F474016

General Info

Members Datasets Scaffolds Average Seq Length
669 266 669 338

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10206390|Ga0207648_102063901
Length 406
Sequence LAVRKLFGTDGVRGVAGQFLTAELAPRVLIVRDPRESGEMLEAAVAAGVAXXXXEALLGGVLPTPGAPLLLDRHGRPLRNLRLSVTDRCNLRCSYCMPEAEYAWLPREDILHFEEIERLVDIFVSLGVDKVRLTGGEPLLRRDMPELVRRLATRSGIADLAMTTNGVLLAAHAGALKDAGLHRMTVSLDTLDPARFKALTRYDELDRVLAGIAAASPLFPGLKIDTVVIRGVNDDELVALIEYGATHGAEVRFIEYMDVGGATHWSMNRVVSRREVLERLEAHYGAIAPIVESSSAPADRFRLPDGRVFGIISSTTEPFCHACDRSRLTADGLWYLCLYAPRGTDLRKVLRGGASDEEIAELVRATWSRRADRGAEVRLASGDRSPLIPLDGLRTDPHLEMHTRGG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
161 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
186 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 1.64
Rhizosphere 97.61
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10023907 3300003203 Bacteria 2406
2 JGI25407J50210_10009937 3300003373 Bacteria 2416
3 JGI26141J51220_1000130 3300003503 Bacteria 3686
4 Ga0065715_10001125 3300005293 Bacteria 11430
5 Ga0070676_10017001 3300005328 Bacteria 4021
6 Ga0070676_10017597 3300005328 Bacteria 3955
7 Ga0070690_100069050 3300005330 Bacteria 2293
8 Ga0070690_100151733 3300005330 Bacteria 1582
9 Ga0070670_100015266 3300005331 Bacteria 6592
10 Ga0070670_100045773 3300005331 Bacteria 3761
11 Ga0070670_100084332 3300005331 Bacteria 2730
12 Ga0068869_100001281 3300005334 Bacteria 14862
13 Ga0068869_100030552 3300005334 Bacteria 3783
14 Ga0068869_100079657 3300005334 Bacteria 2441
15 Ga0070680_100011104 3300005336 Bacteria 6963
16 Ga0070682_100000940 3300005337 Bacteria 16941
17 Ga0070660_100006007 3300005339 Bacteria 8394
18 Ga0070689_100047342 3300005340 Bacteria 3316
19 Ga0070691_10003618 3300005341 Bacteria 6977
20 Ga0070687_100018714 3300005343 Bacteria 3209
21 Ga0070687_100043337 3300005343 Bacteria 2286
22 Ga0070661_100005220 3300005344 Bacteria 8944
23 Ga0070692_10000406 3300005345 Bacteria 12905
24 Ga0070692_10006643 3300005345 Bacteria 5034
25 Ga0070668_100106202 3300005347 Bacteria 2231
26 Ga0070669_100021948 3300005353 Bacteria 4565
27 Ga0070669_100051495 3300005353 Bacteria 3010
28 Ga0070669_100295857 3300005353 Bacteria 1301
29 Ga0070675_100001343 3300005354 Bacteria 18014
30 Ga0070675_100004816 3300005354 Bacteria 10299
31 Ga0070675_100046718 3300005354 Bacteria 3546
32 Ga0070673_100014940 3300005364 Bacteria 5434
33 Ga0070688_100053051 3300005365 Bacteria 2535
34 Ga0070688_100076231 3300005365 Bacteria 2157
35 Ga0070688_100126091 3300005365 Bacteria 1721
36 Ga0070659_100003412 3300005366 Bacteria 11322
37 Ga0070667_100137791 3300005367 Bacteria 2135
38 Ga0070703_10001999 3300005406 Bacteria 5961
39 Ga0070703_10035917 3300005406 Bacteria 1520
40 Ga0070713_100032883 3300005436 Bacteria 4148
41 Ga0070701_10008204 3300005438 Bacteria 4503
42 Ga0070701_10050537 3300005438 Bacteria 2153
43 Ga0070701_10136554 3300005438 Bacteria 1398
44 Ga0070705_100002212 3300005440 Bacteria 9882
45 Ga0070705_100026162 3300005440 Bacteria 3173
46 Ga0070705_100097542 3300005440 Bacteria 1848
47 Ga0070694_100000718 3300005444 Bacteria 18439
48 Ga0070694_100082136 3300005444 Bacteria 2243
49 Ga0070708_100005307 3300005445 Bacteria 10213
50 Ga0070708_100023197 3300005445 Bacteria 5273
51 Ga0070708_100026182 3300005445 Bacteria 4990
52 Ga0070708_100065829 3300005445 Bacteria 3250
53 Ga0070708_100096190 3300005445 Bacteria 2705
54 Ga0070708_100153372 3300005445 Bacteria 2143
55 Ga0070708_100177898 3300005445 Bacteria 1988
56 Ga0070708_100339892 3300005445 Bacteria 1415
57 Ga0070663_100012132 3300005455 Bacteria 5438
58 Ga0070663_100017114 3300005455 Bacteria 4723
59 Ga0070678_100028714 3300005456 Bacteria 3798
60 Ga0070678_100139996 3300005456 Bacteria 1935
61 Ga0070678_100269459 3300005456 Bacteria 1435
62 Ga0070662_100039211 3300005457 Bacteria 3369
63 Ga0070681_10054099 3300005458 Bacteria 3999
64 Ga0068867_100051560 3300005459 Bacteria 3035
65 Ga0068867_100069344 3300005459 Bacteria 2633
66 Ga0070706_100009915 3300005467 Bacteria 8844
67 Ga0070706_100022362 3300005467 Bacteria 5823
68 Ga0070706_100042363 3300005467 Bacteria 4206
69 Ga0070706_100088898 3300005467 Bacteria 2864
70 Ga0070706_100093088 3300005467 Bacteria 2796
71 Ga0070706_100123458 3300005467 Bacteria 2414
72 Ga0070706_100362669 3300005467 Bacteria 1350
73 Ga0070707_100001535 3300005468 Bacteria 22487
74 Ga0070707_100011624 3300005468 Bacteria 8214
75 Ga0070707_100053084 3300005468 Bacteria 3885
76 Ga0070707_100147609 3300005468 Bacteria 2289
77 Ga0070707_100203415 3300005468 Bacteria 1930
78 Ga0070698_100000147 3300005471 Bacteria 63668
79 Ga0070698_100009771 3300005471 Bacteria 10256
80 Ga0070698_100057921 3300005471 Bacteria 3919
81 Ga0070698_100075625 3300005471 Bacteria 3371
82 Ga0070698_100149447 3300005471 Bacteria 2284
83 Ga0070698_100386670 3300005471 Bacteria 1332
84 Ga0070699_100006894 3300005518 Bacteria 9882
85 Ga0070699_100012706 3300005518 Bacteria 7258
86 Ga0070699_100020863 3300005518 Bacteria 5650
87 Ga0070699_100029408 3300005518 Bacteria 4737
88 Ga0070699_100029925 3300005518 Bacteria 4697
89 Ga0070699_100064343 3300005518 Bacteria 3181
90 Ga0070699_100120880 3300005518 Bacteria 2303
91 Ga0070699_100220015 3300005518 Bacteria 1692
92 Ga0070679_100000882 3300005530 Bacteria 26065
93 Ga0070679_100076878 3300005530 Bacteria 3327
94 Ga0070697_100006030 3300005536 Bacteria 9375
95 Ga0070697_100015152 3300005536 Bacteria 6053
96 Ga0070697_100028482 3300005536 Bacteria 4473
97 Ga0070697_100054536 3300005536 Bacteria 3249
98 Ga0070697_100186272 3300005536 Bacteria 1760
99 Ga0070697_100284831 3300005536 Bacteria 1418
100 Ga0068853_100000850 3300005539 Bacteria 21319
101 Ga0070672_100013577 3300005543 Bacteria 5759
102 Ga0070672_100067652 3300005543 Bacteria 2831
103 Ga0070672_100137539 3300005543 Bacteria 2012
104 Ga0070695_100002551 3300005545 Bacteria 10518
105 Ga0070695_100003065 3300005545 Bacteria 9724
106 Ga0070695_100008967 3300005545 Bacteria 5943
107 Ga0070695_100104305 3300005545 Bacteria 1914
108 Ga0070695_100297317 3300005545 Bacteria 1192
109 Ga0070696_100003134 3300005546 Bacteria 11012
110 Ga0070696_100044141 3300005546 Bacteria 3086
111 Ga0070693_100000018 3300005547 Bacteria 62344
112 Ga0070665_100035594 3300005548 Bacteria 5007
113 Ga0070665_100122418 3300005548 Bacteria 2603
114 Ga0070665_100281882 3300005548 Bacteria 1664
115 Ga0070704_100013680 3300005549 Bacteria 5046
116 Ga0070704_100015371 3300005549 Bacteria 4807
117 Ga0070704_100231345 3300005549 Bacteria 1508
118 Ga0068855_100000233 3300005563 Bacteria 70757
119 Ga0070664_100026984 3300005564 Bacteria 4770
120 Ga0068857_100034376 3300005577 Bacteria 4484
121 Ga0068857_100111420 3300005577 Bacteria 2460
122 Ga0068854_100000372 3300005578 Bacteria 28633
123 Ga0068856_100002918 3300005614 Bacteria 17513
124 Ga0068856_100245269 3300005614 Bacteria 1806
125 Ga0070702_100111155 3300005615 Bacteria 1699
126 Ga0068859_100014301 3300005617 Bacteria 7960
127 Ga0068859_100070347 3300005617 Bacteria 3534
128 Ga0068859_100219928 3300005617 Bacteria 1987
129 Ga0068859_100484606 3300005617 Bacteria 1332
130 Ga0068864_100031079 3300005618 Bacteria 4529
131 Ga0068864_100082030 3300005618 Bacteria 2829
132 Ga0068864_100137320 3300005618 Bacteria 2203
133 Ga0068866_10053459 3300005718 Bacteria 2065
134 Ga0068861_100042189 3300005719 Bacteria 3419
135 Ga0068861_100085635 3300005719 Bacteria 2476
136 Ga0068861_100177558 3300005719 Bacteria 1770
137 Ga0068851_10021993 3300005834 Bacteria 3101
138 Ga0068851_10126146 3300005834 Bacteria 1380
139 Ga0068870_10000164 3300005840 Bacteria 23543
140 Ga0068870_10140283 3300005840 Bacteria 1413
141 Ga0068863_100018837 3300005841 Bacteria 6606
142 Ga0068863_100039352 3300005841 Bacteria 4499
143 Ga0068863_100110013 3300005841 Bacteria 2623
144 Ga0068858_100060334 3300005842 Bacteria 3506
145 Ga0068860_100023167 3300005843 Bacteria 6003
146 Ga0068860_100039573 3300005843 Bacteria 4510
147 Ga0068860_100220548 3300005843 Bacteria 1841
148 Ga0068862_100035170 3300005844 Bacteria 4240
149 Ga0068862_100113377 3300005844 Bacteria 2382
150 Ga0068862_100118571 3300005844 Bacteria 2330
151 Ga0068862_100204643 3300005844 Bacteria 1781
152 Ga0068862_100354657 3300005844 Bacteria 1362
153 Ga0081455_10001913 3300005937 Bacteria 25012
154 Ga0081538_10002145 3300005981 Bacteria 19640
155 Ga0081538_10004506 3300005981 Bacteria 12822
156 Ga0081538_10024983 3300005981 Unclassified 4235
157 Ga0081540_1006769 3300005983 Bacteria 8287
158 Ga0081539_10000775 3300005985 Bacteria 62812
159 Ga0097621_100154795 3300006237 Bacteria 1967
160 Ga0097621_100182007 3300006237 Bacteria 1816
161 Ga0097621_100299659 3300006237 Bacteria 1419
162 Ga0075428_100003207 3300006844 Bacteria 17888
163 Ga0075428_100010839 3300006844 Bacteria 10133
164 Ga0075430_100003525 3300006846 Bacteria 13095
165 Ga0075430_100008074 3300006846 Bacteria 8894
166 Ga0075430_100046471 3300006846 Bacteria 3667
167 Ga0075430_100085038 3300006846 Bacteria 2649
168 Ga0075431_100003509 3300006847 Bacteria 15193
169 Ga0075431_100007612 3300006847 Bacteria 10784
170 Ga0075431_100011019 3300006847 Bacteria 9100
171 Ga0075431_100022099 3300006847 Bacteria 6506
172 Ga0075431_100023739 3300006847 Bacteria 6277
173 Ga0075433_10000305 3300006852 Bacteria 29652
174 Ga0075433_10032999 3300006852 Bacteria 4436
175 Ga0075433_10043134 3300006852 Bacteria 3915
176 Ga0075433_10066518 3300006852 Bacteria 3163
177 Ga0075433_10235906 3300006852 Bacteria 1624
178 Ga0075434_100000107 3300006871 Bacteria 47551
179 Ga0075434_100004736 3300006871 Bacteria 12304
180 Ga0075434_100012802 3300006871 Bacteria 7962
181 Ga0075434_100032542 3300006871 Bacteria 5142
182 Ga0075434_100079651 3300006871 Bacteria 3272
183 Ga0075434_100174198 3300006871 Bacteria 2171
184 Ga0075429_100011821 3300006880 Bacteria 7569
185 Ga0075429_100017667 3300006880 Bacteria 6169
186 Ga0075429_100219076 3300006880 Bacteria 1667
187 Ga0068865_100006094 3300006881 Bacteria 7355
188 Ga0075436_100079572 3300006914 Bacteria 2270
189 Ga0075436_100201299 3300006914 Bacteria 1410
190 Ga0097620_100014301 3300006931 Bacteria 7960
191 Ga0097620_100070348 3300006931 Bacteria 3534
192 Ga0097620_100219929 3300006931 Bacteria 1987
193 Ga0097620_100484648 3300006931 Bacteria 1332
194 Ga0075435_100002197 3300007076 Bacteria 12874
195 Ga0075435_100008350 3300007076 Bacteria 7424
196 Ga0075435_100025026 3300007076 Bacteria 4641
197 Ga0075435_100058668 3300007076 Bacteria 3118
198 Ga0075435_100239810 3300007076 Bacteria 1542
199 Ga0099794_10009292 3300007265 Bacteria 4127
200 Ga0099794_10011374 3300007265 Bacteria 3808
201 Ga0099794_10033254 3300007265 Bacteria 2424
202 Ga0105240_10039733 3300009093 Bacteria 6022
203 Ga0105240_10075893 3300009093 Bacteria 4145
204 Ga0111539_10001802 3300009094 Bacteria 28518
205 Ga0111539_10007082 3300009094 Bacteria 14373
206 Ga0111539_10014329 3300009094 Bacteria 9899
207 Ga0111539_10096225 3300009094 Bacteria 3477
208 Ga0111539_10500207 3300009094 Bacteria 1416
209 Ga0114129_10000026 3300009147 Bacteria 113517
210 Ga0114129_10005676 3300009147 Bacteria 17663
211 Ga0114129_10006211 3300009147 Bacteria 16946
212 Ga0114129_10008312 3300009147 Bacteria 14808
213 Ga0114129_10023313 3300009147 Bacteria 8780
214 Ga0114129_10033308 3300009147 Bacteria 7281
215 Ga0114129_10056999 3300009147 Bacteria 5470
216 Ga0114129_10057391 3300009147 Bacteria 5448
217 Ga0114129_10067395 3300009147 Bacteria 4992
218 Ga0114129_10094659 3300009147 Bacteria 4137
219 Ga0114129_10116736 3300009147 Bacteria 3677
220 Ga0114129_10129065 3300009147 Bacteria 3474
221 Ga0114129_10250363 3300009147 Bacteria 2378
222 Ga0114129_10879259 3300009147 Bacteria 1137
223 Ga0105243_10065279 3300009148 Bacteria 2923
224 Ga0105243_10111908 3300009148 Bacteria 2286
225 Ga0105241_10203100 3300009174 Bacteria 1657
226 Ga0105242_10014087 3300009176 Bacteria 6189
227 Ga0105248_10104872 3300009177 Bacteria 3187
228 Ga0105248_10453353 3300009177 Bacteria 1445
229 Ga0105248_10527950 3300009177 Bacteria 1331
230 Ga0105248_10701086 3300009177 Bacteria 1142
231 Ga0105249_10032354 3300009553 Bacteria 4731
232 Ga0105249_10249963 3300009553 Bacteria 1758
233 Ga0105246_10031604 3300011119 Bacteria 3504
234 Ga0105246_10056987 3300011119 Bacteria 2703
235 Ga0157373_10000292 3300013100 Bacteria 40273
236 Ga0157369_10043156 3300013105 Bacteria 4916
237 Ga0163162_10097126 3300013306 Bacteria 3034
238 Ga0163162_10159768 3300013306 Bacteria 2375
239 Ga0157372_10001109 3300013307 Bacteria 29268
240 Ga0157372_10010311 3300013307 Bacteria 9928
241 Ga0157375_10088409 3300013308 Bacteria 3153
242 Ga0157375_10096361 3300013308 Bacteria 3031
243 Ga0157375_10302882 3300013308 Bacteria 1762
244 Ga0157375_10622558 3300013308 Bacteria 1237
245 Ga0163163_10015430 3300014325 Bacteria 7063
246 Ga0163163_10138267 3300014325 Bacteria 2477
247 Ga0157380_10005737 3300014326 Bacteria 8686
248 Ga0157380_10106836 3300014326 Bacteria 2343
249 Ga0157380_10140582 3300014326 Bacteria 2074
250 Ga0157380_10367350 3300014326 Bacteria 1353
251 Ga0157376_10010193 3300014969 Bacteria 6862
252 Ga0157376_10042390 3300014969 Bacteria 3730
253 Ga0207697_10047862 3300025315 Bacteria 1763
254 Ga0207656_10034654 3300025321 Bacteria 2109
255 Ga0207653_10015948 3300025885 Bacteria 2358
256 Ga0207682_10005989 3300025893 Bacteria 4916
257 Ga0207688_10046132 3300025901 Bacteria 2432
258 Ga0207680_10080327 3300025903 Bacteria 2047
259 Ga0207685_10036488 3300025905 Bacteria 1803
260 Ga0207645_10017069 3300025907 Bacteria 4796
261 Ga0207645_10023503 3300025907 Bacteria 4006
262 Ga0207643_10007829 3300025908 Bacteria 5739
263 Ga0207684_10000782 3300025910 Bacteria 36914
264 Ga0207684_10002909 3300025910 Bacteria 16974
265 Ga0207684_10004060 3300025910 Bacteria 13977
266 Ga0207684_10006876 3300025910 Bacteria 10293
267 Ga0207684_10013669 3300025910 Bacteria 7014
268 Ga0207684_10019054 3300025910 Bacteria 5870
269 Ga0207684_10040389 3300025910 Bacteria 3955
270 Ga0207684_10160921 3300025910 Bacteria 1933
271 Ga0207684_10198158 3300025910 Bacteria 1732
272 Ga0207707_10010573 3300025912 Bacteria 8012
273 Ga0207660_10001271 3300025917 Bacteria 16932
274 Ga0207660_10023868 3300025917 Bacteria 4135
275 Ga0207662_10036173 3300025918 Bacteria 2885
276 Ga0207662_10059061 3300025918 Bacteria 2298
277 Ga0207657_10029843 3300025919 Bacteria 4957
278 Ga0207649_10010891 3300025920 Bacteria 5001
279 Ga0207652_10001130 3300025921 Bacteria 24020
280 Ga0207646_10000819 3300025922 Bacteria 40434
281 Ga0207646_10017570 3300025922 Bacteria 6687
282 Ga0207646_10039441 3300025922 Bacteria 4251
283 Ga0207646_10048185 3300025922 Bacteria 3820
284 Ga0207681_10017867 3300025923 Bacteria 4458
285 Ga0207650_10035391 3300025925 Bacteria 3625
286 Ga0207650_10043508 3300025925 Bacteria 3297
287 Ga0207650_10231081 3300025925 Bacteria 1492
288 Ga0207650_10245980 3300025925 Bacteria 1446
289 Ga0207659_10001244 3300025926 Bacteria 15262
290 Ga0207659_10085851 3300025926 Bacteria 2339
291 Ga0207659_10245753 3300025926 Bacteria 1450
292 Ga0207659_10373640 3300025926 Bacteria 1187
293 Ga0207690_10007207 3300025932 Bacteria 6604
294 Ga0207706_10002488 3300025933 Bacteria 17959
295 Ga0207706_10153653 3300025933 Bacteria 2024
296 Ga0207686_10210800 3300025934 Bacteria 1397
297 Ga0207709_10019990 3300025935 Bacteria 3773
298 Ga0207709_10067766 3300025935 Bacteria 2254
299 Ga0207709_10254895 3300025935 Bacteria 1283
300 Ga0207670_10095709 3300025936 Bacteria 2110
301 Ga0207669_10029625 3300025937 Bacteria 3030
302 Ga0207704_10127821 3300025938 Bacteria 1753
303 Ga0207691_10110850 3300025940 Bacteria 2440
304 Ga0207691_10130305 3300025940 Bacteria 2222
305 Ga0207691_10149292 3300025940 Bacteria 2056
306 Ga0207691_10156554 3300025940 Bacteria 2001
307 Ga0207711_10044986 3300025941 Bacteria 3771
308 Ga0207711_10052176 3300025941 Bacteria 3504
309 Ga0207711_10110266 3300025941 Bacteria 2447
310 Ga0207689_10001039 3300025942 Bacteria 26654
311 Ga0207689_10021833 3300025942 Bacteria 5382
312 Ga0207689_10029723 3300025942 Bacteria 4559
313 Ga0207689_10044495 3300025942 Bacteria 3671
314 Ga0207661_10076046 3300025944 Bacteria 2757
315 Ga0207679_10002961 3300025945 Bacteria 10527
316 Ga0207667_10003926 3300025949 Bacteria 18290
317 Ga0207651_10021287 3300025960 Bacteria 3938
318 Ga0207651_10305761 3300025960 Bacteria 1324
319 Ga0207712_10039512 3300025961 Bacteria 3233
320 Ga0207668_10088591 3300025972 Bacteria 2267
321 Ga0207640_10021139 3300025981 Bacteria 3873
322 Ga0207640_10298906 3300025981 Bacteria 1273
323 Ga0207658_10049553 3300025986 Bacteria 3087
324 Ga0207658_10089595 3300025986 Bacteria 2382
325 Ga0207658_10118921 3300025986 Bacteria 2103
326 Ga0207703_10036762 3300026035 Bacteria 3899
327 Ga0207703_10110692 3300026035 Bacteria 2343
328 Ga0207703_10243553 3300026035 Bacteria 1617
329 Ga0207639_10011499 3300026041 Bacteria 6151
330 Ga0207678_10008687 3300026067 Bacteria 8946
331 Ga0207678_10030208 3300026067 Bacteria 4730
332 Ga0207678_10128914 3300026067 Bacteria 2157
333 Ga0207708_10002040 3300026075 Bacteria 14886
334 Ga0207702_10007056 3300026078 Bacteria 9610
335 Ga0207641_10067124 3300026088 Bacteria 3072
336 Ga0207641_10146539 3300026088 Bacteria 2135
337 Ga0207648_10000066 3300026089 Bacteria 98414
338 Ga0207648_10033262 3300026089 Bacteria 4549
339 Ga0207648_10206390 3300026089 Bacteria 1744
340 Ga0207676_10020431 3300026095 Bacteria 4846
341 Ga0207676_10045952 3300026095 Bacteria 3376
342 Ga0207676_10115894 3300026095 Bacteria 2250
343 Ga0207676_10137315 3300026095 Bacteria 2088
344 Ga0207676_10392115 3300026095 Bacteria 1295
345 Ga0207674_10003899 3300026116 Bacteria 18151
346 Ga0207674_10129633 3300026116 Bacteria 2486
347 Ga0207675_100006665 3300026118 Bacteria 10926
348 Ga0207675_100045399 3300026118 Bacteria 4105
349 Ga0207675_100136095 3300026118 Bacteria 2331
350 Ga0207675_100190299 3300026118 Bacteria 1968
351 Ga0207683_10004061 3300026121 Bacteria 12648
352 Ga0207683_10018467 3300026121 Bacteria 5952
353 Ga0207683_10046315 3300026121 Bacteria 3805
354 Ga0207683_10276287 3300026121 Bacteria 1535
355 Ga0207683_10379000 3300026121 Bacteria 1300
356 Ga0209969_1012202 3300027360 Bacteria 1237
357 Ga0209982_1003541 3300027552 Bacteria 2220
358 Ga0209970_1001274 3300027614 Bacteria 4451
359 Ga0209983_1003116 3300027665 Bacteria 3563
360 Ga0209588_1009249 3300027671 Bacteria 2941
361 Ga0209588_1017800 3300027671 Bacteria 2206
362 Ga0209971_1000137 3300027682 Bacteria 21896
363 Ga0209966_1000354 3300027695 Bacteria 14029
364 Ga0209998_10000278 3300027717 Bacteria 16052
365 Ga0209974_10007141 3300027876 Bacteria 3860
366 Ga0207428_10000033 3300027907 Bacteria 232081
367 Ga0207428_10002954 3300027907 Bacteria 16826
368 Ga0207428_10122251 3300027907 Bacteria 1996
369 Ga0268266_10028066 3300028379 Bacteria 4785
370 Ga0268265_10017061 3300028380 Bacteria 5002
371 Ga0268265_10301343 3300028380 Bacteria 1443
372 Ga0268264_10025358 3300028381 Bacteria 4844
373 Ga0268264_10037611 3300028381 Bacteria 3990
374 Ga0268264_10112012 3300028381 Bacteria 2392
375 Ga0268264_10190561 3300028381 Bacteria 1869
376 Ga0268264_10456841 3300028381 Bacteria 1238
377 Ga0268264_10538039 3300028381 Bacteria 1144
378 Ga0307515_10049339 3300028794 Bacteria 6337
379 Ga0307512_10031311 3300030522 Bacteria 4609
380 Ga0265328_10035938 3300031239 Bacteria 1831
381 Ga0307513_10029541 3300031456 Bacteria 6248
382 Ga0307408_100010076 3300031548 Bacteria 6230
383 Ga0307408_100148423 3300031548 Bacteria 1848
384 Ga0307405_10024796 3300031731 Bacteria 3433
385 Ga0307405_10189894 3300031731 Bacteria 1483
386 Ga0307413_10167763 3300031824 Bacteria 1550
387 Ga0307410_10042958 3300031852 Bacteria 2991
388 Ga0307410_10085475 3300031852 Bacteria 2226
389 Ga0307406_10225755 3300031901 Bacteria 1395
390 Ga0307412_10016513 3300031911 Bacteria 4399
391 Ga0307409_100078399 3300031995 Bacteria 2657
392 Ga0307409_100091023 3300031995 Bacteria 2499
393 Ga0307409_100098836 3300031995 Bacteria 2415
394 Ga0307416_100007740 3300032002 Bacteria 6867
395 Ga0307416_100064162 3300032002 Bacteria 3012
396 Ga0307416_100298176 3300032002 Bacteria 1600
397 Ga0307411_10085568 3300032005 Bacteria 2184
398 Ga0307411_10086825 3300032005 Bacteria 2171
399 Ga0307415_100054902 3300032126 Bacteria 2722
400 Ga0307415_100302346 3300032126 Bacteria 1326
401 Ga0373958_0012670 3300034819 Bacteria 1447
402 Ga0373959_0003281 3300034820 Bacteria 2572
403 Ga0373940_0022042 3300035088 Bacteria 1634
404 Ga0373949_0003845 3300035090 Bacteria 3490
405 Ga0373949_0037316 3300035090 Bacteria 1181
406 Ga0373951_0003206 3300035091 Bacteria 4001
407 Ga0373931_0007813 3300035691 Bacteria 5054
408 Ga0373937_0151723 3300036401 Bacteria 2171
409 Ga0395899_0024461 3300037312 Bacteria 4566
410 Ga0395900_0037014 3300037418 Bacteria 5031
411 Ga0395900_0124565 3300037418 Bacteria 2643
412 Ga0395898_0022130 3300037466 Bacteria 6440
413 Ga0395901_0000800 3300038443 Bacteria 34936
414 Ga0451853_0590954 3300041512 Bacteria 3599
415 Ga0439463_052271 3300042016 Bacteria 1042
416 Ga0439458_0000856 3300042157 Bacteria 7869
417 Ga0439434_0027643 3300042435 Bacteria 1716
418 Ga0439464_0003106 3300042439 Bacteria 4156
419 Ga0439460_0001555 3300042461 Bacteria 5409
420 Ga0451577_0033452 3300042876 Bacteria 4634
421 Ga0451577_0082237 3300042876 Bacteria 2872
422 Ga0451577_0087060 3300042876 Bacteria 2787
423 Ga0451577_0243300 3300042876 Bacteria 1628
424 Ga0451577_0268561 3300042876 Bacteria 1545
425 Ga0453683_0035844 3300044673 Bacteria 3124
426 Ga0453683_0139244 3300044673 Bacteria 1531
427 Ga0453684_0160502 3300044712 Bacteria 2660
428 Ga0453684_0234930 3300044712 Bacteria 2114
429 Ga0466957_0221388 3300044842 Bacteria 1250
430 Ga0451576_0006452 3300045051 Bacteria 14383
431 Ga0451576_0050144 3300045051 Bacteria 4379
432 Ga0451576_0079038 3300045051 Bacteria 3422
433 Ga0451576_0086331 3300045051 Bacteria 3263
434 Ga0451576_0220849 3300045051 Bacteria 1978
435 Ga0451576_0239194 3300045051 Bacteria 1897
436 Ga0451576_0339570 3300045051 Bacteria 1572
437 Ga0495603_0091807 3300046455 Bacteria 1775
438 Ga0495638_0089174 3300046460 Bacteria 1861
439 Ga0495580_0001704 3300046472 Bacteria 19309
440 Ga0495580_0004134 3300046472 Bacteria 12232
441 Ga0495580_0021322 3300046472 Bacteria 4781
442 Ga0495662_0096726 3300046476 Bacteria 1443
443 Ga0495608_0006020 3300046511 Bacteria 8621
444 Ga0495628_0001735 3300046516 Bacteria 19829
445 Ga0495628_0012923 3300046516 Bacteria 7030
446 Ga0495628_0159152 3300046516 Bacteria 1717
447 Ga0495642_0035352 3300046528 Bacteria 2016
448 Ga0495640_0035527 3300046533 Bacteria 3527
449 Ga0495640_0102881 3300046533 Bacteria 1873
450 Ga0495667_0062495 3300046559 Bacteria 2440
451 Ga0495656_0055350 3300046615 Bacteria 1710
452 Ga0495635_0212766 3300046663 Bacteria 1309
453 Ga0495659_0037464 3300046664 Bacteria 1718
454 Ga0495588_0092919 3300046674 Bacteria 1581
455 Ga0495669_0058935 3300046684 Bacteria 1733
456 Ga0495674_0160825 3300047319 Bacteria 1879
457 Ga0495614_0098382 3300048089 Bacteria 1277
458 Ga0496101_0038412 3300048904 Bacteria 3401
459 Ga0496104_0027085 3300048907 Bacteria 5301
460 Ga0496106_0056733 3300048909 Bacteria 2961
461 Ga0496107_0256157 3300048910 Bacteria 1302
462 Ga0496108_0020778 3300048911 Bacteria 5397
463 Ga0496109_0001763 3300048912 Bacteria 17979
464 Ga0496110_0043201 3300048913 Bacteria 3935
465 Ga0496112_0001651 3300048915 Bacteria 17324
466 Ga0496113_0056221 3300048916 Bacteria 2953
467 Ga0496114_0203591 3300048917 Bacteria 1734
468 Ga0496114_0359884 3300048917 Bacteria 1287
469 Ga0501033_0033751 3300049570 Bacteria 3842
470 Ga0501033_0043722 3300049570 Bacteria 3336
471 Ga0501033_0049919 3300049570 Bacteria 3105
472 Ga0501033_0230787 3300049570 Bacteria 1315
473 Ga0501033_0243433 3300049570 Bacteria 1276
474 Ga0501034_0028788 3300049571 Bacteria 5652
475 Ga0501036_0009822 3300049572 Bacteria 7880
476 Ga0501036_0030397 3300049572 Bacteria 4563
477 Ga0501036_0114144 3300049572 Bacteria 2283
478 Ga0501036_0152082 3300049572 Bacteria 1952
479 Ga0501036_0161392 3300049572 Bacteria 1890
480 Ga0501036_0250896 3300049572 Bacteria 1483
481 Ga0501036_0342010 3300049572 Bacteria 1250
482 Ga0501037_0166525 3300049573 Bacteria 1569
483 Ga0501038_0056475 3300049574 Bacteria 3371
484 Ga0501038_0268471 3300049574 Bacteria 1346
485 Ga0501039_0038953 3300049575 Bacteria 3671
486 Ga0501039_0332974 3300049575 Bacteria 1193
487 Ga0501040_0001869 3300049576 Bacteria 13503
488 Ga0501040_0003568 3300049576 Bacteria 10063
489 Ga0501040_0004654 3300049576 Bacteria 8903
490 Ga0501040_0073285 3300049576 Bacteria 2366
491 Ga0501040_0147158 3300049576 Bacteria 1661
492 Ga0501041_0009193 3300049577 Bacteria 5821
493 Ga0501041_0014660 3300049577 Bacteria 4654
494 Ga0501041_0044228 3300049577 Bacteria 2707
495 Ga0501041_0215551 3300049577 Bacteria 1204
496 Ga0501042_0001174 3300049578 Bacteria 15170
497 Ga0501042_0002362 3300049578 Bacteria 11573
498 Ga0501042_0003676 3300049578 Bacteria 9671
499 Ga0501042_0028657 3300049578 Bacteria 3926
500 Ga0501042_0322487 3300049578 Bacteria 1116
501 Ga0501046_0009939 3300049580 Bacteria 8197
502 Ga0501046_0046076 3300049580 Bacteria 3462
503 Ga0501046_0109902 3300049580 Bacteria 2107
504 Ga0501046_0150184 3300049580 Bacteria 1758
505 Ga0501047_0033160 3300049581 Bacteria 4985
506 Ga0501047_0379649 3300049581 Bacteria 1248
507 Ga0501048_0035731 3300049582 Bacteria 3575
508 Ga0501048_0237094 3300049582 Bacteria 1294
509 Ga0501067_0009421 3300049583 Bacteria 5411
510 Ga0501068_0014096 3300049584 Bacteria 4564
511 Ga0501068_0015010 3300049584 Bacteria 4440
512 Ga0501068_0052752 3300049584 Bacteria 2461
513 Ga0501071_0007644 3300049587 Bacteria 7122
514 Ga0501071_0049024 3300049587 Bacteria 3039
515 Ga0501071_0113915 3300049587 Bacteria 2000
516 Ga0501071_0179048 3300049587 Bacteria 1588
517 Ga0501071_0224263 3300049587 Bacteria 1415
518 Ga0501071_0261554 3300049587 Bacteria 1307
519 Ga0501072_0001344 3300049588 Bacteria 18413
520 Ga0501072_0003788 3300049588 Bacteria 11420
521 Ga0501072_0016206 3300049588 Bacteria 5717
522 Ga0501072_0038075 3300049588 Bacteria 3775
523 Ga0501072_0061364 3300049588 Bacteria 2965
524 Ga0501072_0094873 3300049588 Bacteria 2371
525 Ga0501073_0124322 3300049589 Bacteria 1788
526 Ga0501074_0013593 3300049590 Bacteria 5918
527 Ga0501074_0058038 3300049590 Bacteria 2788
528 Ga0501074_0126110 3300049590 Bacteria 1831
529 Ga0501075_0004490 3300049591 Bacteria 9450
530 Ga0501075_0007341 3300049591 Bacteria 7645
531 Ga0501075_0016313 3300049591 Bacteria 5348
532 Ga0501075_0024123 3300049591 Bacteria 4455
533 Ga0501075_0034077 3300049591 Bacteria 3790
534 Ga0501075_0123861 3300049591 Bacteria 1968
535 Ga0501075_0154890 3300049591 Bacteria 1747
536 Ga0501075_0298052 3300049591 Bacteria 1228
537 Ga0501075_0328099 3300049591 Bacteria 1166
538 Ga0501075_0403613 3300049591 Bacteria 1042
539 Ga0501076_0003486 3300049592 Bacteria 11051
540 Ga0501076_0009184 3300049592 Bacteria 7289
541 Ga0501076_0022777 3300049592 Bacteria 4818
542 Ga0501076_0024869 3300049592 Bacteria 4632
543 Ga0501076_0030135 3300049592 Bacteria 4225
544 Ga0501076_0055384 3300049592 Bacteria 3145
545 Ga0501076_0088951 3300049592 Bacteria 2482
546 Ga0501076_0185539 3300049592 Bacteria 1696
547 Ga0501076_0423857 3300049592 Bacteria 1095
548 Ga0501077_0010203 3300049593 Bacteria 5849
549 Ga0501077_0022486 3300049593 Bacteria 3994
550 Ga0501077_0037763 3300049593 Bacteria 3075
551 Ga0501079_0006450 3300049741 Bacteria 8812
552 Ga0501079_0007316 3300049741 Bacteria 8341
553 Ga0501079_0019688 3300049741 Bacteria 5155
554 Ga0501079_0111906 3300049741 Bacteria 2122
555 Ga0501079_0126509 3300049741 Bacteria 1988
556 Ga0501079_0181078 3300049741 Bacteria 1644
557 Ga0501080_0038130 3300049742 Bacteria 4488
558 Ga0501080_0086478 3300049742 Bacteria 2913
559 Ga0501080_0088096 3300049742 Bacteria 2884
560 Ga0501080_0136483 3300049742 Bacteria 2270
561 Ga0501081_0002753 3300049743 Bacteria 11146
562 Ga0501081_0003490 3300049743 Bacteria 10051
563 Ga0501081_0006156 3300049743 Bacteria 7773
564 Ga0501081_0006694 3300049743 Bacteria 7490
565 Ga0501081_0006909 3300049743 Bacteria 7374
566 Ga0501081_0097109 3300049743 Bacteria 2079
567 Ga0501081_0117111 3300049743 Bacteria 1895
568 Ga0501081_0147783 3300049743 Bacteria 1687
569 Ga0501081_0222429 3300049743 Bacteria 1373
570 Ga0501081_0301912 3300049743 Bacteria 1175
571 Ga0501081_0312634 3300049743 Bacteria 1154
572 Ga0501081_0324829 3300049743 Bacteria 1131
573 Ga0501035_0444547 3300049822 Bacteria 1073
574 Ga0501044_0016417 3300049823 Bacteria 7948
575 Ga0501045_0000340 3300049824 Bacteria 27693
576 Ga0501045_0022534 3300049824 Bacteria 4511
577 Ga0501045_0035346 3300049824 Bacteria 3628
578 Ga0501045_0052866 3300049824 Bacteria 2967
579 Ga0501045_0157311 3300049824 Bacteria 1691
580 nmdc:mga05p37_120524_c1 3300050507 Bacteria 3223
581 nmdc:mga05p37_134102_c1 3300050507 Bacteria 3038
582 nmdc:mga05p37_13734_c1 3300050507 Bacteria 9703
583 nmdc:mga05p37_30941_c1 3300050507 Bacteria 6535
584 nmdc:mga05p37_35081_c1 3300050507 Bacteria 6149
585 nmdc:mga05p37_3828_c1 3300050507 Bacteria 17597
586 nmdc:mga05p37_39684_c1 3300050507 Bacteria 5780
587 nmdc:mga05p37_486453_c1 3300050507 Bacteria 1420
588 nmdc:mga05p37_546910_c1 3300050507 Bacteria 1319
589 nmdc:mga05p37_683066_c1 3300050507 Bacteria 1144
590 nmdc:mga05p37_7057_c1 3300050507 Bacteria 13242
591 nmdc:mga05p37_9544_c1 3300050507 Bacteria 11492
592 nmdc:mga09592_1842_c1 3300050508 Bacteria 17047
593 nmdc:mga09592_27860_c1 3300050508 Bacteria 4690
594 nmdc:mga09592_299673_c1 3300050508 Bacteria 1394
595 nmdc:mga09592_360504_c1 3300050508 Bacteria 1258
596 nmdc:mga09592_90362_c1 3300050508 Bacteria 2616
597 nmdc:mga0qj67_151403_c1 3300050509 Bacteria 1882
598 nmdc:mga0qj67_2581_c1 3300050509 Bacteria 12955
599 nmdc:mga0qj67_66067_c1 3300050509 Bacteria 2880
600 nmdc:mga0qj67_9351_c1 3300050509 Bacteria 7289
601 nmdc:mga06r32_118866_c1 3300050510 Bacteria 2606
602 nmdc:mga06r32_164351_c1 3300050510 Bacteria 2202
603 nmdc:mga06r32_16710_c1 3300050510 Bacteria 6689
604 nmdc:mga06r32_21876_c1 3300050510 Bacteria 5906
605 nmdc:mga06r32_27719_c1 3300050510 Bacteria 5295
606 nmdc:mga06r32_50067_c1 3300050510 Bacteria 3996
607 nmdc:mga06r32_8196_c1 3300050510 Bacteria 9404
608 nmdc:mga06r32_99737_c1 3300050510 Bacteria 2849
609 nmdc:mga08y16_2189_c1 3300050511 Bacteria 20051
610 nmdc:mga08y16_43295_c1 3300050511 Bacteria 4718
611 nmdc:mga08y16_5112_c1 3300050511 Bacteria 13706
612 nmdc:mga08y16_60756_c1 3300050511 Bacteria 3947
613 nmdc:mga08y16_90648_c1 3300050511 Bacteria 3187
614 nmdc:mga0n895_108653_c1 3300050512 Bacteria 2789
615 nmdc:mga0n895_25456_c1 3300050512 Bacteria 5591
616 nmdc:mga0n895_3140_c1 3300050512 Bacteria 13183
617 nmdc:mga0n895_74813_c1 3300050512 Bacteria 3366
618 nmdc:mga0rr50_107886_c1 3300050513 Bacteria 2199
619 nmdc:mga0rr50_110799_c1 3300050513 Bacteria 2172
620 nmdc:mga0rr50_158228_c1 3300050513 Bacteria 1837
621 nmdc:mga0rr50_28588_c1 3300050513 Bacteria 3920
622 nmdc:mga0rr50_46108_c1 3300050513 Bacteria 3208
623 nmdc:mga0rr50_51144_c1 3300050513 Bacteria 3065
624 nmdc:mga0rr50_6438_c1 3300050513 Bacteria 7148
625 nmdc:mga0rr50_79833_c1 3300050513 Bacteria 2521
626 nmdc:mga08x19_17940_c1 3300050514 Bacteria 4334
627 nmdc:mga08x19_67016_c1 3300050514 Bacteria 2335
628 nmdc:mga08x19_98478_c1 3300050514 Bacteria 1937
629 nmdc:mga0a205_14434_c1 3300050515 Bacteria 7368
630 nmdc:mga0a205_175563_c1 3300050515 Unclassified 2038
631 nmdc:mga0a205_20368_c1 3300050515 Bacteria 6256
632 nmdc:mga0a205_261593_c1 3300050515 Bacteria 1608
633 nmdc:mga0a205_28188_c2 3300050515 Bacteria 4329
634 nmdc:mga0a205_32_c1 3300050515 Bacteria 79060
635 nmdc:mga0a205_64122_c1 3300050515 Bacteria 3549
636 Ga0495601_0066542 3300053077 Bacteria 2294
637 Ga0495595_0031552 3300053084 Bacteria 2382
638 Ga0495619_0055479 3300053085 Bacteria 2624
639 Ga0500568_0002127 3300053139 Bacteria 11957
640 Ga0501084_0006596 3300054114 Bacteria 9540
641 Ga0501084_0008353 3300054114 Bacteria 8547
642 Ga0501084_0013589 3300054114 Bacteria 6737
643 Ga0501084_0018144 3300054114 Bacteria 5860
644 Ga0501084_0107065 3300054114 Bacteria 2349
645 Ga0501084_0116990 3300054114 Bacteria 2241
646 Ga0501084_0142449 3300054114 Bacteria 2019
647 Ga0501084_0174837 3300054114 Bacteria 1812
648 Ga0501084_0228081 3300054114 Bacteria 1572
649 Ga0501084_0382226 3300054114 Bacteria 1190
650 Ga0590071_012209 3300059421 Bacteria 2013
651 Ga0590075_006024 3300059424 Bacteria 2870
652 Ga0590077_001701 3300059426 Bacteria 5003
653 Ga0590077_002796 3300059426 Bacteria 3673
654 Ga0501082_0002155 3300060353 Bacteria 17252
655 Ga0501082_0004795 3300060353 Bacteria 11797
656 Ga0501082_0066055 3300060353 Bacteria 3115
657 Ga0501082_0115887 3300060353 Bacteria 2320
658 Ga0501082_0152616 3300060353 Bacteria 2007
659 Ga0501082_0177809 3300060353 Bacteria 1850
660 Ga0501082_0275053 3300060353 Bacteria 1466
661 Ga0501082_0411911 3300060353 Bacteria 1180
662 Ga0530510_0001210 3300061734 Bacteria 17226
663 Ga0530510_0013034 3300061734 Bacteria 5848
664 Ga0530510_0038469 3300061734 Bacteria 3454
665 Ga0530510_0115266 3300061734 Bacteria 1970
666 Ga0530510_0176812 3300061734 Bacteria 1582
667 Ga0530510_0200404 3300061734 Bacteria 1482
668 Ga0530510_0218830 3300061734 Bacteria 1415
669 Ga0530510_0352543 3300061734 Bacteria 1105

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10879259 Ga0114129_108792592 279
2 3300050515 nmdc:mga0a205_175563_c1 nmdc:mga0a205_175563_c1_11_862 279
3 3300049587 Ga0501071_0261554 Ga0501071_0261554_14_892 291
4 3300045051 Ga0451576_0220849 Ga0451576_0220849_1070_1960 295
5 3300049574 Ga0501038_0056475 Ga0501038_0056475_555_1487 299
6 3300049580 Ga0501046_0046076 Ga0501046_0046076_2248_3171 306
7 3300049592 Ga0501076_0055384 Ga0501076_0055384_650_1576 306
8 3300049592 Ga0501076_0024869 Ga0501076_0024869_3692_4621 308
9 3300005445 Ga0070708_100096190 Ga0070708_1000961902 310
10 3300005467 Ga0070706_100022362 Ga0070706_1000223622 310
11 3300005468 Ga0070707_100147609 Ga0070707_1001476092 310
12 3300005536 Ga0070697_100284831 Ga0070697_1002848311 310
13 3300007076 Ga0075435_100239810 Ga0075435_1002398102 310
14 3300025910 Ga0207684_10019054 Ga0207684_100190542 310
15 3300025910 Ga0207684_10040389 Ga0207684_100403892 310
16 3300025910 Ga0207684_10198158 Ga0207684_101981582 310
17 3300025922 Ga0207646_10039441 Ga0207646_100394413 310
18 3300044673 Ga0453683_0139244 Ga0453683_0139244_524_1459 310
19 3300049576 Ga0501040_0147158 Ga0501040_0147158_674_1609 310
20 3300049577 Ga0501041_0215551 Ga0501041_0215551_207_1142 310
21 3300049591 Ga0501075_0403613 Ga0501075_0403613_86_1021 310
22 3300049592 Ga0501076_0423857 Ga0501076_0423857_23_958 310
23 3300049741 Ga0501079_0126509 Ga0501079_0126509_1034_1969 310
24 3300049743 Ga0501081_0147783 Ga0501081_0147783_43_978 310
25 3300049743 Ga0501081_0222429 Ga0501081_0222429_425_1360 310
26 3300049743 Ga0501081_0301912 Ga0501081_0301912_40_975 310
27 3300049743 Ga0501081_0312634 Ga0501081_0312634_187_1122 310
28 3300049743 Ga0501081_0324829 Ga0501081_0324829_142_1077 310
29 3300049822 Ga0501035_0444547 Ga0501035_0444547_53_988 310
30 3300050507 nmdc:mga05p37_683066_c1 nmdc:mga05p37_683066_c1_99_1034 310
31 3300050507 nmdc:mga05p37_7057_c1 nmdc:mga05p37_7057_c1_5347_6282 310
32 3300050508 nmdc:mga09592_360504_c1 nmdc:mga09592_360504_c1_303_1238 310
33 3300050509 nmdc:mga0qj67_151403_c1 nmdc:mga0qj67_151403_c1_772_1707 310
34 3300050510 nmdc:mga06r32_50067_c1 nmdc:mga06r32_50067_c1_1819_2754 310
35 3300050512 nmdc:mga0n895_25456_c1 nmdc:mga0n895_25456_c1_258_1193 310
36 3300050513 nmdc:mga0rr50_107886_c1 nmdc:mga0rr50_107886_c1_346_1368 310
37 3300050513 nmdc:mga0rr50_51144_c1 nmdc:mga0rr50_51144_c1_1852_2787 310
38 3300050514 nmdc:mga08x19_98478_c1 nmdc:mga08x19_98478_c1_74_1096 310
39 3300050515 nmdc:mga0a205_14434_c1 nmdc:mga0a205_14434_c1_258_1193 310
40 3300060353 Ga0501082_0177809 Ga0501082_0177809_50_985 310
41 3300061734 Ga0530510_0218830 Ga0530510_0218830_453_1388 310
42 3300006871 Ga0075434_100012802 Ga0075434_1000128026 314
43 3300007076 Ga0075435_100025026 Ga0075435_1000250262 314
44 3300035088 Ga0373940_0022042 Ga0373940_0022042_145_1167 314
45 3300042876 Ga0451577_0268561 Ga0451577_0268561_139_1161 314
46 3300045051 Ga0451576_0086331 Ga0451576_0086331_995_2017 314
47 3300046472 Ga0495580_0004134 Ga0495580_0004134_2300_3322 314
48 3300046528 Ga0495642_0035352 Ga0495642_0035352_149_1171 314
49 3300046516 Ga0495628_0012923 Ga0495628_0012923_5870_6892 318
50 3300009177 Ga0105248_10527950 Ga0105248_105279501 319
51 3300005471 Ga0070698_100386670 Ga0070698_1003866701 324
52 3300009553 Ga0105249_10249963 Ga0105249_102499632 324
53 3300005549 Ga0070704_100231345 Ga0070704_1002313452 325
54 3300005436 Ga0070713_100032883 Ga0070713_1000328834 326
55 3300005844 Ga0068862_100118571 Ga0068862_1001185712 326
56 3300028380 Ga0268265_10301343 Ga0268265_103013431 326
57 3300049570 Ga0501033_0049919 Ga0501033_0049919_198_1214 327
58 3300049572 Ga0501036_0009822 Ga0501036_0009822_313_1329 327
59 3300049573 Ga0501037_0166525 Ga0501037_0166525_95_1111 327
60 3300049576 Ga0501040_0003568 Ga0501040_0003568_6312_7328 327
61 3300049577 Ga0501041_0009193 Ga0501041_0009193_4315_5331 327
62 3300049578 Ga0501042_0002362 Ga0501042_0002362_4093_5109 327
63 3300049580 Ga0501046_0009939 Ga0501046_0009939_3543_4559 327
64 3300049587 Ga0501071_0007644 Ga0501071_0007644_3803_4819 327
65 3300049588 Ga0501072_0003788 Ga0501072_0003788_6733_7749 327
66 3300049590 Ga0501074_0126110 Ga0501074_0126110_294_1310 327
67 3300049592 Ga0501076_0030135 Ga0501076_0030135_1344_2360 327
68 3300049593 Ga0501077_0037763 Ga0501077_0037763_491_1507 327
69 3300049741 Ga0501079_0019688 Ga0501079_0019688_494_1510 327
70 3300049742 Ga0501080_0038130 Ga0501080_0038130_519_1535 327
71 3300049743 Ga0501081_0002753 Ga0501081_0002753_6484_7500 327
72 3300049824 Ga0501045_0022534 Ga0501045_0022534_2999_4015 327
73 3300054114 Ga0501084_0008353 Ga0501084_0008353_1580_2596 327
74 3300060353 Ga0501082_0004795 Ga0501082_0004795_6467_7483 327
75 3300061734 Ga0530510_0001210 Ga0530510_0001210_14104_15120 327
76 3300005330 Ga0070690_100151733 Ga0070690_1001517332 329
77 3300005340 Ga0070689_100047342 Ga0070689_1000473423 329
78 3300005365 Ga0070688_100076231 Ga0070688_1000762313 329
79 3300005367 Ga0070667_100137791 Ga0070667_1001377913 329
80 3300005548 Ga0070665_100122418 Ga0070665_1001224184 329
81 3300005617 Ga0068859_100070347 Ga0068859_1000703473 329
82 3300005834 Ga0068851_10126146 Ga0068851_101261462 329
83 3300005841 Ga0068863_100039352 Ga0068863_1000393521 329
84 3300006237 Ga0097621_100299659 Ga0097621_1002996592 329
85 3300006931 Ga0097620_100070348 Ga0097620_1000703482 329
86 3300013308 Ga0157375_10096361 Ga0157375_100963612 329
87 3300014969 Ga0157376_10042390 Ga0157376_100423904 329
88 3300025903 Ga0207680_10080327 Ga0207680_100803272 329
89 3300025926 Ga0207659_10373640 Ga0207659_103736401 329
90 3300025940 Ga0207691_10130305 Ga0207691_101303053 329
91 3300025941 Ga0207711_10052176 Ga0207711_100521763 329
92 3300025986 Ga0207658_10089595 Ga0207658_100895952 329
93 3300026067 Ga0207678_10128914 Ga0207678_101289141 329
94 3300026095 Ga0207676_10137315 Ga0207676_101373152 329
95 3300026121 Ga0207683_10004061 Ga0207683_100040611 329
96 3300028379 Ga0268266_10028066 Ga0268266_100280664 329
97 3300050515 nmdc:mga0a205_20368_c1 nmdc:mga0a205_20368_c1_30_1025 330
98 3300046533 Ga0495640_0035527 Ga0495640_0035527_1898_2914 333
99 3300046663 Ga0495635_0212766 Ga0495635_0212766_70_1086 333
100 3300005293 Ga0065715_10001125 Ga0065715_100011258 334
101 3300005331 Ga0070670_100045773 Ga0070670_1000457735 334
102 3300005343 Ga0070687_100043337 Ga0070687_1000433373 334
103 3300005354 Ga0070675_100004816 Ga0070675_1000048162 334
104 3300005365 Ga0070688_100053051 Ga0070688_1000530513 334
105 3300005365 Ga0070688_100126091 Ga0070688_1001260912 334
106 3300005438 Ga0070701_10136554 Ga0070701_101365541 334
107 3300005456 Ga0070678_100028714 Ga0070678_1000287144 334
108 3300005543 Ga0070672_100013577 Ga0070672_1000135773 334
109 3300005548 Ga0070665_100035594 Ga0070665_1000355944 334
110 3300005614 Ga0068856_100245269 Ga0068856_1002452692 334
111 3300005617 Ga0068859_100484606 Ga0068859_1004846061 334
112 3300005618 Ga0068864_100082030 Ga0068864_1000820303 334
113 3300005719 Ga0068861_100085635 Ga0068861_1000856353 334
114 3300005841 Ga0068863_100110013 Ga0068863_1001100133 334
115 3300005844 Ga0068862_100204643 Ga0068862_1002046433 334
116 3300006237 Ga0097621_100182007 Ga0097621_1001820072 334
117 3300006852 Ga0075433_10235906 Ga0075433_102359062 334
118 3300006914 Ga0075436_100201299 Ga0075436_1002012992 334
119 3300006931 Ga0097620_100484648 Ga0097620_1004846481 334
120 3300009093 Ga0105240_10075893 Ga0105240_100758933 334
121 3300009147 Ga0114129_10250363 Ga0114129_102503632 334
122 3300009177 Ga0105248_10104872 Ga0105248_101048722 334
123 3300009177 Ga0105248_10701086 Ga0105248_107010861 334
124 3300009553 Ga0105249_10032354 Ga0105249_100323544 334
125 3300011119 Ga0105246_10031604 Ga0105246_100316045 334
126 3300013306 Ga0163162_10097126 Ga0163162_100971264 334
127 3300013308 Ga0157375_10302882 Ga0157375_103028821 334
128 3300014325 Ga0163163_10138267 Ga0163163_101382674 334
129 3300014326 Ga0157380_10106836 Ga0157380_101068362 334
130 3300025315 Ga0207697_10047862 Ga0207697_100478622 334
131 3300025918 Ga0207662_10059061 Ga0207662_100590611 334
132 3300025925 Ga0207650_10043508 Ga0207650_100435082 334
133 3300025925 Ga0207650_10231081 Ga0207650_102310812 334
134 3300025926 Ga0207659_10085851 Ga0207659_100858512 334
135 3300025936 Ga0207670_10095709 Ga0207670_100957093 334
136 3300025940 Ga0207691_10110850 Ga0207691_101108503 334
137 3300025941 Ga0207711_10044986 Ga0207711_100449865 334
138 3300025944 Ga0207661_10076046 Ga0207661_100760463 334
139 3300025960 Ga0207651_10021287 Ga0207651_100212871 334
140 3300025961 Ga0207712_10039512 Ga0207712_100395123 334
141 3300025972 Ga0207668_10088591 Ga0207668_100885912 334
142 3300026088 Ga0207641_10067124 Ga0207641_100671243 334
143 3300026095 Ga0207676_10045952 Ga0207676_100459523 334
144 3300026121 Ga0207683_10018467 Ga0207683_100184674 334
145 3300026121 Ga0207683_10046315 Ga0207683_100463151 334
146 3300036401 Ga0373937_0151723 Ga0373937_0151723_359_1372 334
147 3300044842 Ga0466957_0221388 Ga0466957_0221388_201_1217 334
148 3300048904 Ga0496101_0038412 Ga0496101_0038412_297_1331 334
149 3300048907 Ga0496104_0027085 Ga0496104_0027085_1676_2710 334
150 3300048910 Ga0496107_0256157 Ga0496107_0256157_218_1252 334
151 3300048911 Ga0496108_0020778 Ga0496108_0020778_1952_2986 334
152 3300048912 Ga0496109_0001763 Ga0496109_0001763_3231_4265 334
153 3300048913 Ga0496110_0043201 Ga0496110_0043201_341_1375 334
154 3300048915 Ga0496112_0001651 Ga0496112_0001651_12904_13938 334
155 3300048916 Ga0496113_0056221 Ga0496113_0056221_177_1211 334
156 3300049571 Ga0501034_0028788 Ga0501034_0028788_1038_2054 334
157 3300049581 Ga0501047_0379649 Ga0501047_0379649_60_1076 334
158 3300049823 Ga0501044_0016417 Ga0501044_0016417_6456_7472 334
159 3300050511 nmdc:mga08y16_90648_c1 nmdc:mga08y16_90648_c1_1168_2184 334
160 3300050513 nmdc:mga0rr50_46108_c1 nmdc:mga0rr50_46108_c1_542_1558 334
161 3300054114 Ga0501084_0382226 Ga0501084_0382226_152_1168 334
162 3300059421 Ga0590071_012209 Ga0590071_012209_611_1696 334
163 3300060353 Ga0501082_0411911 Ga0501082_0411911_89_1105 334
164 3300003503 JGI26141J51220_1000130 JGI26141J51220_10001304 335
165 3300005457 Ga0070662_100039211 Ga0070662_1000392113 335
166 3300005530 Ga0070679_100076878 Ga0070679_1000768783 335
167 3300005545 Ga0070695_100002551 Ga0070695_1000025517 335
168 3300005937 Ga0081455_10001913 Ga0081455_100019136 335
169 3300009093 Ga0105240_10039733 Ga0105240_100397334 335
170 3300009147 Ga0114129_10033308 Ga0114129_100333086 335
171 3300013307 Ga0157372_10010311 Ga0157372_100103118 335
172 3300025933 Ga0207706_10153653 Ga0207706_101536531 335
173 3300027360 Ga0209969_1012202 Ga0209969_10122022 335
174 3300027552 Ga0209982_1003541 Ga0209982_10035413 335
175 3300027614 Ga0209970_1001274 Ga0209970_10012748 335
176 3300027665 Ga0209983_1003116 Ga0209983_10031163 335
177 3300027682 Ga0209971_1000137 Ga0209971_100013723 335
178 3300027695 Ga0209966_1000354 Ga0209966_10003544 335
179 3300027717 Ga0209998_10000278 Ga0209998_1000027815 335
180 3300027876 Ga0209974_10007141 Ga0209974_100071414 335
181 3300042439 Ga0439464_0003106 Ga0439464_0003106_2240_3253 335
182 3300042461 Ga0439460_0001555 Ga0439460_0001555_1584_2597 335
183 3300042876 Ga0451577_0087060 Ga0451577_0087060_1604_2617 335
184 3300049570 Ga0501033_0043722 Ga0501033_0043722_2078_3091 335
185 3300049572 Ga0501036_0152082 Ga0501036_0152082_543_1556 335
186 3300049572 Ga0501036_0342010 Ga0501036_0342010_70_1092 335
187 3300049576 Ga0501040_0001869 Ga0501040_0001869_137_1150 335
188 3300049577 Ga0501041_0044228 Ga0501041_0044228_519_1532 335
189 3300049578 Ga0501042_0001174 Ga0501042_0001174_54_1067 335
190 3300049581 Ga0501047_0033160 Ga0501047_0033160_1789_2802 335
191 3300049582 Ga0501048_0035731 Ga0501048_0035731_2181_3194 335
192 3300049584 Ga0501068_0015010 Ga0501068_0015010_1032_2045 335
193 3300049587 Ga0501071_0049024 Ga0501071_0049024_1679_2692 335
194 3300049588 Ga0501072_0061364 Ga0501072_0061364_365_1378 335
195 3300049589 Ga0501073_0124322 Ga0501073_0124322_223_1236 335
196 3300049590 Ga0501074_0013593 Ga0501074_0013593_2729_3742 335
197 3300049591 Ga0501075_0024123 Ga0501075_0024123_589_1602 335
198 3300049591 Ga0501075_0328099 Ga0501075_0328099_122_1144 335
199 3300049593 Ga0501077_0022486 Ga0501077_0022486_420_1433 335
200 3300049741 Ga0501079_0007316 Ga0501079_0007316_5108_6121 335
201 3300049742 Ga0501080_0088096 Ga0501080_0088096_1618_2631 335
202 3300049743 Ga0501081_0006909 Ga0501081_0006909_2177_3190 335
203 3300049824 Ga0501045_0000340 Ga0501045_0000340_8425_9438 335
204 3300050508 nmdc:mga09592_299673_c1 nmdc:mga09592_299673_c1_304_1332 335
205 3300054114 Ga0501084_0013589 Ga0501084_0013589_3448_4461 335
206 3300054114 Ga0501084_0142449 Ga0501084_0142449_865_1878 335
207 3300060353 Ga0501082_0002155 Ga0501082_0002155_13553_14566 335
208 3300061734 Ga0530510_0352543 Ga0530510_0352543_69_1091 335
209 3300005328 Ga0070676_10017001 Ga0070676_100170015 336
210 3300005330 Ga0070690_100069050 Ga0070690_1000690502 336
211 3300005331 Ga0070670_100084332 Ga0070670_1000843324 336
212 3300005334 Ga0068869_100079657 Ga0068869_1000796574 336
213 3300005353 Ga0070669_100021948 Ga0070669_1000219485 336
214 3300005353 Ga0070669_100295857 Ga0070669_1002958571 336
215 3300005354 Ga0070675_100001343 Ga0070675_10000134310 336
216 3300005354 Ga0070675_100046718 Ga0070675_1000467183 336
217 3300005364 Ga0070673_100014940 Ga0070673_1000149405 336
218 3300005406 Ga0070703_10035917 Ga0070703_100359172 336
219 3300005440 Ga0070705_100097542 Ga0070705_1000975421 336
220 3300005455 Ga0070663_100017114 Ga0070663_1000171144 336
221 3300005456 Ga0070678_100139996 Ga0070678_1001399962 336
222 3300005456 Ga0070678_100269459 Ga0070678_1002694592 336
223 3300005459 Ga0068867_100069344 Ga0068867_1000693443 336
224 3300005467 Ga0070706_100362669 Ga0070706_1003626691 336
225 3300005468 Ga0070707_100203415 Ga0070707_1002034152 336
226 3300005471 Ga0070698_100075625 Ga0070698_1000756252 336
227 3300005543 Ga0070672_100067652 Ga0070672_1000676523 336
228 3300005545 Ga0070695_100297317 Ga0070695_1002973171 336
229 3300005548 Ga0070665_100281882 Ga0070665_1002818822 336
230 3300005615 Ga0070702_100111155 Ga0070702_1001111551 336
231 3300005617 Ga0068859_100219928 Ga0068859_1002199283 336
232 3300005618 Ga0068864_100137320 Ga0068864_1001373203 336
233 3300005718 Ga0068866_10053459 Ga0068866_100534592 336
234 3300005719 Ga0068861_100042189 Ga0068861_1000421893 336
235 3300005719 Ga0068861_100177558 Ga0068861_1001775582 336
236 3300005834 Ga0068851_10021993 Ga0068851_100219932 336
237 3300005840 Ga0068870_10140283 Ga0068870_101402831 336
238 3300005841 Ga0068863_100018837 Ga0068863_1000188378 336
239 3300006881 Ga0068865_100006094 Ga0068865_1000060948 336
240 3300006931 Ga0097620_100219929 Ga0097620_1002199292 336
241 3300009094 Ga0111539_10001802 Ga0111539_100018025 336
242 3300009176 Ga0105242_10014087 Ga0105242_100140874 336
243 3300009177 Ga0105248_10453353 Ga0105248_104533532 336
244 3300013308 Ga0157375_10088409 Ga0157375_100884093 336
245 3300013308 Ga0157375_10622558 Ga0157375_106225581 336
246 3300014325 Ga0163163_10015430 Ga0163163_100154309 336
247 3300014326 Ga0157380_10005737 Ga0157380_100057372 336
248 3300014326 Ga0157380_10140582 Ga0157380_101405823 336
249 3300014326 Ga0157380_10367350 Ga0157380_103673501 336
250 3300025321 Ga0207656_10034654 Ga0207656_100346542 336
251 3300025893 Ga0207682_10005989 Ga0207682_100059895 336
252 3300025907 Ga0207645_10017069 Ga0207645_100170695 336
253 3300025925 Ga0207650_10245980 Ga0207650_102459802 336
254 3300025926 Ga0207659_10001244 Ga0207659_100012449 336
255 3300025926 Ga0207659_10245753 Ga0207659_102457531 336
256 3300025934 Ga0207686_10210800 Ga0207686_102108002 336
257 3300025935 Ga0207709_10067766 Ga0207709_100677663 336
258 3300025937 Ga0207669_10029625 Ga0207669_100296252 336
259 3300025938 Ga0207704_10127821 Ga0207704_101278212 336
260 3300025940 Ga0207691_10156554 Ga0207691_101565542 336
261 3300025942 Ga0207689_10021833 Ga0207689_100218333 336
262 3300025942 Ga0207689_10029723 Ga0207689_100297236 336
263 3300025960 Ga0207651_10305761 Ga0207651_103057611 336
264 3300025981 Ga0207640_10298906 Ga0207640_102989062 336
265 3300025986 Ga0207658_10049553 Ga0207658_100495532 336
266 3300026035 Ga0207703_10110692 Ga0207703_101106921 336
267 3300026035 Ga0207703_10243553 Ga0207703_102435532 336
268 3300026067 Ga0207678_10030208 Ga0207678_100302085 336
269 3300026088 Ga0207641_10146539 Ga0207641_101465391 336
270 3300026089 Ga0207648_10000066 Ga0207648_100000663 336
271 3300026089 Ga0207648_10206390 Ga0207648_102063901 336
272 3300026095 Ga0207676_10020431 Ga0207676_100204312 336
273 3300026095 Ga0207676_10392115 Ga0207676_103921151 336
274 3300026118 Ga0207675_100006665 Ga0207675_1000066654 336
275 3300026118 Ga0207675_100136095 Ga0207675_1001360951 336
276 3300026118 Ga0207675_100190299 Ga0207675_1001902993 336
277 3300026121 Ga0207683_10276287 Ga0207683_102762872 336
278 3300026121 Ga0207683_10379000 Ga0207683_103790001 336
279 3300027907 Ga0207428_10002954 Ga0207428_100029542 336
280 3300028381 Ga0268264_10456841 Ga0268264_104568412 336
281 3300028794 Ga0307515_10049339 Ga0307515_100493394 336
282 3300031731 Ga0307405_10024796 Ga0307405_100247962 336
283 3300031852 Ga0307410_10042958 Ga0307410_100429582 336
284 3300031911 Ga0307412_10016513 Ga0307412_100165132 336
285 3300031995 Ga0307409_100078399 Ga0307409_1000783992 336
286 3300031995 Ga0307409_100091023 Ga0307409_1000910231 336
287 3300032002 Ga0307416_100007740 Ga0307416_1000077404 336
288 3300032002 Ga0307416_100298176 Ga0307416_1002981761 336
289 3300032005 Ga0307411_10086825 Ga0307411_100868251 336
290 3300032126 Ga0307415_100054902 Ga0307415_1000549021 336
291 3300041512 Ga0451853_0590954 Ga0451853_0590954_1320_2336 336
292 3300042876 Ga0451577_0082237 Ga0451577_0082237_65_1084 336
293 3300044712 Ga0453684_0160502 Ga0453684_0160502_671_1687 336
294 3300046455 Ga0495603_0091807 Ga0495603_0091807_134_1150 336
295 3300046460 Ga0495638_0089174 Ga0495638_0089174_386_1408 336
296 3300046511 Ga0495608_0006020 Ga0495608_0006020_3221_4243 336
297 3300046559 Ga0495667_0062495 Ga0495667_0062495_583_1605 336
298 3300046674 Ga0495588_0092919 Ga0495588_0092919_396_1412 336
299 3300048089 Ga0495614_0098382 Ga0495614_0098382_231_1247 336
300 3300048917 Ga0496114_0359884 Ga0496114_0359884_128_1177 336
301 3300049570 Ga0501033_0230787 Ga0501033_0230787_213_1244 336
302 3300049572 Ga0501036_0114144 Ga0501036_0114144_1115_2146 336
303 3300049576 Ga0501040_0004654 Ga0501040_0004654_316_1341 336
304 3300049577 Ga0501041_0014660 Ga0501041_0014660_1417_2442 336
305 3300049578 Ga0501042_0003676 Ga0501042_0003676_3766_4791 336
306 3300049582 Ga0501048_0237094 Ga0501048_0237094_21_1052 336
307 3300049587 Ga0501071_0113915 Ga0501071_0113915_953_1978 336
308 3300049591 Ga0501075_0007341 Ga0501075_0007341_4742_5767 336
309 3300049592 Ga0501076_0022777 Ga0501076_0022777_1486_2511 336
310 3300049743 Ga0501081_0003490 Ga0501081_0003490_3949_4974 336
311 3300050511 nmdc:mga08y16_2189_c1 nmdc:mga08y16_2189_c1_15444_16469 336
312 3300053139 Ga0500568_0002127 Ga0500568_0002127_9089_10111 336
313 3300059424 Ga0590075_006024 Ga0590075_006024_644_1660 336
314 3300059426 Ga0590077_001701 Ga0590077_001701_2468_3484 336
315 3300059426 Ga0590077_002796 Ga0590077_002796_758_1774 336
316 3300061734 Ga0530510_0115266 Ga0530510_0115266_495_1520 336
317 3300003203 JGI25406J46586_10023907 JGI25406J46586_100239072 337
318 3300003373 JGI25407J50210_10009937 JGI25407J50210_100099371 337
319 3300005328 Ga0070676_10017597 Ga0070676_100175972 337
320 3300005331 Ga0070670_100015266 Ga0070670_1000152666 337
321 3300005334 Ga0068869_100001281 Ga0068869_1000012817 337
322 3300005334 Ga0068869_100030552 Ga0068869_1000305524 337
323 3300005336 Ga0070680_100011104 Ga0070680_1000111043 337
324 3300005337 Ga0070682_100000940 Ga0070682_10000094017 337
325 3300005339 Ga0070660_100006007 Ga0070660_1000060077 337
326 3300005341 Ga0070691_10003618 Ga0070691_100036184 337
327 3300005343 Ga0070687_100018714 Ga0070687_1000187144 337
328 3300005344 Ga0070661_100005220 Ga0070661_1000052207 337
329 3300005345 Ga0070692_10000406 Ga0070692_100004068 337
330 3300005345 Ga0070692_10006643 Ga0070692_100066432 337
331 3300005347 Ga0070668_100106202 Ga0070668_1001062022 337
332 3300005353 Ga0070669_100051495 Ga0070669_1000514952 337
333 3300005366 Ga0070659_100003412 Ga0070659_1000034123 337
334 3300005406 Ga0070703_10001999 Ga0070703_100019997 337
335 3300005438 Ga0070701_10008204 Ga0070701_100082043 337
336 3300005438 Ga0070701_10050537 Ga0070701_100505372 337
337 3300005440 Ga0070705_100002212 Ga0070705_1000022124 337
338 3300005440 Ga0070705_100026162 Ga0070705_1000261623 337
339 3300005444 Ga0070694_100000718 Ga0070694_10000071812 337
340 3300005444 Ga0070694_100082136 Ga0070694_1000821363 337
341 3300005445 Ga0070708_100005307 Ga0070708_1000053072 337
342 3300005445 Ga0070708_100023197 Ga0070708_1000231975 337
343 3300005445 Ga0070708_100026182 Ga0070708_1000261825 337
344 3300005445 Ga0070708_100065829 Ga0070708_1000658292 337
345 3300005445 Ga0070708_100153372 Ga0070708_1001533723 337
346 3300005445 Ga0070708_100177898 Ga0070708_1001778982 337
347 3300005445 Ga0070708_100339892 Ga0070708_1003398922 337
348 3300005455 Ga0070663_100012132 Ga0070663_1000121326 337
349 3300005458 Ga0070681_10054099 Ga0070681_100540995 337
350 3300005459 Ga0068867_100051560 Ga0068867_1000515604 337
351 3300005467 Ga0070706_100009915 Ga0070706_1000099154 337
352 3300005467 Ga0070706_100042363 Ga0070706_1000423632 337
353 3300005467 Ga0070706_100088898 Ga0070706_1000888982 337
354 3300005467 Ga0070706_100093088 Ga0070706_1000930882 337
355 3300005467 Ga0070706_100123458 Ga0070706_1001234583 337
356 3300005468 Ga0070707_100001535 Ga0070707_10000153524 337
357 3300005468 Ga0070707_100011624 Ga0070707_1000116245 337
358 3300005468 Ga0070707_100053084 Ga0070707_1000530844 337
359 3300005471 Ga0070698_100000147 Ga0070698_10000014716 337
360 3300005471 Ga0070698_100009771 Ga0070698_1000097717 337
361 3300005471 Ga0070698_100057921 Ga0070698_1000579214 337
362 3300005471 Ga0070698_100149447 Ga0070698_1001494473 337
363 3300005518 Ga0070699_100006894 Ga0070699_1000068944 337
364 3300005518 Ga0070699_100012706 Ga0070699_1000127067 337
365 3300005518 Ga0070699_100020863 Ga0070699_1000208635 337
366 3300005518 Ga0070699_100029408 Ga0070699_1000294083 337
367 3300005518 Ga0070699_100029925 Ga0070699_1000299252 337
368 3300005518 Ga0070699_100064343 Ga0070699_1000643432 337
369 3300005518 Ga0070699_100120880 Ga0070699_1001208803 337
370 3300005518 Ga0070699_100220015 Ga0070699_1002200152 337
371 3300005530 Ga0070679_100000882 Ga0070679_1000008827 337
372 3300005536 Ga0070697_100006030 Ga0070697_1000060307 337
373 3300005536 Ga0070697_100015152 Ga0070697_1000151523 337
374 3300005536 Ga0070697_100028482 Ga0070697_1000284823 337
375 3300005536 Ga0070697_100054536 Ga0070697_1000545362 337
376 3300005536 Ga0070697_100186272 Ga0070697_1001862722 337
377 3300005539 Ga0068853_100000850 Ga0068853_1000008503 337
378 3300005543 Ga0070672_100137539 Ga0070672_1001375392 337
379 3300005545 Ga0070695_100003065 Ga0070695_1000030657 337
380 3300005545 Ga0070695_100008967 Ga0070695_1000089676 337
381 3300005545 Ga0070695_100104305 Ga0070695_1001043052 337
382 3300005546 Ga0070696_100003134 Ga0070696_1000031347 337
383 3300005546 Ga0070696_100044141 Ga0070696_1000441413 337
384 3300005547 Ga0070693_100000018 Ga0070693_1000000187 337
385 3300005549 Ga0070704_100013680 Ga0070704_1000136805 337
386 3300005549 Ga0070704_100015371 Ga0070704_1000153713 337
387 3300005563 Ga0068855_100000233 Ga0068855_10000023356 337
388 3300005564 Ga0070664_100026984 Ga0070664_1000269845 337
389 3300005577 Ga0068857_100034376 Ga0068857_1000343763 337
390 3300005577 Ga0068857_100111420 Ga0068857_1001114203 337
391 3300005578 Ga0068854_100000372 Ga0068854_1000003726 337
392 3300005614 Ga0068856_100002918 Ga0068856_10000291812 337
393 3300005617 Ga0068859_100014301 Ga0068859_1000143016 337
394 3300005618 Ga0068864_100031079 Ga0068864_1000310794 337
395 3300005840 Ga0068870_10000164 Ga0068870_1000016413 337
396 3300005842 Ga0068858_100060334 Ga0068858_1000603342 337
397 3300005843 Ga0068860_100023167 Ga0068860_1000231676 337
398 3300005843 Ga0068860_100039573 Ga0068860_1000395734 337
399 3300005843 Ga0068860_100220548 Ga0068860_1002205482 337
400 3300005844 Ga0068862_100035170 Ga0068862_1000351703 337
401 3300005844 Ga0068862_100113377 Ga0068862_1001133773 337
402 3300005844 Ga0068862_100354657 Ga0068862_1003546572 337
403 3300005981 Ga0081538_10002145 Ga0081538_100021457 337
404 3300005981 Ga0081538_10004506 Ga0081538_100045063 337
405 3300005981 Ga0081538_10024983 Ga0081538_100249833 337
406 3300005983 Ga0081540_1006769 Ga0081540_10067693 337
407 3300005985 Ga0081539_10000775 Ga0081539_1000077519 337
408 3300006237 Ga0097621_100154795 Ga0097621_1001547952 337
409 3300006844 Ga0075428_100003207 Ga0075428_1000032073 337
410 3300006844 Ga0075428_100010839 Ga0075428_10001083910 337
411 3300006846 Ga0075430_100003525 Ga0075430_10000352510 337
412 3300006846 Ga0075430_100008074 Ga0075430_1000080746 337
413 3300006846 Ga0075430_100046471 Ga0075430_1000464714 337
414 3300006846 Ga0075430_100085038 Ga0075430_1000850382 337
415 3300006847 Ga0075431_100003509 Ga0075431_1000035093 337
416 3300006847 Ga0075431_100007612 Ga0075431_1000076122 337
417 3300006847 Ga0075431_100011019 Ga0075431_1000110198 337
418 3300006847 Ga0075431_100022099 Ga0075431_1000220995 337
419 3300006847 Ga0075431_100023739 Ga0075431_1000237398 337
420 3300006852 Ga0075433_10000305 Ga0075433_1000030511 337
421 3300006852 Ga0075433_10032999 Ga0075433_100329993 337
422 3300006852 Ga0075433_10043134 Ga0075433_100431342 337
423 3300006852 Ga0075433_10066518 Ga0075433_100665182 337
424 3300006871 Ga0075434_100000107 Ga0075434_10000010748 337
425 3300006871 Ga0075434_100004736 Ga0075434_1000047366 337
426 3300006871 Ga0075434_100032542 Ga0075434_1000325423 337
427 3300006871 Ga0075434_100079651 Ga0075434_1000796512 337
428 3300006871 Ga0075434_100174198 Ga0075434_1001741982 337
429 3300006880 Ga0075429_100011821 Ga0075429_1000118212 337
430 3300006880 Ga0075429_100017667 Ga0075429_1000176675 337
431 3300006880 Ga0075429_100219076 Ga0075429_1002190762 337
432 3300006914 Ga0075436_100079572 Ga0075436_1000795723 337
433 3300006931 Ga0097620_100014301 Ga0097620_1000143016 337
434 3300007076 Ga0075435_100002197 Ga0075435_1000021971 337
435 3300007076 Ga0075435_100008350 Ga0075435_1000083503 337
436 3300007076 Ga0075435_100058668 Ga0075435_1000586682 337
437 3300007265 Ga0099794_10009292 Ga0099794_100092926 337
438 3300007265 Ga0099794_10011374 Ga0099794_100113744 337
439 3300007265 Ga0099794_10033254 Ga0099794_100332543 337
440 3300009094 Ga0111539_10007082 Ga0111539_100070828 337
441 3300009094 Ga0111539_10014329 Ga0111539_100143298 337
442 3300009094 Ga0111539_10096225 Ga0111539_100962252 337
443 3300009094 Ga0111539_10500207 Ga0111539_105002072 337
444 3300009147 Ga0114129_10000026 Ga0114129_1000002613 337
445 3300009147 Ga0114129_10005676 Ga0114129_100056762 337
446 3300009147 Ga0114129_10006211 Ga0114129_100062117 337
447 3300009147 Ga0114129_10008312 Ga0114129_100083122 337
448 3300009147 Ga0114129_10023313 Ga0114129_100233134 337
449 3300009147 Ga0114129_10056999 Ga0114129_100569994 337
450 3300009147 Ga0114129_10057391 Ga0114129_100573912 337
451 3300009147 Ga0114129_10067395 Ga0114129_100673953 337
452 3300009147 Ga0114129_10094659 Ga0114129_100946596 337
453 3300009147 Ga0114129_10116736 Ga0114129_101167363 337
454 3300009147 Ga0114129_10129065 Ga0114129_101290652 337
455 3300009148 Ga0105243_10065279 Ga0105243_100652792 337
456 3300009148 Ga0105243_10111908 Ga0105243_101119082 337
457 3300009174 Ga0105241_10203100 Ga0105241_102031002 337
458 3300011119 Ga0105246_10056987 Ga0105246_100569874 337
459 3300013100 Ga0157373_10000292 Ga0157373_1000029219 337
460 3300013105 Ga0157369_10043156 Ga0157369_100431566 337
461 3300013306 Ga0163162_10159768 Ga0163162_101597683 337
462 3300013307 Ga0157372_10001109 Ga0157372_100011097 337
463 3300014969 Ga0157376_10010193 Ga0157376_100101933 337
464 3300025885 Ga0207653_10015948 Ga0207653_100159483 337
465 3300025901 Ga0207688_10046132 Ga0207688_100461323 337
466 3300025905 Ga0207685_10036488 Ga0207685_100364882 337
467 3300025907 Ga0207645_10023503 Ga0207645_100235032 337
468 3300025908 Ga0207643_10007829 Ga0207643_100078293 337
469 3300025910 Ga0207684_10000782 Ga0207684_1000078213 337
470 3300025910 Ga0207684_10002909 Ga0207684_1000290911 337
471 3300025910 Ga0207684_10004060 Ga0207684_100040607 337
472 3300025910 Ga0207684_10006876 Ga0207684_100068767 337
473 3300025910 Ga0207684_10013669 Ga0207684_100136697 337
474 3300025910 Ga0207684_10160921 Ga0207684_101609212 337
475 3300025912 Ga0207707_10010573 Ga0207707_100105733 337
476 3300025917 Ga0207660_10001271 Ga0207660_1000127117 337
477 3300025917 Ga0207660_10023868 Ga0207660_100238682 337
478 3300025918 Ga0207662_10036173 Ga0207662_100361733 337
479 3300025919 Ga0207657_10029843 Ga0207657_100298435 337
480 3300025920 Ga0207649_10010891 Ga0207649_100108913 337
481 3300025921 Ga0207652_10001130 Ga0207652_1000113018 337
482 3300025922 Ga0207646_10000819 Ga0207646_1000081917 337
483 3300025922 Ga0207646_10017570 Ga0207646_100175703 337
484 3300025922 Ga0207646_10048185 Ga0207646_100481852 337
485 3300025923 Ga0207681_10017867 Ga0207681_100178672 337
486 3300025925 Ga0207650_10035391 Ga0207650_100353913 337
487 3300025932 Ga0207690_10007207 Ga0207690_100072073 337
488 3300025933 Ga0207706_10002488 Ga0207706_100024883 337
489 3300025935 Ga0207709_10019990 Ga0207709_100199904 337
490 3300025935 Ga0207709_10254895 Ga0207709_102548952 337
491 3300025940 Ga0207691_10149292 Ga0207691_101492922 337
492 3300025941 Ga0207711_10110266 Ga0207711_101102663 337
493 3300025942 Ga0207689_10001039 Ga0207689_100010393 337
494 3300025942 Ga0207689_10044495 Ga0207689_100444954 337
495 3300025945 Ga0207679_10002961 Ga0207679_100029617 337
496 3300025949 Ga0207667_10003926 Ga0207667_100039267 337
497 3300025981 Ga0207640_10021139 Ga0207640_100211394 337
498 3300025986 Ga0207658_10118921 Ga0207658_101189212 337
499 3300026035 Ga0207703_10036762 Ga0207703_100367622 337
500 3300026041 Ga0207639_10011499 Ga0207639_100114993 337
501 3300026067 Ga0207678_10008687 Ga0207678_100086873 337
502 3300026075 Ga0207708_10002040 Ga0207708_1000204015 337
503 3300026078 Ga0207702_10007056 Ga0207702_100070567 337
504 3300026089 Ga0207648_10033262 Ga0207648_100332626 337
505 3300026095 Ga0207676_10115894 Ga0207676_101158942 337
506 3300026116 Ga0207674_10003899 Ga0207674_100038993 337
507 3300026116 Ga0207674_10129633 Ga0207674_101296332 337
508 3300026118 Ga0207675_100045399 Ga0207675_1000453992 337
509 3300027671 Ga0209588_1009249 Ga0209588_10092493 337
510 3300027671 Ga0209588_1017800 Ga0209588_10178003 337
511 3300027907 Ga0207428_10000033 Ga0207428_100000332 337
512 3300027907 Ga0207428_10122251 Ga0207428_101222512 337
513 3300028380 Ga0268265_10017061 Ga0268265_100170616 337
514 3300028381 Ga0268264_10025358 Ga0268264_100253586 337
515 3300028381 Ga0268264_10037611 Ga0268264_100376112 337
516 3300028381 Ga0268264_10112012 Ga0268264_101120121 337
517 3300028381 Ga0268264_10190561 Ga0268264_101905611 337
518 3300028381 Ga0268264_10538039 Ga0268264_105380391 337
519 3300030522 Ga0307512_10031311 Ga0307512_100313112 337
520 3300031239 Ga0265328_10035938 Ga0265328_100359382 337
521 3300031456 Ga0307513_10029541 Ga0307513_100295416 337
522 3300031548 Ga0307408_100010076 Ga0307408_1000100764 337
523 3300031548 Ga0307408_100148423 Ga0307408_1001484232 337
524 3300031731 Ga0307405_10189894 Ga0307405_101898941 337
525 3300031824 Ga0307413_10167763 Ga0307413_101677631 337
526 3300031852 Ga0307410_10085475 Ga0307410_100854752 337
527 3300031901 Ga0307406_10225755 Ga0307406_102257551 337
528 3300031995 Ga0307409_100098836 Ga0307409_1000988362 337
529 3300032002 Ga0307416_100064162 Ga0307416_1000641624 337
530 3300032005 Ga0307411_10085568 Ga0307411_100855683 337
531 3300032126 Ga0307415_100302346 Ga0307415_1003023462 337
532 3300034819 Ga0373958_0012670 Ga0373958_0012670_220_1242 337
533 3300034820 Ga0373959_0003281 Ga0373959_0003281_775_1800 337
534 3300035090 Ga0373949_0003845 Ga0373949_0003845_1545_2567 337
535 3300035090 Ga0373949_0037316 Ga0373949_0037316_85_1104 337
536 3300035091 Ga0373951_0003206 Ga0373951_0003206_2201_3220 337
537 3300035691 Ga0373931_0007813 Ga0373931_0007813_2072_3097 337
538 3300037312 Ga0395899_0024461 Ga0395899_0024461_2092_3114 337
539 3300037418 Ga0395900_0037014 Ga0395900_0037014_3644_4666 337
540 3300037418 Ga0395900_0124565 Ga0395900_0124565_1076_2104 337
541 3300037466 Ga0395898_0022130 Ga0395898_0022130_83_1105 337
542 3300038443 Ga0395901_0000800 Ga0395901_0000800_15119_16141 337
543 3300042016 Ga0439463_052271 Ga0439463_052271_12_1031 337
544 3300042157 Ga0439458_0000856 Ga0439458_0000856_1837_2856 337
545 3300042435 Ga0439434_0027643 Ga0439434_0027643_576_1610 337
546 3300042876 Ga0451577_0033452 Ga0451577_0033452_1866_2885 337
547 3300042876 Ga0451577_0243300 Ga0451577_0243300_52_1077 337
548 3300044673 Ga0453683_0035844 Ga0453683_0035844_1502_2521 337
549 3300044712 Ga0453684_0234930 Ga0453684_0234930_335_1354 337
550 3300045051 Ga0451576_0006452 Ga0451576_0006452_4204_5235 337
551 3300045051 Ga0451576_0050144 Ga0451576_0050144_581_1615 337
552 3300045051 Ga0451576_0079038 Ga0451576_0079038_2142_3161 337
553 3300045051 Ga0451576_0239194 Ga0451576_0239194_33_1061 337
554 3300045051 Ga0451576_0339570 Ga0451576_0339570_193_1218 337
555 3300046472 Ga0495580_0001704 Ga0495580_0001704_13253_14275 337
556 3300046472 Ga0495580_0021322 Ga0495580_0021322_2864_3895 337
557 3300046476 Ga0495662_0096726 Ga0495662_0096726_303_1325 337
558 3300046516 Ga0495628_0001735 Ga0495628_0001735_17537_18568 337
559 3300046516 Ga0495628_0159152 Ga0495628_0159152_166_1188 337
560 3300046533 Ga0495640_0102881 Ga0495640_0102881_719_1741 337
561 3300046615 Ga0495656_0055350 Ga0495656_0055350_488_1513 337
562 3300046664 Ga0495659_0037464 Ga0495659_0037464_172_1194 337
563 3300046684 Ga0495669_0058935 Ga0495669_0058935_248_1273 337
564 3300047319 Ga0495674_0160825 Ga0495674_0160825_629_1651 337
565 3300048909 Ga0496106_0056733 Ga0496106_0056733_1527_2546 337
566 3300048917 Ga0496114_0203591 Ga0496114_0203591_141_1163 337
567 3300049570 Ga0501033_0033751 Ga0501033_0033751_2485_3507 337
568 3300049570 Ga0501033_0243433 Ga0501033_0243433_137_1171 337
569 3300049572 Ga0501036_0030397 Ga0501036_0030397_2721_3743 337
570 3300049572 Ga0501036_0161392 Ga0501036_0161392_745_1767 337
571 3300049572 Ga0501036_0250896 Ga0501036_0250896_348_1373 337
572 3300049574 Ga0501038_0268471 Ga0501038_0268471_277_1311 337
573 3300049575 Ga0501039_0038953 Ga0501039_0038953_229_1251 337
574 3300049575 Ga0501039_0332974 Ga0501039_0332974_34_1056 337
575 3300049576 Ga0501040_0073285 Ga0501040_0073285_732_1769 337
576 3300049578 Ga0501042_0028657 Ga0501042_0028657_845_1867 337
577 3300049578 Ga0501042_0322487 Ga0501042_0322487_45_1076 337
578 3300049580 Ga0501046_0109902 Ga0501046_0109902_593_1615 337
579 3300049580 Ga0501046_0150184 Ga0501046_0150184_275_1297 337
580 3300049583 Ga0501067_0009421 Ga0501067_0009421_1157_2179 337
581 3300049584 Ga0501068_0014096 Ga0501068_0014096_270_1292 337
582 3300049584 Ga0501068_0052752 Ga0501068_0052752_760_1779 337
583 3300049587 Ga0501071_0179048 Ga0501071_0179048_272_1297 337
584 3300049587 Ga0501071_0224263 Ga0501071_0224263_323_1345 337
585 3300049588 Ga0501072_0001344 Ga0501072_0001344_5806_6828 337
586 3300049588 Ga0501072_0016206 Ga0501072_0016206_4429_5454 337
587 3300049588 Ga0501072_0038075 Ga0501072_0038075_2463_3485 337
588 3300049588 Ga0501072_0094873 Ga0501072_0094873_358_1395 337
589 3300049590 Ga0501074_0058038 Ga0501074_0058038_1041_2063 337
590 3300049591 Ga0501075_0004490 Ga0501075_0004490_5253_6275 337
591 3300049591 Ga0501075_0016313 Ga0501075_0016313_3454_4476 337
592 3300049591 Ga0501075_0034077 Ga0501075_0034077_254_1279 337
593 3300049591 Ga0501075_0123861 Ga0501075_0123861_226_1263 337
594 3300049591 Ga0501075_0154890 Ga0501075_0154890_667_1689 337
595 3300049591 Ga0501075_0298052 Ga0501075_0298052_170_1189 337
596 3300049592 Ga0501076_0003486 Ga0501076_0003486_1854_2876 337
597 3300049592 Ga0501076_0009184 Ga0501076_0009184_3575_4600 337
598 3300049592 Ga0501076_0088951 Ga0501076_0088951_883_1905 337
599 3300049592 Ga0501076_0185539 Ga0501076_0185539_237_1271 337
600 3300049593 Ga0501077_0010203 Ga0501077_0010203_3915_4937 337
601 3300049741 Ga0501079_0006450 Ga0501079_0006450_6083_7105 337
602 3300049741 Ga0501079_0111906 Ga0501079_0111906_556_1578 337
603 3300049741 Ga0501079_0181078 Ga0501079_0181078_388_1410 337
604 3300049742 Ga0501080_0086478 Ga0501080_0086478_460_1479 337
605 3300049742 Ga0501080_0136483 Ga0501080_0136483_935_1957 337
606 3300049743 Ga0501081_0006156 Ga0501081_0006156_4270_5292 337
607 3300049743 Ga0501081_0006694 Ga0501081_0006694_5719_6741 337
608 3300049743 Ga0501081_0097109 Ga0501081_0097109_272_1294 337
609 3300049743 Ga0501081_0117111 Ga0501081_0117111_226_1248 337
610 3300049824 Ga0501045_0035346 Ga0501045_0035346_2144_3166 337
611 3300049824 Ga0501045_0052866 Ga0501045_0052866_1258_2283 337
612 3300049824 Ga0501045_0157311 Ga0501045_0157311_542_1579 337
613 3300050507 nmdc:mga05p37_120524_c1 nmdc:mga05p37_120524_c1_1036_2058 337
614 3300050507 nmdc:mga05p37_134102_c1 nmdc:mga05p37_134102_c1_1026_2051 337
615 3300050507 nmdc:mga05p37_13734_c1 nmdc:mga05p37_13734_c1_3817_4842 337
616 3300050507 nmdc:mga05p37_30941_c1 nmdc:mga05p37_30941_c1_750_1769 337
617 3300050507 nmdc:mga05p37_35081_c1 nmdc:mga05p37_35081_c1_4002_5024 337
618 3300050507 nmdc:mga05p37_3828_c1 nmdc:mga05p37_3828_c1_12150_13175 337
619 3300050507 nmdc:mga05p37_39684_c1 nmdc:mga05p37_39684_c1_665_1687 337
620 3300050507 nmdc:mga05p37_486453_c1 nmdc:mga05p37_486453_c1_170_1204 337
621 3300050507 nmdc:mga05p37_546910_c1 nmdc:mga05p37_546910_c1_49_1083 337
622 3300050507 nmdc:mga05p37_9544_c1 nmdc:mga05p37_9544_c1_7325_8347 337
623 3300050508 nmdc:mga09592_1842_c1 nmdc:mga09592_1842_c1_15251_16270 337
624 3300050508 nmdc:mga09592_27860_c1 nmdc:mga09592_27860_c1_561_1583 337
625 3300050508 nmdc:mga09592_90362_c1 nmdc:mga09592_90362_c1_1100_2134 337
626 3300050509 nmdc:mga0qj67_2581_c1 nmdc:mga0qj67_2581_c1_7048_8070 337
627 3300050509 nmdc:mga0qj67_66067_c1 nmdc:mga0qj67_66067_c1_1168_2193 337
628 3300050509 nmdc:mga0qj67_9351_c1 nmdc:mga0qj67_9351_c1_4113_5138 337
629 3300050510 nmdc:mga06r32_118866_c1 nmdc:mga06r32_118866_c1_1475_2494 337
630 3300050510 nmdc:mga06r32_164351_c1 nmdc:mga06r32_164351_c1_714_1736 337
631 3300050510 nmdc:mga06r32_16710_c1 nmdc:mga06r32_16710_c1_3374_4399 337
632 3300050510 nmdc:mga06r32_21876_c1 nmdc:mga06r32_21876_c1_3699_4721 337
633 3300050510 nmdc:mga06r32_27719_c1 nmdc:mga06r32_27719_c1_2143_3165 337
634 3300050510 nmdc:mga06r32_8196_c1 nmdc:mga06r32_8196_c1_5879_6901 337
635 3300050510 nmdc:mga06r32_99737_c1 nmdc:mga06r32_99737_c1_548_1573 337
636 3300050511 nmdc:mga08y16_43295_c1 nmdc:mga08y16_43295_c1_2026_3045 337
637 3300050511 nmdc:mga08y16_5112_c1 nmdc:mga08y16_5112_c1_11809_12831 337
638 3300050511 nmdc:mga08y16_60756_c1 nmdc:mga08y16_60756_c1_2320_3345 337
639 3300050512 nmdc:mga0n895_108653_c1 nmdc:mga0n895_108653_c1_617_1639 337
640 3300050512 nmdc:mga0n895_3140_c1 nmdc:mga0n895_3140_c1_3215_4234 337
641 3300050512 nmdc:mga0n895_74813_c1 nmdc:mga0n895_74813_c1_818_1849 337
642 3300050513 nmdc:mga0rr50_110799_c1 nmdc:mga0rr50_110799_c1_344_1366 337
643 3300050513 nmdc:mga0rr50_158228_c1 nmdc:mga0rr50_158228_c1_264_1283 337
644 3300050513 nmdc:mga0rr50_28588_c1 nmdc:mga0rr50_28588_c1_156_1181 337
645 3300050513 nmdc:mga0rr50_6438_c1 nmdc:mga0rr50_6438_c1_2353_3384 337
646 3300050513 nmdc:mga0rr50_79833_c1 nmdc:mga0rr50_79833_c1_1413_2432 337
647 3300050514 nmdc:mga08x19_17940_c1 nmdc:mga08x19_17940_c1_1646_2677 337
648 3300050514 nmdc:mga08x19_67016_c1 nmdc:mga08x19_67016_c1_520_1551 337
649 3300050515 nmdc:mga0a205_261593_c1 nmdc:mga0a205_261593_c1_475_1497 337
650 3300050515 nmdc:mga0a205_28188_c2 nmdc:mga0a205_28188_c2_235_1257 337
651 3300050515 nmdc:mga0a205_32_c1 nmdc:mga0a205_32_c1_45506_46525 337
652 3300050515 nmdc:mga0a205_64122_c1 nmdc:mga0a205_64122_c1_800_1831 337
653 3300053077 Ga0495601_0066542 Ga0495601_0066542_967_1989 337
654 3300053084 Ga0495595_0031552 Ga0495595_0031552_90_1112 337
655 3300053085 Ga0495619_0055479 Ga0495619_0055479_1568_2590 337
656 3300054114 Ga0501084_0006596 Ga0501084_0006596_6037_7059 337
657 3300054114 Ga0501084_0018144 Ga0501084_0018144_744_1766 337
658 3300054114 Ga0501084_0107065 Ga0501084_0107065_1180_2202 337
659 3300054114 Ga0501084_0116990 Ga0501084_0116990_232_1257 337
660 3300054114 Ga0501084_0174837 Ga0501084_0174837_624_1649 337
661 3300054114 Ga0501084_0228081 Ga0501084_0228081_341_1363 337
662 3300060353 Ga0501082_0066055 Ga0501082_0066055_25_1047 337
663 3300060353 Ga0501082_0115887 Ga0501082_0115887_682_1704 337
664 3300060353 Ga0501082_0152616 Ga0501082_0152616_865_1902 337
665 3300060353 Ga0501082_0275053 Ga0501082_0275053_39_1064 337
666 3300061734 Ga0530510_0013034 Ga0530510_0013034_102_1124 337
667 3300061734 Ga0530510_0038469 Ga0530510_0038469_733_1755 337
668 3300061734 Ga0530510_0176812 Ga0530510_0176812_31_1056 337
669 3300061734 Ga0530510_0200404 Ga0530510_0200404_382_1404 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

83

244

0.98

PF06463

Mob_synth_C

Molybdenum Cofactor Synthesis C

249

376

0.96

PF02878

PGM_PMM_I

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I

4

76

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.9278 1 304
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.9151 1 310
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.8693 1 310
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.862 1 304
7tom-assembly1.cif.gz_A x-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (gdgt-mas) from methanocaldococcus jannaschii with bacterial lipid substrate analog, 5'deoxyadenosine, and methionine bound 0.8476 6 220
ID Description Score Start End Superfamily
af_P9WJS3_16_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9841 1 337 3.20.20.70
af_P9WJS3_16_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9812 1 337 3.20.20.70
1tv8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9278 1 304 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9213 2 318 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9148 2 322 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V7TLS8-F1-model_v4 Cyclic pyranopterin phosphate synthase MoaA 0.9906 1 108 GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-W4L4M7-F1-model_v4 Radical SAM core domain-containing protein 0.9884 1 220 GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A7W1JS71-F1-model_v4 Radical SAM protein 0.9759 1 188 GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A2V5MKD8-F1-model_v4 GTP 3',8-cyclase MoaA 0.9758 1 184 GO:0006777
GO:0046872
GO:0051536
GO:0061798
GO:0061799
AF-A0A7S4F4U7-F1-model_v4 Radical SAM core domain-containing protein 0.9758 3 157 GO:0006777
GO:0046872
GO:0051536
GO:0061798
GO:0061799

Feature Viewer

pLDDT pTM Quality
92.36 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map