAAYQGKALVNSVTAEDERLHAILPLVKRYGAAVIGLPNDEEQIPDAPEERLALARKLIRTATDTYQIPIEDIVIDPLAMPVGADTGNTMRTLETLALVRDEFGVNTTLGASNLSFGMPDRHALTAAFLPLAAAHGLTSAIMDTRTPQVVTAARAADLLLGRDDWGAAWIAAFRAAKAAEQLSPAGTTLRTPRGMPALPDRRRGAGWRTEDAPQSPRHANRDR

Samples

Sample ID Description Type Environment
1 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
83 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
143 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
144 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
148 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
149 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
152 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
159 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
162 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
191 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.9
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 5.23
Rhizosphere 92.53
Stem 0
Stem Tuber 0
Unclassified 2.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10000398 3300003659 Bacteria 6005
2 Ga0070658_10006727 3300005327 Bacteria 9314
3 Ga0070658_10007493 3300005327 Bacteria 8806
4 Ga0070676_10351239 3300005328 Bacteria 1014
5 Ga0070683_100095482 3300005329 Bacteria 2795
6 Ga0070683_100284399 3300005329 Bacteria 1573
7 Ga0070690_100022486 3300005330 Bacteria 3857
8 Ga0070680_100098443 3300005336 Bacteria 2426
9 Ga0070680_100110586 3300005336 Bacteria 2287
10 Ga0070682_100037868 3300005337 Bacteria 2955
11 Ga0070682_100308805 3300005337 Bacteria 1163
12 Ga0068868_100147018 3300005338 Bacteria 1939
13 Ga0068868_100378941 3300005338 Bacteria 1217
14 Ga0070689_100047404 3300005340 Bacteria 3314
15 Ga0070691_10034550 3300005341 Bacteria 2380
16 Ga0070691_10084260 3300005341 Bacteria 1560
17 Ga0070687_100153364 3300005343 Bacteria 1354
18 Ga0070661_100238413 3300005344 Bacteria 1400
19 Ga0070692_10055715 3300005345 Bacteria 2068
20 Ga0070668_100114738 3300005347 Bacteria 2147
21 Ga0070675_100033222 3300005354 Bacteria 4181
22 Ga0070671_100244779 3300005355 Bacteria 1522
23 Ga0070673_100098201 3300005364 Bacteria 2406
24 Ga0070667_100112253 3300005367 Bacteria 2364
25 Ga0070709_10006011 3300005434 Bacteria 6598
26 Ga0070709_10035182 3300005434 Bacteria 3042
27 Ga0070709_10041597 3300005434 Bacteria 2832
28 Ga0070709_10335440 3300005434 Bacteria 1113
29 Ga0070714_100022125 3300005435 Bacteria 5210
30 Ga0070714_100068074 3300005435 Bacteria 3071
31 Ga0070714_100105493 3300005435 Bacteria 2488
32 Ga0070714_100180930 3300005435 Bacteria 1918
33 Ga0070714_100183072 3300005435 Bacteria 1907
34 Ga0070714_100443169 3300005435 Bacteria 1233
35 Ga0070713_100018274 3300005436 Bacteria 5329
36 Ga0070713_100130271 3300005436 Bacteria 2217
37 Ga0070713_100273965 3300005436 Bacteria 1546
38 Ga0070713_100328778 3300005436 Bacteria 1413
39 Ga0070710_10002884 3300005437 Bacteria 8191
40 Ga0070711_100063942 3300005439 Bacteria 2569
41 Ga0070711_100097676 3300005439 Bacteria 2130
42 Ga0070705_100215403 3300005440 Bacteria 1326
43 Ga0070708_100028053 3300005445 Bacteria 4840
44 Ga0070708_100052879 3300005445 Bacteria 3602
45 Ga0070708_100353281 3300005445 Bacteria 1385
46 Ga0070708_100594662 3300005445 Bacteria 1043
47 Ga0070663_100242030 3300005455 Bacteria 1424
48 Ga0070663_100339395 3300005455 Bacteria 1213
49 Ga0070678_100252806 3300005456 Bacteria 1478
50 Ga0070681_10210639 3300005458 Bacteria 1860
51 Ga0070681_10370948 3300005458 Bacteria 1342
52 Ga0068867_100061590 3300005459 Bacteria 2786
53 Ga0070685_10012773 3300005466 Bacteria 4417
54 Ga0070706_100003827 3300005467 Bacteria 14708
55 Ga0070706_100006264 3300005467 Bacteria 11256
56 Ga0070706_100008346 3300005467 Bacteria 9648
57 Ga0070706_100130554 3300005467 Bacteria 2344
58 Ga0070706_100147969 3300005467 Bacteria 2193
59 Ga0070707_100000596 3300005468 Bacteria 36368
60 Ga0070707_100011189 3300005468 Bacteria 8363
61 Ga0070707_100021466 3300005468 Bacteria 6103
62 Ga0070707_100025539 3300005468 Bacteria 5605
63 Ga0070707_100056960 3300005468 Bacteria 3749
64 Ga0070707_100067523 3300005468 Bacteria 3440
65 Ga0070707_100155466 3300005468 Bacteria 2228
66 Ga0070707_100295190 3300005468 Bacteria 1575
67 Ga0070698_100000272 3300005471 Bacteria 52507
68 Ga0070698_100000415 3300005471 Bacteria 45479
69 Ga0070698_100000997 3300005471 Bacteria 31180
70 Ga0070698_100003605 3300005471 Bacteria 17018
71 Ga0070698_100013860 3300005471 Bacteria 8524
72 Ga0070698_100028331 3300005471 Bacteria 5819
73 Ga0070698_100035486 3300005471 Bacteria 5156
74 Ga0070698_100093920 3300005471 Bacteria 2979
75 Ga0070698_100318580 3300005471 Bacteria 1486
76 Ga0070699_100088729 3300005518 Bacteria 2701
77 Ga0070679_100086043 3300005530 Bacteria 3130
78 Ga0070679_100579644 3300005530 Bacteria 1065
79 Ga0070684_100008234 3300005535 Bacteria 8146
80 Ga0070684_100026234 3300005535 Bacteria 4906
81 Ga0070684_100096180 3300005535 Bacteria 2640
82 Ga0070684_100229345 3300005535 Bacteria 1695
83 Ga0070697_100074348 3300005536 Bacteria 2792
84 Ga0070697_100201039 3300005536 Bacteria 1694
85 Ga0068853_100084552 3300005539 Bacteria 2780
86 Ga0068853_100270850 3300005539 Bacteria 1563
87 Ga0070672_100015514 3300005543 Bacteria 5427
88 Ga0070672_100430052 3300005543 Bacteria 1135
89 Ga0070696_100057788 3300005546 Bacteria 2708
90 Ga0070665_100174594 3300005548 Bacteria 2150
91 Ga0070665_100221691 3300005548 Bacteria 1891
92 Ga0070665_100422668 3300005548 Bacteria 1341
93 Ga0068855_100137800 3300005563 Bacteria 2783
94 Ga0070664_100126825 3300005564 Bacteria 2239
95 Ga0068857_100072535 3300005577 Bacteria 3068
96 Ga0068857_100326583 3300005577 Bacteria 1417
97 Ga0068854_100052623 3300005578 Bacteria 2921
98 Ga0068856_100121353 3300005614 Bacteria 2615
99 Ga0068856_100411945 3300005614 Bacteria 1371
100 Ga0070702_100121017 3300005615 Bacteria 1639
101 Ga0068864_100106489 3300005618 Bacteria 2493
102 Ga0068864_100270829 3300005618 Bacteria 1582
103 Ga0068864_100468157 3300005618 Bacteria 1208
104 Ga0068861_100246366 3300005719 Bacteria 1522
105 Ga0068870_10003577 3300005840 Bacteria 6589
106 Ga0068870_10006656 3300005840 Bacteria 5107
107 Ga0068863_100130514 3300005841 Bacteria 2399
108 Ga0068863_100145498 3300005841 Bacteria 2266
109 Ga0068858_100066920 3300005842 Bacteria 3326
110 Ga0068860_100115826 3300005843 Bacteria 2563
111 Ga0081455_10001397 3300005937 Bacteria 29816
112 Ga0081540_1000070 3300005983 Bacteria 111392
113 Ga0081540_1000255 3300005983 Bacteria 56347
114 Ga0070717_10011880 3300006028 Bacteria 6627
115 Ga0070717_10030716 3300006028 Bacteria 4316
116 Ga0070717_10040696 3300006028 Bacteria 3787
117 Ga0070717_10357081 3300006028 Bacteria 1307
118 Ga0070717_10469510 3300006028 Bacteria 1135
119 Ga0075363_100112466 3300006048 Bacteria 1514
120 Ga0070715_10003563 3300006163 Bacteria 4985
121 Ga0070716_100086062 3300006173 Bacteria 1890
122 Ga0070716_100110221 3300006173 Bacteria 1704
123 Ga0070716_100172751 3300006173 Bacteria 1412
124 Ga0070712_100001430 3300006175 Bacteria 14559
125 Ga0070712_100024741 3300006175 Bacteria 3983
126 Ga0070712_100029923 3300006175 Bacteria 3654
127 Ga0070712_100045889 3300006175 Bacteria 3019
128 Ga0070712_100138604 3300006175 Bacteria 1853
129 Ga0097621_100207432 3300006237 Bacteria 1703
130 Ga0068871_100060277 3300006358 Bacteria 3095
131 Ga0068871_100158580 3300006358 Bacteria 1934
132 Ga0075428_100065303 3300006844 Bacteria 3985
133 Ga0075433_10079779 3300006852 Bacteria 2884
134 Ga0075434_100116857 3300006871 Bacteria 2680
135 Ga0075434_100543344 3300006871 Bacteria 1182
136 Ga0075436_100023790 3300006914 Bacteria 4209
137 Ga0075436_100036516 3300006914 Bacteria 3391
138 Ga0075436_100038138 3300006914 Bacteria 3317
139 Ga0075436_100038908 3300006914 Bacteria 3282
140 Ga0075435_100010584 3300007076 Bacteria 6750
141 Ga0075435_100164107 3300007076 Bacteria 1872
142 Ga0099794_10056226 3300007265 Bacteria 1903
143 Ga0105251_10039771 3300009011 Bacteria 2295
144 Ga0111539_10030235 3300009094 Bacteria 6586
145 Ga0105245_10422077 3300009098 Bacteria 1337
146 Ga0105247_10109600 3300009101 Bacteria 1775
147 Ga0114129_10123228 3300009147 Bacteria 3566
148 Ga0105243_10190814 3300009148 Bacteria 1790
149 Ga0105242_10351222 3300009176 Bacteria 1362
150 Ga0105248_10835268 3300009177 Bacteria 1040
151 Ga0105237_10165429 3300009545 Bacteria 2211
152 Ga0105238_10108642 3300009551 Bacteria 2755
153 Ga0105239_10937086 3300010375 Bacteria 994
154 Ga0105246_10030702 3300011119 Bacteria 3551
155 Ga0105246_10067203 3300011119 Bacteria 2511
156 Ga0157341_1002091 3300012494 Bacteria 1282
157 Ga0157338_1006338 3300012515 Bacteria 1091
158 Ga0157370_10053967 3300013104 Bacteria 3831
159 Ga0157370_10068763 3300013104 Bacteria 3347
160 Ga0157369_10025418 3300013105 Bacteria 6576
161 Ga0157369_10044576 3300013105 Bacteria 4826
162 Ga0157369_10069173 3300013105 Bacteria 3793
163 Ga0157369_10139462 3300013105 Bacteria 2566
164 Ga0157369_10272517 3300013105 Bacteria 1763
165 Ga0163162_10264431 3300013306 Bacteria 1852
166 Ga0163163_10032737 3300014325 Bacteria 5023
167 Ga0163163_10235243 3300014325 Bacteria 1881
168 Ga0163163_10488913 3300014325 Bacteria 1292
169 Ga0157380_10022765 3300014326 Bacteria 4723
170 Ga0157380_10328683 3300014326 Bacteria 1421
171 Ga0157377_10036512 3300014745 Bacteria 2704
172 Ga0157379_10101468 3300014968 Bacteria 2582
173 Ga0157376_10229016 3300014969 Bacteria 1725
174 Ga0157376_10314520 3300014969 Bacteria 1487
175 Ga0206354_10221321 3300020081 Bacteria 3273
176 Ga0206354_10324262 3300020081 Bacteria 2578
177 Ga0206353_11100521 3300020082 Bacteria 2875
178 Ga0206353_12026084 3300020082 Bacteria 2476
179 Ga0213875_10000158 3300021388 Bacteria 71389
180 Ga0213875_10124775 3300021388 Bacteria 1203
181 Ga0224712_10100834 3300022467 Bacteria 1224
182 Ga0207692_10001781 3300025898 Bacteria 8174
183 Ga0207692_10005925 3300025898 Bacteria 4931
184 Ga0207692_10040324 3300025898 Bacteria 2303
185 Ga0207692_10065417 3300025898 Bacteria 1896
186 Ga0207710_10015780 3300025900 Bacteria 3194
187 Ga0207688_10004276 3300025901 Bacteria 7785
188 Ga0207647_10051533 3300025904 Bacteria 2543
189 Ga0207647_10175835 3300025904 Bacteria 1245
190 Ga0207685_10103586 3300025905 Bacteria 1221
191 Ga0207699_10003184 3300025906 Bacteria 7812
192 Ga0207699_10006004 3300025906 Bacteria 5846
193 Ga0207699_10018224 3300025906 Bacteria 3716
194 Ga0207699_10060602 3300025906 Bacteria 2273
195 Ga0207645_10231042 3300025907 Bacteria 1221
196 Ga0207643_10001438 3300025908 Bacteria 13665
197 Ga0207705_10041110 3300025909 Bacteria 3316
198 Ga0207684_10000787 3300025910 Bacteria 36852
199 Ga0207684_10010320 3300025910 Bacteria 8223
200 Ga0207684_10020239 3300025910 Bacteria 5685
201 Ga0207684_10021790 3300025910 Bacteria 5470
202 Ga0207684_10042341 3300025910 Bacteria 3860
203 Ga0207684_10045578 3300025910 Bacteria 3718
204 Ga0207684_10086258 3300025910 Bacteria 2674
205 Ga0207654_10053639 3300025911 Bacteria 2328
206 Ga0207693_10003435 3300025915 Bacteria 13516
207 Ga0207693_10023877 3300025915 Bacteria 4853
208 Ga0207693_10037306 3300025915 Bacteria 3830
209 Ga0207693_10057348 3300025915 Bacteria 3053
210 Ga0207693_10058382 3300025915 Bacteria 3023
211 Ga0207663_10047249 3300025916 Bacteria 2656
212 Ga0207662_10022414 3300025918 Bacteria 3622
213 Ga0207657_10002750 3300025919 Bacteria 18932
214 Ga0207657_10022835 3300025919 Bacteria 5840
215 Ga0207649_10098987 3300025920 Bacteria 1926
216 Ga0207649_10193116 3300025920 Bacteria 1433
217 Ga0207652_10017047 3300025921 Bacteria 5942
218 Ga0207652_10105681 3300025921 Bacteria 2491
219 Ga0207646_10000500 3300025922 Bacteria 52535
220 Ga0207646_10001807 3300025922 Bacteria 25880
221 Ga0207646_10050063 3300025922 Bacteria 3740
222 Ga0207646_10054303 3300025922 Bacteria 3584
223 Ga0207646_10079695 3300025922 Bacteria 2928
224 Ga0207646_10091532 3300025922 Bacteria 2722
225 Ga0207646_10097284 3300025922 Bacteria 2637
226 Ga0207646_10104414 3300025922 Bacteria 2541
227 Ga0207646_10200449 3300025922 Bacteria 1803
228 Ga0207646_10266011 3300025922 Bacteria 1550
229 Ga0207646_10330249 3300025922 Bacteria 1378
230 Ga0207650_10004613 3300025925 Bacteria 9422
231 Ga0207659_10274453 3300025926 Bacteria 1376
232 Ga0207700_10012338 3300025928 Bacteria 5504
233 Ga0207700_10054264 3300025928 Bacteria 3007
234 Ga0207700_10103492 3300025928 Bacteria 2276
235 Ga0207700_10193018 3300025928 Bacteria 1712
236 Ga0207700_10230511 3300025928 Bacteria 1574
237 Ga0207700_10387648 3300025928 Bacteria 1223
238 Ga0207664_10001200 3300025929 Bacteria 17207
239 Ga0207664_10001575 3300025929 Bacteria 14979
240 Ga0207664_10001831 3300025929 Bacteria 14023
241 Ga0207664_10003267 3300025929 Bacteria 10773
242 Ga0207664_10012574 3300025929 Bacteria 6055
243 Ga0207664_10035385 3300025929 Bacteria 3853
244 Ga0207664_10204686 3300025929 Bacteria 1705
245 Ga0207664_10214649 3300025929 Bacteria 1666
246 Ga0207664_10215974 3300025929 Bacteria 1661
247 Ga0207664_10474070 3300025929 Bacteria 1119
248 Ga0207670_10028108 3300025936 Bacteria 3565
249 Ga0207704_10328385 3300025938 Bacteria 1183
250 Ga0207665_10002304 3300025939 Bacteria 12896
251 Ga0207665_10008798 3300025939 Bacteria 6638
252 Ga0207665_10016409 3300025939 Bacteria 4862
253 Ga0207665_10054765 3300025939 Bacteria 2691
254 Ga0207665_10315019 3300025939 Bacteria 1173
255 Ga0207691_10023010 3300025940 Bacteria 5870
256 Ga0207689_10002061 3300025942 Bacteria 18976
257 Ga0207661_10103120 3300025944 Bacteria 2400
258 Ga0207661_10131026 3300025944 Bacteria 2148
259 Ga0207679_10258460 3300025945 Bacteria 1484
260 Ga0207667_10127461 3300025949 Bacteria 2622
261 Ga0207651_10439907 3300025960 Bacteria 1117
262 Ga0207640_10074296 3300025981 Bacteria 2300
263 Ga0207677_10156536 3300026023 Bacteria 1765
264 Ga0207639_10141007 3300026041 Bacteria 2008
265 Ga0207678_10002282 3300026067 Bacteria 17353
266 Ga0207678_10005083 3300026067 Bacteria 11795
267 Ga0207678_10199094 3300026067 Bacteria 1712
268 Ga0207708_10179810 3300026075 Bacteria 1679
269 Ga0207641_10256788 3300026088 Bacteria 1634
270 Ga0207648_10044100 3300026089 Bacteria 3913
271 Ga0207676_10054942 3300026095 Bacteria 3123
272 Ga0207676_10297162 3300026095 Bacteria 1473
273 Ga0207674_10013418 3300026116 Bacteria 9094
274 Ga0207674_10026006 3300026116 Bacteria 6228
275 Ga0207674_10029653 3300026116 Bacteria 5758
276 Ga0207674_10039601 3300026116 Bacteria 4885
277 Ga0207675_100009072 3300026118 Bacteria 9333
278 Ga0207683_10000774 3300026121 Bacteria 29121
279 Ga0207683_10097628 3300026121 Bacteria 2620
280 Ga0207683_10180711 3300026121 Bacteria 1913
281 Ga0207428_10372026 3300027907 Bacteria 1049
282 Ga0268266_10159905 3300028379 Bacteria 2037
283 Ga0268266_10266874 3300028379 Bacteria 1588
284 Ga0268265_10560615 3300028380 Bacteria 1086
285 Ga0268264_10296055 3300028381 Bacteria 1521
286 Ga0265337_1000057 3300028556 Bacteria 51000
287 Ga0265326_10003994 3300028558 Bacteria 4775
288 Ga0265319_1019198 3300028563 Bacteria 2558
289 Ga0265334_10000298 3300028573 Bacteria 27757
290 Ga0265318_10051173 3300028577 Bacteria 1551
291 Ga0265323_10014644 3300028653 Bacteria 3098
292 Ga0265322_10003954 3300028654 Bacteria 4441
293 Ga0265336_10003082 3300028666 Bacteria 6639
294 Ga0265336_10060799 3300028666 Bacteria 1133
295 Ga0265338_10002491 3300028800 Bacteria 27482
296 Ga0265338_10010734 3300028800 Bacteria 10691
297 Ga0265324_10005410 3300029957 Bacteria 5519
298 Ga0265760_10023331 3300031090 Bacteria 1797
299 Ga0265325_10038636 3300031241 Bacteria 2518
300 Ga0265316_10038089 3300031344 Bacteria 3877
301 Ga0265313_10008995 3300031595 Bacteria 6550
302 Ga0307508_10181997 3300031616 Bacteria 1704
303 Ga0265342_10011537 3300031712 Bacteria 6039
304 Ga0373958_0000702 3300034819 Bacteria 4243
305 Ga0373938_0002427 3300034957 Bacteria 3005
306 Ga0373926_0000338 3300035083 Bacteria 11831
307 Ga0373926_0008176 3300035083 Bacteria 3483
308 Ga0373926_0036116 3300035083 Bacteria 1754
309 Ga0373929_0012997 3300035085 Bacteria 1590
310 Ga0373934_0002751 3300035086 Bacteria 6455
311 Ga0373934_0005659 3300035086 Bacteria 4628
312 Ga0373934_0009461 3300035086 Bacteria 3651
313 Ga0373934_0033902 3300035086 Bacteria 2005
314 Ga0373934_0089514 3300035086 Bacteria 1240
315 Ga0373940_0005533 3300035088 Bacteria 2743
316 Ga0373949_0014747 3300035090 Bacteria 1742
317 Ga0373951_0006077 3300035091 Bacteria 2775
318 Ga0373923_0016080 3300035111 Bacteria 2835
319 Ga0373923_0143768 3300035111 Bacteria 1079
320 Ga0373936_0011924 3300035113 Bacteria 3298
321 Ga0373936_0077167 3300035113 Bacteria 1381
322 Ga0373936_0097727 3300035113 Bacteria 1236
323 Ga0373945_0008784 3300035116 Bacteria 3298
324 Ga0373953_0000027 3300035117 Bacteria 39541
325 Ga0373953_0005416 3300035117 Bacteria 4141
326 Ga0373953_0061130 3300035117 Bacteria 1540
327 Ga0373953_0091118 3300035117 Bacteria 1275
328 Ga0373954_0002667 3300035118 Bacteria 7508
329 Ga0373954_0046215 3300035118 Bacteria 2035
330 Ga0373954_0087633 3300035118 Bacteria 1492
331 Ga0373954_0103078 3300035118 Bacteria 1378
332 Ga0373956_0003730 3300035119 Bacteria 6140
333 Ga0373956_0039909 3300035119 Bacteria 2081
334 Ga0373956_0051315 3300035119 Bacteria 1853
335 Ga0373956_0150830 3300035119 Bacteria 1094
336 Ga0373957_0000178 3300035120 Bacteria 16194
337 Ga0373957_0000855 3300035120 Bacteria 7968
338 Ga0373943_0007036 3300035170 Bacteria 5046
339 Ga0373943_0028150 3300035170 Bacteria 2646
340 Ga0373943_0057587 3300035170 Bacteria 1931
341 Ga0373946_0002230 3300035171 Bacteria 6837
342 Ga0373946_0040999 3300035171 Bacteria 1897
343 Ga0373955_0000277 3300035172 Bacteria 21420
344 Ga0373955_0003321 3300035172 Bacteria 7065
345 Ga0373955_0011489 3300035172 Bacteria 4223
346 Ga0373955_0011954 3300035172 Bacteria 4159
347 Ga0373955_0204464 3300035172 Bacteria 1176
348 Ga0373942_0014589 3300035207 Bacteria 1905
349 Ga0316574_0093274 3300035398 Bacteria 1922
350 Ga0373924_0000722 3300035410 Bacteria 10312
351 Ga0373924_0001566 3300035410 Bacteria 7478
352 Ga0373924_0018352 3300035410 Bacteria 2694
353 Ga0373924_0098473 3300035410 Bacteria 1256
354 Ga0373931_0005867 3300035691 Bacteria 5714
355 Ga0373931_0224919 3300035691 Bacteria 1131
356 Ga0373935_0004554 3300035692 Bacteria 8151
357 Ga0373935_0011484 3300035692 Bacteria 5316
358 Ga0373935_0017888 3300035692 Bacteria 4305
359 Ga0373933_0000056 3300035724 Bacteria 66983
360 Ga0373933_0011242 3300035724 Bacteria 4927
361 Ga0373933_0015508 3300035724 Bacteria 4249
362 Ga0373933_0017567 3300035724 Bacteria 4013
363 Ga0373933_0054262 3300035724 Bacteria 2401
364 Ga0373947_0000012 3300035725 Bacteria 155188
365 Ga0373947_0000109 3300035725 Bacteria 41040
366 Ga0373947_0007711 3300035725 Bacteria 6220
367 Ga0373937_0000152 3300036401 Bacteria 66956
368 Ga0373937_0007300 3300036401 Bacteria 9566
369 Ga0373937_0028368 3300036401 Bacteria 5064
370 Ga0373937_0172487 3300036401 Bacteria 2029
371 Ga0373937_0183687 3300036401 Bacteria 1964
372 Ga0373937_0207389 3300036401 Bacteria 1843
373 Ga0373937_0387389 3300036401 Bacteria 1326
374 Ga0373925_0000319 3300037068 Bacteria 50232
375 Ga0373925_0002082 3300037068 Bacteria 16451
376 Ga0373925_0004704 3300037068 Bacteria 10298
377 Ga0373925_0006462 3300037068 Bacteria 8623
378 Ga0373925_0023768 3300037068 Bacteria 4471
379 Ga0395905_0480055 3300037471 Bacteria 1142
380 Ga0436364_0045810 3300037853 Bacteria 51517
381 Ga0436364_0074751 3300037853 Bacteria 2044
382 Ga0436364_0560348 3300037853 Bacteria 12968
383 Ga0436364_0960361 3300037853 Bacteria 2823
384 Ga0436364_1388557 3300037853 Bacteria 1911
385 Ga0436365_0247847 3300039437 Bacteria 1835
386 Ga0436365_1837031 3300039437 Bacteria 1949
387 Ga0436363_1301976 3300039450 Bacteria 2192
388 Ga0436363_1374337 3300039450 Bacteria 1440
389 Ga0436362_0770758 3300039453 Bacteria 1928
390 Ga0450920_002111 3300042122 Bacteria 3357
391 Ga0450907_009958 3300042146 Bacteria 1576
392 Ga0466963_0061428 3300044694 Bacteria 2512
393 Ga0466967_0228890 3300045976 Bacteria 1769
394 Ga0495592_0000129 3300046454 Bacteria 66962
395 Ga0495592_0018006 3300046454 Bacteria 5366
396 Ga0495592_0101941 3300046454 Bacteria 2044
397 Ga0495592_0107423 3300046454 Bacteria 1979
398 Ga0495592_0226780 3300046454 Bacteria 1246
399 Ga0495603_0006306 3300046455 Bacteria 7094
400 Ga0495603_0055108 3300046455 Bacteria 2356
401 Ga0495629_0039097 3300046459 Bacteria 3339
402 Ga0495641_0003961 3300046461 Bacteria 10760
403 Ga0495641_0006421 3300046461 Bacteria 7622
404 Ga0495651_0000089 3300046462 Bacteria 66983
405 Ga0495653_0006178 3300046463 Bacteria 9825
406 Ga0495653_0013196 3300046463 Bacteria 6735
407 Ga0495653_0018397 3300046463 Bacteria 5674
408 Ga0495653_0084033 3300046463 Bacteria 2345
409 Ga0495580_0014361 3300046472 Bacteria 6007
410 Ga0495580_0019899 3300046472 Bacteria 4977
411 Ga0495582_0003442 3300046473 Bacteria 8921
412 Ga0495662_0006459 3300046476 Bacteria 5854
413 Ga0495664_0007818 3300046477 Bacteria 5950
414 Ga0495664_0023197 3300046477 Bacteria 3599
415 Ga0495664_0092039 3300046477 Bacteria 1823
416 Ga0495594_0030336 3300046499 Bacteria 2924
417 Ga0495608_0000086 3300046511 Bacteria 67464
418 Ga0495608_0003546 3300046511 Bacteria 11175
419 Ga0495608_0047479 3300046511 Bacteria 2854
420 Ga0495608_0064403 3300046511 Bacteria 2403
421 Ga0495618_0024625 3300046514 Bacteria 3728
422 Ga0495618_0134938 3300046514 Bacteria 1579
423 Ga0495628_0000590 3300046516 Bacteria 33418
424 Ga0495628_0021547 3300046516 Bacteria 5298
425 Ga0495628_0064060 3300046516 Bacteria 2878
426 Ga0495628_0116754 3300046516 Bacteria 2049
427 Ga0495663_0096064 3300046525 Bacteria 971
428 Ga0495666_0019640 3300046526 Bacteria 3352
429 Ga0495666_0030922 3300046526 Bacteria 2625
430 Ga0495652_0000221 3300046529 Bacteria 66315
431 Ga0495652_0006349 3300046529 Bacteria 11009
432 Ga0495652_0013290 3300046529 Bacteria 7409
433 Ga0495652_0031302 3300046529 Bacteria 4659
434 Ga0495652_0076250 3300046529 Bacteria 2781
435 Ga0495652_0140060 3300046529 Bacteria 1903
436 Ga0495665_0000985 3300046531 Bacteria 15100
437 Ga0495665_0084242 3300046531 Bacteria 1671
438 Ga0495640_0019259 3300046533 Bacteria 5041
439 Ga0495640_0023271 3300046533 Bacteria 4517
440 Ga0495640_0070064 3300046533 Bacteria 2357
441 Ga0495586_0010847 3300046535 Bacteria 4841
442 Ga0495586_0109946 3300046535 Bacteria 1533
443 Ga0495587_0000099 3300046536 Bacteria 67448
444 Ga0495587_0004516 3300046536 Bacteria 9144
445 Ga0495587_0014462 3300046536 Bacteria 4949
446 Ga0495587_0028622 3300046536 Bacteria 3387
447 Ga0495587_0034121 3300046536 Bacteria 3069
448 Ga0495587_0065030 3300046536 Bacteria 2130
449 Ga0495645_0012919 3300046543 Bacteria 5895
450 Ga0495645_0020506 3300046543 Bacteria 4771
451 Ga0495645_0109512 3300046543 Bacteria 1955
452 Ga0495645_0224481 3300046543 Bacteria 1261
453 Ga0495645_0269127 3300046543 Bacteria 1125
454 Ga0495645_0310280 3300046543 Bacteria 1027
455 Ga0495667_0000088 3300046559 Bacteria 66785
456 Ga0495667_0001780 3300046559 Bacteria 14290
457 Ga0495667_0003211 3300046559 Bacteria 10963
458 Ga0495667_0026313 3300046559 Bacteria 3920
459 Ga0495667_0038349 3300046559 Bacteria 3190
460 Ga0495667_0045786 3300046559 Bacteria 2894
461 Ga0495634_0008896 3300046642 Bacteria 7440
462 Ga0495634_0019680 3300046642 Bacteria 4793
463 Ga0495634_0063597 3300046642 Bacteria 2448
464 Ga0495634_0162497 3300046642 Bacteria 1407
465 Ga0495635_0015774 3300046663 Bacteria 5277
466 Ga0495635_0107727 3300046663 Bacteria 1903
467 Ga0495657_0000130 3300046675 Bacteria 66983
468 Ga0495657_0021780 3300046675 Bacteria 4597
469 Ga0495657_0041784 3300046675 Bacteria 3135
470 Ga0495657_0047694 3300046675 Bacteria 2894
471 Ga0495599_0000190 3300046678 Bacteria 40649
472 Ga0495599_0056812 3300046678 Bacteria 2449
473 Ga0495599_0080216 3300046678 Bacteria 2037
474 Ga0495599_0182392 3300046678 Bacteria 1293
475 Ga0495623_0000122 3300046679 Bacteria 47783
476 Ga0495623_0014657 3300046679 Bacteria 5070
477 Ga0495623_0017272 3300046679 Bacteria 4661
478 Ga0495623_0047270 3300046679 Bacteria 2731
479 Ga0495623_0116614 3300046679 Bacteria 1613
480 Ga0495646_0069815 3300046680 Bacteria 2071
481 Ga0495646_0097621 3300046680 Bacteria 1688
482 Ga0495647_0019753 3300046681 Bacteria 2412
483 Ga0495658_0003537 3300046683 Bacteria 7725
484 Ga0495613_0001071 3300046689 Bacteria 20866
485 Ga0495613_0012763 3300046689 Bacteria 6246
486 Ga0495613_0313114 3300046689 Bacteria 1084
487 Ga0495624_0006227 3300046690 Bacteria 8482
488 Ga0495624_0171631 3300046690 Bacteria 1323
489 Ga0495624_0279207 3300046690 Bacteria 1009
490 Ga0495600_0002668 3300046809 Bacteria 10314
491 Ga0495600_0005282 3300046809 Bacteria 7778
492 Ga0495600_0039229 3300046809 Bacteria 3083
493 Ga0495600_0096199 3300046809 Bacteria 1930
494 Ga0495581_0002243 3300047315 Bacteria 10870
495 Ga0495581_0008179 3300047315 Bacteria 6058
496 Ga0495604_0000117 3300047317 Bacteria 66983
497 Ga0495604_0003577 3300047317 Bacteria 12389
498 Ga0495604_0005122 3300047317 Bacteria 10375
499 Ga0495604_0106054 3300047317 Bacteria 2056
500 Ga0495674_0011662 3300047319 Bacteria 8289
501 Ga0495674_0026492 3300047319 Bacteria 5304
502 Ga0495676_0044684 3300047321 Bacteria 3613
503 Ga0495676_0127176 3300047321 Bacteria 1845
504 Ga0495680_0000345 3300047322 Bacteria 51772
505 Ga0495680_0009813 3300047322 Bacteria 8586
506 Ga0495680_0011717 3300047322 Bacteria 7745
507 Ga0495680_0012931 3300047322 Bacteria 7313
508 Ga0495680_0017499 3300047322 Bacteria 6117
509 Ga0495680_0026634 3300047322 Bacteria 4762
510 Ga0495680_0042620 3300047322 Bacteria 3599
511 Ga0495675_0003177 3300047444 Bacteria 9871
512 Ga0495675_0019590 3300047444 Bacteria 4298
513 Ga0495675_0026863 3300047444 Bacteria 3669
514 Ga0495675_0072996 3300047444 Bacteria 2164
515 Ga0495675_0076261 3300047444 Bacteria 2113
516 Ga0495684_0010188 3300047471 Bacteria 7271
517 Ga0495684_0012319 3300047471 Bacteria 6595
518 Ga0495684_0031930 3300047471 Bacteria 4042
519 Ga0495684_0044048 3300047471 Bacteria 3416
520 Ga0495593_0007011 3300047673 Bacteria 6607
521 Ga0495602_0000424 3300048088 Bacteria 39603
522 Ga0495602_0004402 3300048088 Bacteria 14700
523 Ga0495602_0044227 3300048088 Bacteria 4042
524 Ga0495602_0091081 3300048088 Bacteria 2530
525 Ga0495602_0131203 3300048088 Bacteria 1998
526 Ga0495614_0002390 3300048089 Bacteria 8348
527 Ga0495614_0005476 3300048089 Bacteria 5722
528 Ga0496102_0088203 3300048905 Bacteria 2867
529 Ga0496102_0128934 3300048905 Bacteria 2366
530 Ga0496104_0001373 3300048907 Bacteria 21053
531 Ga0496104_0047867 3300048907 Bacteria 4030
532 Ga0496104_0139311 3300048907 Bacteria 2331
533 Ga0496104_0244318 3300048907 Bacteria 1707
534 Ga0496105_0010341 3300048908 Bacteria 7337
535 Ga0496105_0040019 3300048908 Bacteria 3864
536 Ga0496105_0043021 3300048908 Bacteria 3725
537 Ga0496106_0010131 3300048909 Bacteria 6963
538 Ga0496106_0199883 3300048909 Bacteria 1591
539 Ga0496107_0080836 3300048910 Bacteria 2370
540 Ga0496107_0121384 3300048910 Bacteria 1925
541 Ga0496108_0000975 3300048911 Bacteria 22275
542 Ga0496108_0006124 3300048911 Bacteria 9734
543 Ga0496108_0122700 3300048911 Bacteria 2229
544 Ga0496108_0129060 3300048911 Bacteria 2172
545 Ga0496109_0030696 3300048912 Bacteria 4817
546 Ga0496109_0098977 3300048912 Bacteria 2704
547 Ga0496109_0388482 3300048912 Bacteria 1318
548 Ga0496109_0404983 3300048912 Bacteria 1289
549 Ga0496109_0458861 3300048912 Bacteria 1203
550 Ga0496110_0008562 3300048913 Bacteria 8236
551 Ga0496110_0025319 3300048913 Bacteria 5069
552 Ga0496111_0007769 3300048914 Bacteria 7061
553 Ga0496112_0003470 3300048915 Bacteria 13040
554 Ga0496112_0092905 3300048915 Bacteria 2987
555 Ga0496112_0269684 3300048915 Bacteria 1650
556 Ga0496113_0026171 3300048916 Bacteria 4168
557 Ga0496113_0032842 3300048916 Bacteria 3773
558 Ga0496113_0202012 3300048916 Bacteria 1580
559 Ga0496114_0011756 3300048917 Bacteria 7003
560 Ga0496115_0016813 3300048918 Bacteria 5577
561 Ga0496115_0032724 3300048918 Bacteria 4103
562 Ga0496115_0154018 3300048918 Bacteria 1898
563 Ga0496126_0156117 3300048929 Bacteria 1953
564 Ga0496126_0310706 3300048929 Bacteria 1298
565 Ga0501032_0013793 3300049569 Bacteria 5733
566 Ga0501032_0062818 3300049569 Bacteria 2488
567 Ga0501033_0050495 3300049570 Bacteria 3085
568 Ga0501033_0191948 3300049570 Bacteria 1461
569 Ga0501036_0016113 3300049572 Bacteria 6245
570 Ga0501036_0217446 3300049572 Bacteria 1605
571 Ga0501037_0227153 3300049573 Bacteria 1311
572 Ga0501038_0020639 3300049574 Bacteria 5921
573 Ga0501038_0088539 3300049574 Bacteria 2598
574 Ga0501039_0057716 3300049575 Bacteria 3006
575 Ga0501039_0140956 3300049575 Bacteria 1894
576 Ga0501039_0144156 3300049575 Bacteria 1871
577 Ga0501039_0314766 3300049575 Bacteria 1230
578 Ga0501040_0012680 3300049576 Bacteria 5529
579 Ga0501040_0058720 3300049576 Bacteria 2642
580 Ga0501040_0145722 3300049576 Bacteria 1669
581 Ga0501041_0002562 3300049577 Bacteria 10360
582 Ga0501041_0198526 3300049577 Bacteria 1257
583 Ga0501042_0004606 3300049578 Bacteria 8802
584 Ga0501042_0038387 3300049578 Bacteria 3402
585 Ga0501042_0083289 3300049578 Bacteria 2293
586 Ga0501042_0157253 3300049578 Bacteria 1640
587 Ga0501043_0002930 3300049579 Bacteria 14244
588 Ga0501043_0084400 3300049579 Bacteria 2496
589 Ga0501046_0038018 3300049580 Bacteria 3865
590 Ga0501046_0040071 3300049580 Bacteria 3745
591 Ga0501047_0334510 3300049581 Bacteria 1352
592 Ga0501048_0008430 3300049582 Bacteria 7793
593 Ga0501048_0031924 3300049582 Bacteria 3808
594 Ga0501048_0033189 3300049582 Bacteria 3730
595 Ga0501067_0100084 3300049583 Bacteria 1610
596 Ga0501068_0016970 3300049584 Bacteria 4206
597 Ga0501069_0026741 3300049585 Bacteria 3160
598 Ga0501070_0004275 3300049586 Bacteria 12284
599 Ga0501071_0007884 3300049587 Bacteria 7021
600 Ga0501071_0029685 3300049587 Bacteria 3861
601 Ga0501071_0032119 3300049587 Bacteria 3726
602 Ga0501072_0004315 3300049588 Bacteria 10796
603 Ga0501072_0023386 3300049588 Bacteria 4799
604 Ga0501072_0166277 3300049588 Bacteria 1760
605 Ga0501073_0017143 3300049589 Bacteria 5246
606 Ga0501073_0044478 3300049589 Bacteria 3129
607 Ga0501074_0100753 3300049590 Bacteria 2067
608 Ga0501074_0126400 3300049590 Bacteria 1829
609 Ga0501075_0013619 3300049591 Bacteria 5807
610 Ga0501075_0061361 3300049591 Bacteria 2833
611 Ga0501075_0078757 3300049591 Bacteria 2494
612 Ga0501076_0009978 3300049592 Bacteria 7021
613 Ga0501076_0025816 3300049592 Bacteria 4548
614 Ga0501076_0041341 3300049592 Bacteria 3626
615 Ga0501076_0278523 3300049592 Bacteria 1370
616 Ga0501077_0014637 3300049593 Bacteria 4930
617 Ga0501077_0052134 3300049593 Bacteria 2598
618 Ga0501079_0136862 3300049741 Bacteria 1907
619 Ga0501079_0168615 3300049741 Bacteria 1707
620 Ga0501079_0277648 3300049741 Bacteria 1310
621 Ga0501080_0008350 3300049742 Bacteria 9378
622 Ga0501080_0074487 3300049742 Bacteria 3158
623 Ga0501080_0113112 3300049742 Bacteria 2516
624 Ga0501081_0010570 3300049743 Bacteria 6027
625 Ga0501081_0042458 3300049743 Bacteria 3116
626 Ga0501081_0045473 3300049743 Bacteria 3014
627 Ga0501081_0193446 3300049743 Bacteria 1474
628 Ga0501083_0014432 3300049744 Bacteria 5522
629 Ga0501083_0223517 3300049744 Bacteria 1226
630 Ga0501035_0012285 3300049822 Bacteria 7915
631 Ga0501045_0017198 3300049824 Bacteria 5133
632 Ga0501045_0079023 3300049824 Bacteria 2425
633 Ga0501045_0122194 3300049824 Bacteria 1933
634 nmdc:mga05p37_13433_c1 3300050507 Bacteria 9815
635 nmdc:mga05p37_550051_c1 3300050507 Bacteria 1314
636 nmdc:mga08y16_69724_c1 3300050511 Bacteria 3665
637 nmdc:mga0n895_11679_c1 3300050512 Bacteria 7848
638 nmdc:mga0n895_159223_c1 3300050512 Bacteria 2289
639 nmdc:mga0n895_35802_c1 3300050512 Bacteria 4790
640 nmdc:mga0rr50_26444_c1 3300050513 Bacteria 4049
641 nmdc:mga0rr50_360_c1 3300050513 Bacteria 24800
642 nmdc:mga0rr50_7550_c1 3300050513 Bacteria 6715
643 nmdc:mga08x19_139398_c1 3300050514 Bacteria 1637
644 nmdc:mga08x19_24655_c1 3300050514 Bacteria 3742
645 nmdc:mga08x19_3815_c1 3300050514 Bacteria 8970
646 nmdc:mga0a205_18826_c1 3300050515 Bacteria 6500
647 nmdc:mga0a205_24802_c1 3300050515 Bacteria 5706
648 Ga0495601_0001538 3300053077 Bacteria 12746
649 Ga0495601_0076527 3300053077 Bacteria 2143
650 Ga0495612_0003598 3300053078 Bacteria 6425
651 Ga0495612_0038366 3300053078 Bacteria 1946
652 Ga0495612_0110602 3300053078 Bacteria 1175
653 Ga0495612_0146152 3300053078 Bacteria 1027
654 Ga0495595_0001168 3300053084 Bacteria 10181
655 Ga0495595_0032134 3300053084 Bacteria 2362
656 Ga0495595_0038899 3300053084 Bacteria 2169
657 Ga0495595_0150804 3300053084 Bacteria 1144
658 Ga0495619_0002859 3300053085 Bacteria 11244
659 Ga0495619_0032656 3300053085 Bacteria 3378
660 Ga0501084_0010845 3300054114 Bacteria 7548
661 Ga0501084_0021020 3300054114 Bacteria 5444
662 Ga0501084_0026845 3300054114 Bacteria 4810
663 Ga0501082_0111939 3300060353 Bacteria 2363
664 Ga0501082_0252138 3300060353 Bacteria 1536
665 Ga0466962_0051808 3300061719 Bacteria 1963
666 Ga0530510_0007545 3300061734 Bacteria 7576
667 Ga0530510_0030941 3300061734 Bacteria 3846
668 Ga0530510_0039595 3300061734 Bacteria 3403

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0480055 Ga0395905_0480055_34_945 242
2 3300026121 Ga0207683_10097628 Ga0207683_100976282 253
3 3300046525 Ga0495663_0096064 Ga0495663_0096064_10_876 254
4 3300035088 Ga0373940_0005533 Ga0373940_0005533_1901_2731 263
5 3300046529 Ga0495652_0013290 Ga0495652_0013290_2914_3744 263
6 3300046536 Ga0495587_0014462 Ga0495587_0014462_1786_2616 263
7 3300046559 Ga0495667_0003211 Ga0495667_0003211_320_1150 263
8 3300046642 Ga0495634_0063597 Ga0495634_0063597_11_847 263
9 3300046675 Ga0495657_0021780 Ga0495657_0021780_2649_3479 263
10 3300046680 Ga0495646_0097621 Ga0495646_0097621_293_1123 263
11 3300046689 Ga0495613_0313114 Ga0495613_0313114_230_1066 263
12 3300047317 Ga0495604_0106054 Ga0495604_0106054_401_1231 263
13 3300047444 Ga0495675_0076261 Ga0495675_0076261_963_1793 263
14 3300048088 Ga0495602_0091081 Ga0495602_0091081_553_1383 263
15 3300046455 Ga0495603_0055108 Ga0495603_0055108_1180_2100 264
16 3300048912 Ga0496109_0404983 Ga0496109_0404983_26_946 264
17 3300049574 Ga0501038_0020639 Ga0501038_0020639_2680_3735 268
18 iso_pu_bacteria 2675903059 2676479770 268
19 3300061719 Ga0466962_0051808 Ga0466962_0051808_411_1310 270
20 3300005618 Ga0068864_100270829 Ga0068864_1002708292 271
21 3300042122 Ga0450920_002111 Ga0450920_002111_1595_2491 271
22 3300042146 Ga0450907_009958 Ga0450907_009958_376_1272 271
23 3300049572 Ga0501036_0217446 Ga0501036_0217446_162_1058 271
24 3300049575 Ga0501039_0057716 Ga0501039_0057716_886_1782 271
25 3300049575 Ga0501039_0140956 Ga0501039_0140956_742_1638 271
26 3300049576 Ga0501040_0145722 Ga0501040_0145722_501_1397 271
27 3300049578 Ga0501042_0157253 Ga0501042_0157253_71_967 271
28 3300049587 Ga0501071_0029685 Ga0501071_0029685_1747_2643 271
29 3300049588 Ga0501072_0166277 Ga0501072_0166277_817_1713 271
30 3300049591 Ga0501075_0061361 Ga0501075_0061361_216_1112 271
31 3300049741 Ga0501079_0136862 Ga0501079_0136862_292_1188 271
32 3300049741 Ga0501079_0277648 Ga0501079_0277648_361_1257 271
33 3300049824 Ga0501045_0079023 Ga0501045_0079023_1118_2014 271
34 3300061734 Ga0530510_0007545 Ga0530510_0007545_382_1278 271
35 3300061734 Ga0530510_0039595 Ga0530510_0039595_2070_2966 271
36 3300005338 Ga0068868_100147018 Ga0068868_1001470183 272
37 3300005338 Ga0068868_100378941 Ga0068868_1003789412 272
38 3300005341 Ga0070691_10034550 Ga0070691_100345502 272
39 3300005434 Ga0070709_10041597 Ga0070709_100415974 272
40 3300005435 Ga0070714_100068074 Ga0070714_1000680744 272
41 3300005435 Ga0070714_100105493 Ga0070714_1001054931 272
42 3300005445 Ga0070708_100353281 Ga0070708_1003532812 272
43 3300005445 Ga0070708_100594662 Ga0070708_1005946621 272
44 3300005467 Ga0070706_100003827 Ga0070706_1000038276 272
45 3300005467 Ga0070706_100008346 Ga0070706_1000083465 272
46 3300005467 Ga0070706_100147969 Ga0070706_1001479693 272
47 3300005468 Ga0070707_100000596 Ga0070707_1000005962 272
48 3300005468 Ga0070707_100067523 Ga0070707_1000675232 272
49 3300005468 Ga0070707_100155466 Ga0070707_1001554662 272
50 3300005471 Ga0070698_100000272 Ga0070698_10000027218 272
51 3300005471 Ga0070698_100003605 Ga0070698_10000360512 272
52 3300005471 Ga0070698_100093920 Ga0070698_1000939201 272
53 3300005535 Ga0070684_100008234 Ga0070684_1000082348 272
54 3300005535 Ga0070684_100096180 Ga0070684_1000961802 272
55 3300005536 Ga0070697_100074348 Ga0070697_1000743482 272
56 3300005539 Ga0068853_100270850 Ga0068853_1002708502 272
57 3300005543 Ga0070672_100430052 Ga0070672_1004300522 272
58 3300005548 Ga0070665_100174594 Ga0070665_1001745942 272
59 3300005548 Ga0070665_100221691 Ga0070665_1002216912 272
60 3300005563 Ga0068855_100137800 Ga0068855_1001378002 272
61 3300005577 Ga0068857_100072535 Ga0068857_1000725353 272
62 3300005614 Ga0068856_100411945 Ga0068856_1004119452 272
63 3300005615 Ga0070702_100121017 Ga0070702_1001210172 272
64 3300005618 Ga0068864_100468157 Ga0068864_1004681572 272
65 3300005841 Ga0068863_100145498 Ga0068863_1001454982 272
66 3300005842 Ga0068858_100066920 Ga0068858_1000669202 272
67 3300005983 Ga0081540_1000070 Ga0081540_10000707 272
68 3300006028 Ga0070717_10030716 Ga0070717_100307162 272
69 3300006028 Ga0070717_10040696 Ga0070717_100406963 272
70 3300006163 Ga0070715_10003563 Ga0070715_100035632 272
71 3300006173 Ga0070716_100086062 Ga0070716_1000860622 272
72 3300006173 Ga0070716_100172751 Ga0070716_1001727512 272
73 3300006175 Ga0070712_100024741 Ga0070712_1000247414 272
74 3300006871 Ga0075434_100543344 Ga0075434_1005433442 272
75 3300006914 Ga0075436_100023790 Ga0075436_1000237903 272
76 3300007265 Ga0099794_10056226 Ga0099794_100562262 272
77 3300009098 Ga0105245_10422077 Ga0105245_104220772 272
78 3300009545 Ga0105237_10165429 Ga0105237_101654292 272
79 3300009551 Ga0105238_10108642 Ga0105238_101086422 272
80 3300013104 Ga0157370_10068763 Ga0157370_100687632 272
81 3300013105 Ga0157369_10025418 Ga0157369_100254184 272
82 3300013105 Ga0157369_10139462 Ga0157369_101394623 272
83 3300013306 Ga0163162_10264431 Ga0163162_102644312 272
84 3300014325 Ga0163163_10032737 Ga0163163_100327373 272
85 3300014325 Ga0163163_10488913 Ga0163163_104889132 272
86 3300014968 Ga0157379_10101468 Ga0157379_101014683 272
87 3300014969 Ga0157376_10314520 Ga0157376_103145202 272
88 3300021388 Ga0213875_10124775 Ga0213875_101247752 272
89 3300025905 Ga0207685_10103586 Ga0207685_101035862 272
90 3300025910 Ga0207684_10000787 Ga0207684_100007875 272
91 3300025910 Ga0207684_10020239 Ga0207684_100202392 272
92 3300025910 Ga0207684_10021790 Ga0207684_100217906 272
93 3300025915 Ga0207693_10057348 Ga0207693_100573482 272
94 3300025919 Ga0207657_10022835 Ga0207657_100228353 272
95 3300025922 Ga0207646_10000500 Ga0207646_1000050018 272
96 3300025922 Ga0207646_10050063 Ga0207646_100500632 272
97 3300025922 Ga0207646_10097284 Ga0207646_100972842 272
98 3300025928 Ga0207700_10387648 Ga0207700_103876482 272
99 3300025929 Ga0207664_10001575 Ga0207664_100015757 272
100 3300025929 Ga0207664_10001831 Ga0207664_100018319 272
101 3300025939 Ga0207665_10315019 Ga0207665_103150192 272
102 3300025944 Ga0207661_10131026 Ga0207661_101310262 272
103 3300025949 Ga0207667_10127461 Ga0207667_101274612 272
104 3300026023 Ga0207677_10156536 Ga0207677_101565362 272
105 3300026041 Ga0207639_10141007 Ga0207639_101410072 272
106 3300026095 Ga0207676_10054942 Ga0207676_100549422 272
107 3300026095 Ga0207676_10297162 Ga0207676_102971622 272
108 3300026116 Ga0207674_10026006 Ga0207674_100260067 272
109 3300026116 Ga0207674_10029653 Ga0207674_100296535 272
110 3300028379 Ga0268266_10159905 Ga0268266_101599053 272
111 3300028379 Ga0268266_10266874 Ga0268266_102668742 272
112 3300028380 Ga0268265_10560615 Ga0268265_105606151 272
113 3300028381 Ga0268264_10296055 Ga0268264_102960552 272
114 3300028666 Ga0265336_10060799 Ga0265336_100607992 272
115 3300028800 Ga0265338_10010734 Ga0265338_100107341 272
116 3300035086 Ga0373934_0005659 Ga0373934_0005659_552_1448 272
117 3300035117 Ga0373953_0000027 Ga0373953_0000027_30560_31456 272
118 3300035118 Ga0373954_0002667 Ga0373954_0002667_1881_2777 272
119 3300035119 Ga0373956_0003730 Ga0373956_0003730_2923_3819 272
120 3300035120 Ga0373957_0000178 Ga0373957_0000178_7303_8199 272
121 3300035172 Ga0373955_0000277 Ga0373955_0000277_11254_12150 272
122 3300035398 Ga0316574_0093274 Ga0316574_0093274_659_1543 272
123 3300035410 Ga0373924_0001566 Ga0373924_0001566_1617_2513 272
124 3300035691 Ga0373931_0224919 Ga0373931_0224919_20_901 272
125 3300035724 Ga0373933_0000056 Ga0373933_0000056_34299_35195 272
126 3300036401 Ga0373937_0000152 Ga0373937_0000152_34272_35168 272
127 3300036401 Ga0373937_0207389 Ga0373937_0207389_254_1126 272
128 3300037853 Ga0436364_0960361 Ga0436364_0960361_81_977 272
129 3300039437 Ga0436365_1837031 Ga0436365_1837031_88_984 272
130 3300044694 Ga0466963_0061428 Ga0466963_0061428_323_1189 272
131 3300045976 Ga0466967_0228890 Ga0466967_0228890_492_1358 272
132 3300046454 Ga0495592_0000129 Ga0495592_0000129_31789_32685 272
133 3300046462 Ga0495651_0000089 Ga0495651_0000089_34299_35195 272
134 3300046463 Ga0495653_0018397 Ga0495653_0018397_2596_3492 272
135 3300046511 Ga0495608_0000086 Ga0495608_0000086_34295_35191 272
136 3300046516 Ga0495628_0000590 Ga0495628_0000590_19314_20210 272
137 3300046529 Ga0495652_0000221 Ga0495652_0000221_34299_35195 272
138 3300046536 Ga0495587_0000099 Ga0495587_0000099_34279_35175 272
139 3300046543 Ga0495645_0310280 Ga0495645_0310280_105_1001 272
140 3300046559 Ga0495667_0000088 Ga0495667_0000088_31619_32515 272
141 3300046675 Ga0495657_0000130 Ga0495657_0000130_31789_32685 272
142 3300046678 Ga0495599_0000190 Ga0495599_0000190_5466_6362 272
143 3300046679 Ga0495623_0000122 Ga0495623_0000122_26740_27636 272
144 3300046809 Ga0495600_0002668 Ga0495600_0002668_2966_3862 272
145 3300047317 Ga0495604_0000117 Ga0495604_0000117_31789_32685 272
146 3300047322 Ga0495680_0000345 Ga0495680_0000345_19097_19993 272
147 3300047444 Ga0495675_0003177 Ga0495675_0003177_7629_8525 272
148 3300048088 Ga0495602_0000424 Ga0495602_0000424_34271_35167 272
149 3300048905 Ga0496102_0128934 Ga0496102_0128934_621_1502 272
150 3300048907 Ga0496104_0001373 Ga0496104_0001373_9768_10655 272
151 3300048907 Ga0496104_0047867 Ga0496104_0047867_985_1866 272
152 3300048908 Ga0496105_0010341 Ga0496105_0010341_3255_4142 272
153 3300048908 Ga0496105_0043021 Ga0496105_0043021_1160_2041 272
154 3300048911 Ga0496108_0000975 Ga0496108_0000975_6870_7787 272
155 3300048911 Ga0496108_0006124 Ga0496108_0006124_1898_2779 272
156 3300048912 Ga0496109_0030696 Ga0496109_0030696_3269_4156 272
157 3300048912 Ga0496109_0098977 Ga0496109_0098977_1125_2006 272
158 3300048912 Ga0496109_0458861 Ga0496109_0458861_59_949 272
159 3300048915 Ga0496112_0003470 Ga0496112_0003470_3386_4303 272
160 3300048915 Ga0496112_0092905 Ga0496112_0092905_384_1265 272
161 3300048916 Ga0496113_0202012 Ga0496113_0202012_378_1268 272
162 3300048918 Ga0496115_0032724 Ga0496115_0032724_90_1007 272
163 3300048918 Ga0496115_0154018 Ga0496115_0154018_978_1826 272
164 3300048929 Ga0496126_0156117 Ga0496126_0156117_211_1116 272
165 3300049569 Ga0501032_0062818 Ga0501032_0062818_1573_2469 272
166 3300049576 Ga0501040_0058720 Ga0501040_0058720_1305_2201 272
167 3300049577 Ga0501041_0198526 Ga0501041_0198526_255_1151 272
168 3300049578 Ga0501042_0038387 Ga0501042_0038387_563_1459 272
169 3300049580 Ga0501046_0038018 Ga0501046_0038018_2136_3032 272
170 3300049582 Ga0501048_0031924 Ga0501048_0031924_2267_3163 272
171 3300049587 Ga0501071_0032119 Ga0501071_0032119_2816_3712 272
172 3300049588 Ga0501072_0004315 Ga0501072_0004315_9672_10568 272
173 3300049589 Ga0501073_0044478 Ga0501073_0044478_360_1316 272
174 3300049590 Ga0501074_0126400 Ga0501074_0126400_511_1407 272
175 3300049592 Ga0501076_0041341 Ga0501076_0041341_344_1240 272
176 3300049741 Ga0501079_0168615 Ga0501079_0168615_380_1276 272
177 3300049742 Ga0501080_0074487 Ga0501080_0074487_1907_2803 272
178 3300049743 Ga0501081_0042458 Ga0501081_0042458_1054_1950 272
179 3300049743 Ga0501081_0193446 Ga0501081_0193446_257_1174 272
180 3300049824 Ga0501045_0122194 Ga0501045_0122194_867_1763 272
181 3300050507 nmdc:mga05p37_550051_c1 nmdc:mga05p37_550051_c1_480_1298 272
182 3300050511 nmdc:mga08y16_69724_c1 nmdc:mga08y16_69724_c1_358_1251 272
183 3300050514 nmdc:mga08x19_139398_c1 nmdc:mga08x19_139398_c1_483_1373 272
184 3300054114 Ga0501084_0026845 Ga0501084_0026845_890_1786 272
185 3300060353 Ga0501082_0111939 Ga0501082_0111939_419_1315 272
186 3300061734 Ga0530510_0030941 Ga0530510_0030941_511_1407 272
187 3300005327 Ga0070658_10007493 Ga0070658_100074936 273
188 3300005329 Ga0070683_100284399 Ga0070683_1002843991 273
189 3300005330 Ga0070690_100022486 Ga0070690_1000224864 273
190 3300005337 Ga0070682_100308805 Ga0070682_1003088052 273
191 3300005341 Ga0070691_10084260 Ga0070691_100842602 273
192 3300005354 Ga0070675_100033222 Ga0070675_1000332224 273
193 3300005355 Ga0070671_100244779 Ga0070671_1002447792 273
194 3300005364 Ga0070673_100098201 Ga0070673_1000982012 273
195 3300005434 Ga0070709_10035182 Ga0070709_100351822 273
196 3300005436 Ga0070713_100130271 Ga0070713_1001302712 273
197 3300005436 Ga0070713_100273965 Ga0070713_1002739652 273
198 3300005439 Ga0070711_100097676 Ga0070711_1000976763 273
199 3300005440 Ga0070705_100215403 Ga0070705_1002154032 273
200 3300005459 Ga0068867_100061590 Ga0068867_1000615902 273
201 3300005471 Ga0070698_100035486 Ga0070698_1000354865 273
202 3300005518 Ga0070699_100088729 Ga0070699_1000887292 273
203 3300005535 Ga0070684_100026234 Ga0070684_1000262344 273
204 3300005564 Ga0070664_100126825 Ga0070664_1001268252 273
205 3300005618 Ga0068864_100106489 Ga0068864_1001064891 273
206 3300005840 Ga0068870_10006656 Ga0068870_100066562 273
207 3300005843 Ga0068860_100115826 Ga0068860_1001158262 273
208 3300006175 Ga0070712_100138604 Ga0070712_1001386042 273
209 3300006237 Ga0097621_100207432 Ga0097621_1002074322 273
210 3300006358 Ga0068871_100060277 Ga0068871_1000602772 273
211 3300013105 Ga0157369_10272517 Ga0157369_102725172 273
212 3300014326 Ga0157380_10022765 Ga0157380_100227654 273
213 3300020082 Ga0206353_12026084 Ga0206353_120260842 273
214 3300025898 Ga0207692_10040324 Ga0207692_100403243 273
215 3300025904 Ga0207647_10051533 Ga0207647_100515332 273
216 3300025906 Ga0207699_10006004 Ga0207699_100060044 273
217 3300025910 Ga0207684_10086258 Ga0207684_100862582 273
218 3300025911 Ga0207654_10053639 Ga0207654_100536392 273
219 3300025915 Ga0207693_10058382 Ga0207693_100583822 273
220 3300025928 Ga0207700_10193018 Ga0207700_101930182 273
221 3300025929 Ga0207664_10204686 Ga0207664_102046862 273
222 3300025929 Ga0207664_10474070 Ga0207664_104740701 273
223 3300025939 Ga0207665_10008798 Ga0207665_100087983 273
224 3300025940 Ga0207691_10023010 Ga0207691_100230104 273
225 3300025945 Ga0207679_10258460 Ga0207679_102584602 273
226 3300025981 Ga0207640_10074296 Ga0207640_100742962 273
227 3300026089 Ga0207648_10044100 Ga0207648_100441003 273
228 3300026116 Ga0207674_10013418 Ga0207674_100134188 273
229 3300026121 Ga0207683_10000774 Ga0207683_100007742 273
230 3300028556 Ga0265337_1000057 Ga0265337_100005729 273
231 3300028558 Ga0265326_10003994 Ga0265326_100039945 273
232 3300028563 Ga0265319_1019198 Ga0265319_10191983 273
233 3300028573 Ga0265334_10000298 Ga0265334_100002983 273
234 3300028577 Ga0265318_10051173 Ga0265318_100511732 273
235 3300028653 Ga0265323_10014644 Ga0265323_100146442 273
236 3300028654 Ga0265322_10003954 Ga0265322_100039542 273
237 3300028666 Ga0265336_10003082 Ga0265336_100030825 273
238 3300028800 Ga0265338_10002491 Ga0265338_100024912 273
239 3300029957 Ga0265324_10005410 Ga0265324_100054104 273
240 3300031241 Ga0265325_10038636 Ga0265325_100386362 273
241 3300031344 Ga0265316_10038089 Ga0265316_100380894 273
242 3300031595 Ga0265313_10008995 Ga0265313_100089953 273
243 3300031712 Ga0265342_10011537 Ga0265342_100115373 273
244 3300035083 Ga0373926_0036116 Ga0373926_0036116_665_1552 273
245 3300035086 Ga0373934_0089514 Ga0373934_0089514_174_1049 273
246 3300035170 Ga0373943_0057587 Ga0373943_0057587_881_1768 273
247 3300035207 Ga0373942_0014589 Ga0373942_0014589_516_1418 273
248 3300036401 Ga0373937_0387389 Ga0373937_0387389_366_1241 273
249 3300037068 Ga0373925_0004704 Ga0373925_0004704_7569_8561 273
250 3300039450 Ga0436363_1301976 Ga0436363_1301976_1050_1958 273
251 3300046472 Ga0495580_0019899 Ga0495580_0019899_2480_3367 273
252 3300046473 Ga0495582_0003442 Ga0495582_0003442_597_1484 273
253 3300046535 Ga0495586_0109946 Ga0495586_0109946_81_968 273
254 3300046543 Ga0495645_0269127 Ga0495645_0269127_117_983 273
255 3300046663 Ga0495635_0107727 Ga0495635_0107727_58_954 273
256 3300046679 Ga0495623_0116614 Ga0495623_0116614_541_1437 273
257 3300046690 Ga0495624_0279207 Ga0495624_0279207_113_985 273
258 3300047321 Ga0495676_0127176 Ga0495676_0127176_642_1529 273
259 3300047322 Ga0495680_0011717 Ga0495680_0011717_3127_4059 273
260 3300047471 Ga0495684_0044048 Ga0495684_0044048_573_1499 273
261 3300048088 Ga0495602_0044227 Ga0495602_0044227_488_1426 273
262 3300048907 Ga0496104_0139311 Ga0496104_0139311_1374_2288 273
263 3300048908 Ga0496105_0040019 Ga0496105_0040019_1434_2336 273
264 3300048909 Ga0496106_0199883 Ga0496106_0199883_464_1327 273
265 3300048911 Ga0496108_0129060 Ga0496108_0129060_293_1195 273
266 3300048912 Ga0496109_0388482 Ga0496109_0388482_58_972 273
267 3300048913 Ga0496110_0025319 Ga0496110_0025319_1968_2882 273
268 3300048916 Ga0496113_0032842 Ga0496113_0032842_2758_3672 273
269 3300048929 Ga0496126_0310706 Ga0496126_0310706_231_1145 273
270 3300049570 Ga0501033_0191948 Ga0501033_0191948_191_1171 273
271 3300049573 Ga0501037_0227153 Ga0501037_0227153_99_1052 273
272 3300049574 Ga0501038_0088539 Ga0501038_0088539_186_1139 273
273 3300049575 Ga0501039_0314766 Ga0501039_0314766_196_1149 273
274 3300049579 Ga0501043_0084400 Ga0501043_0084400_589_1542 273
275 3300049582 Ga0501048_0033189 Ga0501048_0033189_2622_3575 273
276 3300049589 Ga0501073_0017143 Ga0501073_0017143_3440_4393 273
277 3300049590 Ga0501074_0100753 Ga0501074_0100753_284_1237 273
278 3300049591 Ga0501075_0078757 Ga0501075_0078757_1130_2083 273
279 3300049592 Ga0501076_0025816 Ga0501076_0025816_3367_4320 273
280 3300049593 Ga0501077_0052134 Ga0501077_0052134_886_1839 273
281 3300049742 Ga0501080_0113112 Ga0501080_0113112_1021_1974 273
282 3300049743 Ga0501081_0045473 Ga0501081_0045473_1784_2764 273
283 3300049744 Ga0501083_0223517 Ga0501083_0223517_50_1003 273
284 3300050512 nmdc:mga0n895_159223_c1 nmdc:mga0n895_159223_c1_420_1322 273
285 3300053077 Ga0495601_0076527 Ga0495601_0076527_1246_2112 273
286 3300054114 Ga0501084_0010845 Ga0501084_0010845_2406_3359 273
287 3300005327 Ga0070658_10006727 Ga0070658_100067276 274
288 3300005328 Ga0070676_10351239 Ga0070676_103512391 274
289 3300005329 Ga0070683_100095482 Ga0070683_1000954822 274
290 3300005336 Ga0070680_100098443 Ga0070680_1000984432 274
291 3300005336 Ga0070680_100110586 Ga0070680_1001105863 274
292 3300005337 Ga0070682_100037868 Ga0070682_1000378683 274
293 3300005340 Ga0070689_100047404 Ga0070689_1000474042 274
294 3300005343 Ga0070687_100153364 Ga0070687_1001533642 274
295 3300005344 Ga0070661_100238413 Ga0070661_1002384132 274
296 3300005345 Ga0070692_10055715 Ga0070692_100557151 274
297 3300005367 Ga0070667_100112253 Ga0070667_1001122532 274
298 3300005434 Ga0070709_10006011 Ga0070709_100060114 274
299 3300005435 Ga0070714_100022125 Ga0070714_1000221254 274
300 3300005435 Ga0070714_100183072 Ga0070714_1001830722 274
301 3300005435 Ga0070714_100443169 Ga0070714_1004431692 274
302 3300005436 Ga0070713_100018274 Ga0070713_1000182742 274
303 3300005437 Ga0070710_10002884 Ga0070710_100028842 274
304 3300005439 Ga0070711_100063942 Ga0070711_1000639422 274
305 3300005445 Ga0070708_100028053 Ga0070708_1000280532 274
306 3300005445 Ga0070708_100052879 Ga0070708_1000528794 274
307 3300005455 Ga0070663_100242030 Ga0070663_1002420301 274
308 3300005455 Ga0070663_100339395 Ga0070663_1003393952 274
309 3300005456 Ga0070678_100252806 Ga0070678_1002528062 274
310 3300005458 Ga0070681_10210639 Ga0070681_102106392 274
311 3300005458 Ga0070681_10370948 Ga0070681_103709482 274
312 3300005467 Ga0070706_100006264 Ga0070706_1000062645 274
313 3300005467 Ga0070706_100130554 Ga0070706_1001305542 274
314 3300005468 Ga0070707_100011189 Ga0070707_1000111894 274
315 3300005468 Ga0070707_100021466 Ga0070707_1000214662 274
316 3300005468 Ga0070707_100025539 Ga0070707_1000255395 274
317 3300005468 Ga0070707_100056960 Ga0070707_1000569602 274
318 3300005468 Ga0070707_100295190 Ga0070707_1002951902 274
319 3300005471 Ga0070698_100000415 Ga0070698_10000041540 274
320 3300005471 Ga0070698_100000997 Ga0070698_10000099721 274
321 3300005471 Ga0070698_100013860 Ga0070698_1000138604 274
322 3300005471 Ga0070698_100028331 Ga0070698_1000283313 274
323 3300005471 Ga0070698_100318580 Ga0070698_1003185802 274
324 3300005530 Ga0070679_100086043 Ga0070679_1000860434 274
325 3300005530 Ga0070679_100579644 Ga0070679_1005796442 274
326 3300005535 Ga0070684_100229345 Ga0070684_1002293451 274
327 3300005536 Ga0070697_100201039 Ga0070697_1002010392 274
328 3300005539 Ga0068853_100084552 Ga0068853_1000845522 274
329 3300005543 Ga0070672_100015514 Ga0070672_1000155142 274
330 3300005546 Ga0070696_100057788 Ga0070696_1000577882 274
331 3300005548 Ga0070665_100422668 Ga0070665_1004226682 274
332 3300005577 Ga0068857_100326583 Ga0068857_1003265832 274
333 3300005578 Ga0068854_100052623 Ga0068854_1000526232 274
334 3300005614 Ga0068856_100121353 Ga0068856_1001213532 274
335 3300005840 Ga0068870_10003577 Ga0068870_100035772 274
336 3300005841 Ga0068863_100130514 Ga0068863_1001305142 274
337 3300005937 Ga0081455_10001397 Ga0081455_1000139718 274
338 3300006028 Ga0070717_10011880 Ga0070717_100118804 274
339 3300006028 Ga0070717_10469510 Ga0070717_104695102 274
340 3300006048 Ga0075363_100112466 Ga0075363_1001124662 274
341 3300006175 Ga0070712_100001430 Ga0070712_1000014304 274
342 3300006358 Ga0068871_100158580 Ga0068871_1001585803 274
343 3300009011 Ga0105251_10039771 Ga0105251_100397711 274
344 3300009094 Ga0111539_10030235 Ga0111539_100302354 274
345 3300009101 Ga0105247_10109600 Ga0105247_101096002 274
346 3300009147 Ga0114129_10123228 Ga0114129_101232282 274
347 3300010375 Ga0105239_10937086 Ga0105239_109370861 274
348 3300011119 Ga0105246_10030702 Ga0105246_100307022 274
349 3300011119 Ga0105246_10067203 Ga0105246_100672032 274
350 3300012494 Ga0157341_1002091 Ga0157341_10020911 274
351 3300012515 Ga0157338_1006338 Ga0157338_10063382 274
352 3300013104 Ga0157370_10053967 Ga0157370_100539672 274
353 3300013105 Ga0157369_10044576 Ga0157369_100445764 274
354 3300013105 Ga0157369_10069173 Ga0157369_100691734 274
355 3300014325 Ga0163163_10235243 Ga0163163_102352433 274
356 3300014326 Ga0157380_10328683 Ga0157380_103286832 274
357 3300014745 Ga0157377_10036512 Ga0157377_100365122 274
358 3300020081 Ga0206354_10221321 Ga0206354_102213213 274
359 3300020082 Ga0206353_11100521 Ga0206353_111005212 274
360 3300022467 Ga0224712_10100834 Ga0224712_101008342 274
361 3300025898 Ga0207692_10001781 Ga0207692_100017813 274
362 3300025898 Ga0207692_10005925 Ga0207692_100059254 274
363 3300025900 Ga0207710_10015780 Ga0207710_100157804 274
364 3300025901 Ga0207688_10004276 Ga0207688_100042762 274
365 3300025904 Ga0207647_10175835 Ga0207647_101758352 274
366 3300025906 Ga0207699_10003184 Ga0207699_100031843 274
367 3300025906 Ga0207699_10018224 Ga0207699_100182241 274
368 3300025907 Ga0207645_10231042 Ga0207645_102310422 274
369 3300025908 Ga0207643_10001438 Ga0207643_100014387 274
370 3300025909 Ga0207705_10041110 Ga0207705_100411102 274
371 3300025910 Ga0207684_10010320 Ga0207684_100103202 274
372 3300025910 Ga0207684_10045578 Ga0207684_100455783 274
373 3300025915 Ga0207693_10003435 Ga0207693_100034355 274
374 3300025915 Ga0207693_10037306 Ga0207693_100373062 274
375 3300025916 Ga0207663_10047249 Ga0207663_100472493 274
376 3300025918 Ga0207662_10022414 Ga0207662_100224142 274
377 3300025920 Ga0207649_10098987 Ga0207649_100989872 274
378 3300025921 Ga0207652_10017047 Ga0207652_100170472 274
379 3300025921 Ga0207652_10105681 Ga0207652_101056812 274
380 3300025922 Ga0207646_10001807 Ga0207646_1000180715 274
381 3300025922 Ga0207646_10054303 Ga0207646_100543032 274
382 3300025922 Ga0207646_10079695 Ga0207646_100796952 274
383 3300025922 Ga0207646_10091532 Ga0207646_100915322 274
384 3300025922 Ga0207646_10200449 Ga0207646_102004492 274
385 3300025922 Ga0207646_10266011 Ga0207646_102660112 274
386 3300025922 Ga0207646_10330249 Ga0207646_103302492 274
387 3300025925 Ga0207650_10004613 Ga0207650_100046137 274
388 3300025926 Ga0207659_10274453 Ga0207659_102744532 274
389 3300025928 Ga0207700_10012338 Ga0207700_100123383 274
390 3300025928 Ga0207700_10054264 Ga0207700_100542644 274
391 3300025928 Ga0207700_10103492 Ga0207700_101034923 274
392 3300025929 Ga0207664_10001200 Ga0207664_1000120012 274
393 3300025929 Ga0207664_10035385 Ga0207664_100353854 274
394 3300025929 Ga0207664_10214649 Ga0207664_102146492 274
395 3300025929 Ga0207664_10215974 Ga0207664_102159742 274
396 3300025936 Ga0207670_10028108 Ga0207670_100281083 274
397 3300025938 Ga0207704_10328385 Ga0207704_103283852 274
398 3300025939 Ga0207665_10002304 Ga0207665_100023044 274
399 3300025939 Ga0207665_10016409 Ga0207665_100164092 274
400 3300025939 Ga0207665_10054765 Ga0207665_100547652 274
401 3300025942 Ga0207689_10002061 Ga0207689_100020614 274
402 3300025944 Ga0207661_10103120 Ga0207661_101031202 274
403 3300025960 Ga0207651_10439907 Ga0207651_104399071 274
404 3300026067 Ga0207678_10002282 Ga0207678_1000228211 274
405 3300026067 Ga0207678_10005083 Ga0207678_100050831 274
406 3300026067 Ga0207678_10199094 Ga0207678_101990942 274
407 3300026088 Ga0207641_10256788 Ga0207641_102567882 274
408 3300026116 Ga0207674_10039601 Ga0207674_100396013 274
409 3300026118 Ga0207675_100009072 Ga0207675_1000090727 274
410 3300027907 Ga0207428_10372026 Ga0207428_103720261 274
411 3300031616 Ga0307508_10181997 Ga0307508_101819972 274
412 3300034957 Ga0373938_0002427 Ga0373938_0002427_226_1101 274
413 3300035083 Ga0373926_0008176 Ga0373926_0008176_607_1473 274
414 3300035085 Ga0373929_0012997 Ga0373929_0012997_580_1455 274
415 3300035111 Ga0373923_0143768 Ga0373923_0143768_111_986 274
416 3300035113 Ga0373936_0011924 Ga0373936_0011924_2327_3202 274
417 3300035113 Ga0373936_0077167 Ga0373936_0077167_350_1252 274
418 3300035117 Ga0373953_0091118 Ga0373953_0091118_10_873 274
419 3300035118 Ga0373954_0087633 Ga0373954_0087633_342_1205 274
420 3300035118 Ga0373954_0103078 Ga0373954_0103078_299_1171 274
421 3300035119 Ga0373956_0051315 Ga0373956_0051315_871_1794 274
422 3300035119 Ga0373956_0150830 Ga0373956_0150830_28_891 274
423 3300035170 Ga0373943_0028150 Ga0373943_0028150_1466_2374 274
424 3300035172 Ga0373955_0011489 Ga0373955_0011489_1993_2868 274
425 3300035172 Ga0373955_0011954 Ga0373955_0011954_2470_3378 274
426 3300035410 Ga0373924_0000722 Ga0373924_0000722_8005_8880 274
427 3300035692 Ga0373935_0004554 Ga0373935_0004554_6372_7247 274
428 3300035692 Ga0373935_0011484 Ga0373935_0011484_2036_2902 274
429 3300035692 Ga0373935_0017888 Ga0373935_0017888_2949_3857 274
430 3300035724 Ga0373933_0011242 Ga0373933_0011242_433_1335 274
431 3300035724 Ga0373933_0015508 Ga0373933_0015508_2658_3566 274
432 3300035725 Ga0373947_0000012 Ga0373947_0000012_113556_114422 274
433 3300035725 Ga0373947_0000109 Ga0373947_0000109_26561_27469 274
434 3300036401 Ga0373937_0028368 Ga0373937_0028368_1111_2019 274
435 3300036401 Ga0373937_0172487 Ga0373937_0172487_1100_2008 274
436 3300037068 Ga0373925_0000319 Ga0373925_0000319_29729_30679 274
437 3300037068 Ga0373925_0002082 Ga0373925_0002082_15396_16373 274
438 3300037068 Ga0373925_0006462 Ga0373925_0006462_7445_8353 274
439 3300037068 Ga0373925_0023768 Ga0373925_0023768_3485_4360 274
440 3300039450 Ga0436363_1374337 Ga0436363_1374337_160_1053 274
441 3300046454 Ga0495592_0018006 Ga0495592_0018006_1251_2159 274
442 3300046454 Ga0495592_0101941 Ga0495592_0101941_950_1825 274
443 3300046461 Ga0495641_0003961 Ga0495641_0003961_1559_2434 274
444 3300046463 Ga0495653_0006178 Ga0495653_0006178_3187_4095 274
445 3300046463 Ga0495653_0013196 Ga0495653_0013196_4783_5658 274
446 3300046477 Ga0495664_0007818 Ga0495664_0007818_3167_4042 274
447 3300046511 Ga0495608_0003546 Ga0495608_0003546_2369_3277 274
448 3300046514 Ga0495618_0024625 Ga0495618_0024625_508_1383 274
449 3300046514 Ga0495618_0134938 Ga0495618_0134938_477_1355 274
450 3300046516 Ga0495628_0116754 Ga0495628_0116754_1078_1953 274
451 3300046526 Ga0495666_0019640 Ga0495666_0019640_731_1606 274
452 3300046529 Ga0495652_0006349 Ga0495652_0006349_307_1215 274
453 3300046529 Ga0495652_0031302 Ga0495652_0031302_1876_2751 274
454 3300046529 Ga0495652_0140060 Ga0495652_0140060_479_1399 274
455 3300046531 Ga0495665_0000985 Ga0495665_0000985_7219_8094 274
456 3300046533 Ga0495640_0023271 Ga0495640_0023271_1297_2172 274
457 3300046536 Ga0495587_0004516 Ga0495587_0004516_4866_5774 274
458 3300046536 Ga0495587_0028622 Ga0495587_0028622_1216_2091 274
459 3300046536 Ga0495587_0065030 Ga0495587_0065030_809_1729 274
460 3300046543 Ga0495645_0020506 Ga0495645_0020506_1579_2478 274
461 3300046543 Ga0495645_0109512 Ga0495645_0109512_799_1707 274
462 3300046559 Ga0495667_0001780 Ga0495667_0001780_8207_9115 274
463 3300046559 Ga0495667_0038349 Ga0495667_0038349_132_1034 274
464 3300046559 Ga0495667_0045786 Ga0495667_0045786_111_986 274
465 3300046642 Ga0495634_0008896 Ga0495634_0008896_5289_6164 274
466 3300046642 Ga0495634_0162497 Ga0495634_0162497_51_959 274
467 3300046675 Ga0495657_0041784 Ga0495657_0041784_1029_1952 274
468 3300046675 Ga0495657_0047694 Ga0495657_0047694_1909_2784 274
469 3300046678 Ga0495599_0056812 Ga0495599_0056812_929_1837 274
470 3300046679 Ga0495623_0014657 Ga0495623_0014657_1581_2456 274
471 3300046679 Ga0495623_0017272 Ga0495623_0017272_1983_2891 274
472 3300046683 Ga0495658_0003537 Ga0495658_0003537_4463_5338 274
473 3300046689 Ga0495613_0012763 Ga0495613_0012763_4999_5874 274
474 3300046690 Ga0495624_0006227 Ga0495624_0006227_4035_4910 274
475 3300046809 Ga0495600_0005282 Ga0495600_0005282_4783_5658 274
476 3300046809 Ga0495600_0096199 Ga0495600_0096199_537_1445 274
477 3300047315 Ga0495581_0002243 Ga0495581_0002243_1216_2091 274
478 3300047317 Ga0495604_0003577 Ga0495604_0003577_7826_8734 274
479 3300047319 Ga0495674_0026492 Ga0495674_0026492_3651_4550 274
480 3300047322 Ga0495680_0009813 Ga0495680_0009813_6627_7535 274
481 3300047322 Ga0495680_0012931 Ga0495680_0012931_5489_6364 274
482 3300047322 Ga0495680_0017499 Ga0495680_0017499_3574_4482 274
483 3300047322 Ga0495680_0026634 Ga0495680_0026634_2277_3179 274
484 3300047444 Ga0495675_0026863 Ga0495675_0026863_220_1095 274
485 3300047444 Ga0495675_0072996 Ga0495675_0072996_1202_2110 274
486 3300047471 Ga0495684_0010188 Ga0495684_0010188_4581_5489 274
487 3300047471 Ga0495684_0031930 Ga0495684_0031930_950_1825 274
488 3300047673 Ga0495593_0007011 Ga0495593_0007011_2484_3359 274
489 3300048088 Ga0495602_0004402 Ga0495602_0004402_9311_10219 274
490 3300048088 Ga0495602_0131203 Ga0495602_0131203_157_1059 274
491 3300048089 Ga0495614_0002390 Ga0495614_0002390_6217_7092 274
492 3300048905 Ga0496102_0088203 Ga0496102_0088203_1626_2501 274
493 3300048907 Ga0496104_0244318 Ga0496104_0244318_133_1008 274
494 3300048909 Ga0496106_0010131 Ga0496106_0010131_2103_2978 274
495 3300048910 Ga0496107_0121384 Ga0496107_0121384_678_1586 274
496 3300048914 Ga0496111_0007769 Ga0496111_0007769_205_1107 274
497 3300048916 Ga0496113_0026171 Ga0496113_0026171_2658_3533 274
498 3300049569 Ga0501032_0013793 Ga0501032_0013793_2581_3510 274
499 3300049570 Ga0501033_0050495 Ga0501033_0050495_1321_2250 274
500 3300049572 Ga0501036_0016113 Ga0501036_0016113_3130_4059 274
501 3300049575 Ga0501039_0144156 Ga0501039_0144156_86_1015 274
502 3300049576 Ga0501040_0012680 Ga0501040_0012680_2433_3362 274
503 3300049577 Ga0501041_0002562 Ga0501041_0002562_7245_8174 274
504 3300049578 Ga0501042_0004606 Ga0501042_0004606_6521_7450 274
505 3300049578 Ga0501042_0083289 Ga0501042_0083289_1024_1893 274
506 3300049579 Ga0501043_0002930 Ga0501043_0002930_2187_3116 274
507 3300049580 Ga0501046_0040071 Ga0501046_0040071_2692_3648 274
508 3300049581 Ga0501047_0334510 Ga0501047_0334510_168_1097 274
509 3300049582 Ga0501048_0008430 Ga0501048_0008430_5349_6278 274
510 3300049583 Ga0501067_0100084 Ga0501067_0100084_195_1106 274
511 3300049584 Ga0501068_0016970 Ga0501068_0016970_1449_2378 274
512 3300049585 Ga0501069_0026741 Ga0501069_0026741_531_1460 274
513 3300049586 Ga0501070_0004275 Ga0501070_0004275_8264_9193 274
514 3300049587 Ga0501071_0007884 Ga0501071_0007884_3906_4835 274
515 3300049588 Ga0501072_0023386 Ga0501072_0023386_1684_2613 274
516 3300049591 Ga0501075_0013619 Ga0501075_0013619_2187_3116 274
517 3300049592 Ga0501076_0009978 Ga0501076_0009978_2187_3116 274
518 3300049592 Ga0501076_0278523 Ga0501076_0278523_49_984 274
519 3300049593 Ga0501077_0014637 Ga0501077_0014637_1815_2744 274
520 3300049742 Ga0501080_0008350 Ga0501080_0008350_2187_3116 274
521 3300049743 Ga0501081_0010570 Ga0501081_0010570_1321_2250 274
522 3300049744 Ga0501083_0014432 Ga0501083_0014432_2433_3362 274
523 3300049822 Ga0501035_0012285 Ga0501035_0012285_3894_4823 274
524 3300049824 Ga0501045_0017198 Ga0501045_0017198_2659_3588 274
525 3300053077 Ga0495601_0001538 Ga0495601_0001538_2729_3604 274
526 3300053078 Ga0495612_0038366 Ga0495612_0038366_684_1583 274
527 3300053078 Ga0495612_0110602 Ga0495612_0110602_161_1036 274
528 3300053084 Ga0495595_0001168 Ga0495595_0001168_2101_2976 274
529 3300053084 Ga0495595_0038899 Ga0495595_0038899_1023_1931 274
530 3300053084 Ga0495595_0150804 Ga0495595_0150804_32_913 274
531 3300053085 Ga0495619_0032656 Ga0495619_0032656_1140_2048 274
532 3300054114 Ga0501084_0021020 Ga0501084_0021020_2829_3758 274
533 3300060353 Ga0501082_0252138 Ga0501082_0252138_518_1453 274
534 3300003659 JGI25404J52841_10000398 JGI25404J52841_100003982 275
535 3300005347 Ga0070668_100114738 Ga0070668_1001147382 275
536 3300005434 Ga0070709_10335440 Ga0070709_103354402 275
537 3300005435 Ga0070714_100180930 Ga0070714_1001809302 275
538 3300005436 Ga0070713_100328778 Ga0070713_1003287782 275
539 3300005466 Ga0070685_10012773 Ga0070685_100127732 275
540 3300005719 Ga0068861_100246366 Ga0068861_1002463662 275
541 3300005983 Ga0081540_1000255 Ga0081540_100025538 275
542 3300006028 Ga0070717_10357081 Ga0070717_103570812 275
543 3300006173 Ga0070716_100110221 Ga0070716_1001102212 275
544 3300006175 Ga0070712_100029923 Ga0070712_1000299232 275
545 3300006175 Ga0070712_100045889 Ga0070712_1000458893 275
546 3300006844 Ga0075428_100065303 Ga0075428_1000653033 275
547 3300006852 Ga0075433_10079779 Ga0075433_100797792 275
548 3300006871 Ga0075434_100116857 Ga0075434_1001168572 275
549 3300006914 Ga0075436_100036516 Ga0075436_1000365162 275
550 3300006914 Ga0075436_100038138 Ga0075436_1000381382 275
551 3300006914 Ga0075436_100038908 Ga0075436_1000389082 275
552 3300007076 Ga0075435_100010584 Ga0075435_1000105845 275
553 3300007076 Ga0075435_100164107 Ga0075435_1001641072 275
554 3300009148 Ga0105243_10190814 Ga0105243_101908141 275
555 3300009176 Ga0105242_10351222 Ga0105242_103512221 275
556 3300009177 Ga0105248_10835268 Ga0105248_108352681 275
557 3300014969 Ga0157376_10229016 Ga0157376_102290162 275
558 3300020081 Ga0206354_10324262 Ga0206354_103242623 275
559 3300021388 Ga0213875_10000158 Ga0213875_1000015848 275
560 3300025898 Ga0207692_10065417 Ga0207692_100654172 275
561 3300025906 Ga0207699_10060602 Ga0207699_100606022 275
562 3300025910 Ga0207684_10042341 Ga0207684_100423413 275
563 3300025915 Ga0207693_10023877 Ga0207693_100238774 275
564 3300025919 Ga0207657_10002750 Ga0207657_100027505 275
565 3300025920 Ga0207649_10193116 Ga0207649_101931161 275
566 3300025922 Ga0207646_10104414 Ga0207646_101044142 275
567 3300025928 Ga0207700_10230511 Ga0207700_102305112 275
568 3300025929 Ga0207664_10003267 Ga0207664_1000326712 275
569 3300025929 Ga0207664_10012574 Ga0207664_100125742 275
570 3300026075 Ga0207708_10179810 Ga0207708_101798102 275
571 3300026121 Ga0207683_10180711 Ga0207683_101807112 275
572 3300031090 Ga0265760_10023331 Ga0265760_100233312 275
573 3300034819 Ga0373958_0000702 Ga0373958_0000702_3174_4040 275
574 3300035083 Ga0373926_0000338 Ga0373926_0000338_5842_6738 275
575 3300035086 Ga0373934_0002751 Ga0373934_0002751_4335_5231 275
576 3300035086 Ga0373934_0009461 Ga0373934_0009461_1705_2571 275
577 3300035086 Ga0373934_0033902 Ga0373934_0033902_1104_1976 275
578 3300035090 Ga0373949_0014747 Ga0373949_0014747_419_1285 275
579 3300035091 Ga0373951_0006077 Ga0373951_0006077_975_1865 275
580 3300035111 Ga0373923_0016080 Ga0373923_0016080_847_1719 275
581 3300035113 Ga0373936_0097727 Ga0373936_0097727_109_981 275
582 3300035116 Ga0373945_0008784 Ga0373945_0008784_1568_2464 275
583 3300035117 Ga0373953_0005416 Ga0373953_0005416_2575_3471 275
584 3300035117 Ga0373953_0061130 Ga0373953_0061130_427_1293 275
585 3300035118 Ga0373954_0046215 Ga0373954_0046215_1110_1976 275
586 3300035119 Ga0373956_0039909 Ga0373956_0039909_1137_2003 275
587 3300035120 Ga0373957_0000855 Ga0373957_0000855_6861_7733 275
588 3300035170 Ga0373943_0007036 Ga0373943_0007036_2861_3757 275
589 3300035171 Ga0373946_0002230 Ga0373946_0002230_3095_3991 275
590 3300035171 Ga0373946_0040999 Ga0373946_0040999_24_896 275
591 3300035172 Ga0373955_0003321 Ga0373955_0003321_3508_4404 275
592 3300035172 Ga0373955_0204464 Ga0373955_0204464_232_1098 275
593 3300035410 Ga0373924_0018352 Ga0373924_0018352_254_1150 275
594 3300035410 Ga0373924_0098473 Ga0373924_0098473_283_1155 275
595 3300035691 Ga0373931_0005867 Ga0373931_0005867_2643_3509 275
596 3300035724 Ga0373933_0017567 Ga0373933_0017567_1984_2880 275
597 3300035724 Ga0373933_0054262 Ga0373933_0054262_1300_2172 275
598 3300035725 Ga0373947_0007711 Ga0373947_0007711_1585_2481 275
599 3300036401 Ga0373937_0007300 Ga0373937_0007300_2720_3592 275
600 3300036401 Ga0373937_0183687 Ga0373937_0183687_444_1316 275
601 3300037853 Ga0436364_0045810 Ga0436364_0045810_39486_40343 275
602 3300037853 Ga0436364_0074751 Ga0436364_0074751_531_1442 275
603 3300037853 Ga0436364_0560348 Ga0436364_0560348_4789_5679 275
604 3300037853 Ga0436364_1388557 Ga0436364_1388557_557_1459 275
605 3300039437 Ga0436365_0247847 Ga0436365_0247847_899_1792 275
606 3300039453 Ga0436362_0770758 Ga0436362_0770758_767_1660 275
607 3300046454 Ga0495592_0107423 Ga0495592_0107423_765_1637 275
608 3300046454 Ga0495592_0226780 Ga0495592_0226780_168_1040 275
609 3300046455 Ga0495603_0006306 Ga0495603_0006306_1758_2654 275
610 3300046459 Ga0495629_0039097 Ga0495629_0039097_90_986 275
611 3300046461 Ga0495641_0006421 Ga0495641_0006421_2407_3303 275
612 3300046463 Ga0495653_0084033 Ga0495653_0084033_1181_2077 275
613 3300046472 Ga0495580_0014361 Ga0495580_0014361_2815_3711 275
614 3300046476 Ga0495662_0006459 Ga0495662_0006459_1844_2740 275
615 3300046477 Ga0495664_0023197 Ga0495664_0023197_2378_3274 275
616 3300046477 Ga0495664_0092039 Ga0495664_0092039_390_1289 275
617 3300046499 Ga0495594_0030336 Ga0495594_0030336_697_1593 275
618 3300046511 Ga0495608_0047479 Ga0495608_0047479_1761_2657 275
619 3300046511 Ga0495608_0064403 Ga0495608_0064403_626_1492 275
620 3300046516 Ga0495628_0021547 Ga0495628_0021547_255_1127 275
621 3300046516 Ga0495628_0064060 Ga0495628_0064060_269_1165 275
622 3300046526 Ga0495666_0030922 Ga0495666_0030922_770_1666 275
623 3300046529 Ga0495652_0076250 Ga0495652_0076250_1745_2641 275
624 3300046531 Ga0495665_0084242 Ga0495665_0084242_441_1334 275
625 3300046533 Ga0495640_0019259 Ga0495640_0019259_235_1128 275
626 3300046533 Ga0495640_0070064 Ga0495640_0070064_692_1588 275
627 3300046535 Ga0495586_0010847 Ga0495586_0010847_3853_4749 275
628 3300046536 Ga0495587_0034121 Ga0495587_0034121_1482_2378 275
629 3300046543 Ga0495645_0012919 Ga0495645_0012919_3334_4230 275
630 3300046543 Ga0495645_0224481 Ga0495645_0224481_343_1215 275
631 3300046559 Ga0495667_0026313 Ga0495667_0026313_3033_3905 275
632 3300046642 Ga0495634_0019680 Ga0495634_0019680_564_1460 275
633 3300046663 Ga0495635_0015774 Ga0495635_0015774_1965_2861 275
634 3300046678 Ga0495599_0080216 Ga0495599_0080216_325_1221 275
635 3300046678 Ga0495599_0182392 Ga0495599_0182392_366_1238 275
636 3300046679 Ga0495623_0047270 Ga0495623_0047270_423_1319 275
637 3300046680 Ga0495646_0069815 Ga0495646_0069815_1083_1979 275
638 3300046681 Ga0495647_0019753 Ga0495647_0019753_658_1554 275
639 3300046689 Ga0495613_0001071 Ga0495613_0001071_14783_15679 275
640 3300046690 Ga0495624_0171631 Ga0495624_0171631_410_1303 275
641 3300046809 Ga0495600_0039229 Ga0495600_0039229_770_1666 275
642 3300047315 Ga0495581_0008179 Ga0495581_0008179_3115_4011 275
643 3300047317 Ga0495604_0005122 Ga0495604_0005122_67_939 275
644 3300047319 Ga0495674_0011662 Ga0495674_0011662_7284_8177 275
645 3300047321 Ga0495676_0044684 Ga0495676_0044684_2625_3521 275
646 3300047322 Ga0495680_0042620 Ga0495680_0042620_2378_3274 275
647 3300047444 Ga0495675_0019590 Ga0495675_0019590_2113_3009 275
648 3300047471 Ga0495684_0012319 Ga0495684_0012319_2678_3550 275
649 3300048089 Ga0495614_0005476 Ga0495614_0005476_1444_2340 275
650 3300048910 Ga0496107_0080836 Ga0496107_0080836_324_1190 275
651 3300048911 Ga0496108_0122700 Ga0496108_0122700_721_1587 275
652 3300048913 Ga0496110_0008562 Ga0496110_0008562_1186_2052 275
653 3300048915 Ga0496112_0269684 Ga0496112_0269684_568_1434 275
654 3300048917 Ga0496114_0011756 Ga0496114_0011756_5316_6182 275
655 3300048918 Ga0496115_0016813 Ga0496115_0016813_147_1043 275
656 3300050507 nmdc:mga05p37_13433_c1 nmdc:mga05p37_13433_c1_3736_4611 275
657 3300050512 nmdc:mga0n895_11679_c1 nmdc:mga0n895_11679_c1_2369_3250 275
658 3300050512 nmdc:mga0n895_35802_c1 nmdc:mga0n895_35802_c1_1486_2361 275
659 3300050513 nmdc:mga0rr50_26444_c1 nmdc:mga0rr50_26444_c1_1903_2778 275
660 3300050513 nmdc:mga0rr50_360_c1 nmdc:mga0rr50_360_c1_10416_11297 275
661 3300050513 nmdc:mga0rr50_7550_c1 nmdc:mga0rr50_7550_c1_2654_3520 275
662 3300050514 nmdc:mga08x19_24655_c1 nmdc:mga08x19_24655_c1_1114_1989 275
663 3300050514 nmdc:mga08x19_3815_c1 nmdc:mga08x19_3815_c1_5444_6325 275
664 3300050515 nmdc:mga0a205_18826_c1 nmdc:mga0a205_18826_c1_4564_5445 275
665 3300050515 nmdc:mga0a205_24802_c1 nmdc:mga0a205_24802_c1_4683_5558 275
666 3300053078 Ga0495612_0003598 Ga0495612_0003598_93_989 275
667 3300053078 Ga0495612_0146152 Ga0495612_0146152_15_908 275
668 3300053084 Ga0495595_0032134 Ga0495595_0032134_776_1672 275
669 3300053085 Ga0495619_0002859 Ga0495619_0002859_10024_10920 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00809

Pterin_bind

Pterin binding enzyme

24

248

0.92

PF03599

CdhD

CO dehydrogenase/acetyl-CoA synthase delta subunit

43

207

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f6y-assembly1.cif.gz_B mad crystal structure analysis of methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase (metr) 0.94 21 269
2yck-assembly1.cif.gz_X methyltransferase bound with tetrahydrofolate 0.9398 17 269
1q85-assembly2.cif.gz_B cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+ complex, se-met) 0.9384 1 268
1q7q-assembly2.cif.gz_B cobalamin-dependent methionine synthase (1-566) from t. maritima (oxidized, orthorhombic) 0.9381 1 268
1q7q-assembly1.cif.gz_A cobalamin-dependent methionine synthase (1-566) from t. maritima (oxidized, orthorhombic) 0.9377 1 269
ID Description Score Start End Superfamily
1f6yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.94 21 269 3.20.20.20
1q8jB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.933 4 268 3.20.20.20
1q8jB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9258 4 268 3.20.20.20
4o1eB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.8914 18 273 3.20.20.20
1f6yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.891 21 269 3.20.20.20
ID Description Score Start End GO Terms
AF-A0A432H0E4-F1-model_v4 Methyltetrahydrofolate cobalamin methyltransferase 0.9832 2 178 GO:0005829
GO:0008705
GO:0032259
GO:0046653
GO:0046872
GO:0050667
AF-A0A383DDN4-F1-model_v4 Pterin-binding domain-containing protein 0.9797 1 139 GO:0005829
GO:0008705
GO:0032259
GO:0046653
GO:0046872
GO:0050667
AF-A0A316TLL8-F1-model_v4 Methyltetrahydrofolate--corrinoid methyltransferase 0.9778 1 274 GO:0005829
GO:0008705
GO:0032259
GO:0046653
GO:0046872
GO:0050667
AF-A0A3C1U407-F1-model_v4 Methyltetrahydrofolate--corrinoid methyltransferase 0.9767 2 243 GO:0005829
GO:0008705
GO:0032259
GO:0046653
GO:0046872
GO:0050667
AF-A0A7C2ITA9-F1-model_v4 deleted 0.9762 1 113

Feature Viewer

pLDDT pTM Quality
92.44 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map