F474016
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 669 | 266 | 669 | 338 |
Family's Representative Sequence
| Representative Sequence | 3300026089|Ga0207648_10206390|Ga0207648_102063901 |
| Length | 406 |
| Sequence | LAVRKLFGTDGVRGVAGQFLTAELAPRVLIVRDPRESGEMLEAAVAAGVAXXXXEALLGGVLPTPGAPLLLDRHGRPLRNLRLSVTDRCNLRCSYCMPEAEYAWLPREDILHFEEIERLVDIFVSLGVDKVRLTGGEPLLRRDMPELVRRLATRSGIADLAMTTNGVLLAAHAGALKDAGLHRMTVSLDTLDPARFKALTRYDELDRVLAGIAAASPLFPGLKIDTVVIRGVNDDELVALIEYGATHGAEVRFIEYMDVGGATHWSMNRVVSRREVLERLEAHYGAIAPIVESSSAPADRFRLPDGRVFGIISSTTEPFCHACDRSRLTADGLWYLCLYAPRGTDLRKVLRGGASDEEIAELVRATWSRRADRGAEVRLASGDRSPLIPLDGLRTDPHLEMHTRGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 160 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 161 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 174 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 185 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 186 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 187 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 188 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 189 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 190 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 191 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 194 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 195 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 214 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 215 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 218 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 219 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 261 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 263 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 264 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 265 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 1.64 |
| Rhizosphere | 97.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10023907 | 3300003203 | Bacteria | 2406 |
| 2 | JGI25407J50210_10009937 | 3300003373 | Bacteria | 2416 |
| 3 | JGI26141J51220_1000130 | 3300003503 | Bacteria | 3686 |
| 4 | Ga0065715_10001125 | 3300005293 | Bacteria | 11430 |
| 5 | Ga0070676_10017001 | 3300005328 | Bacteria | 4021 |
| 6 | Ga0070676_10017597 | 3300005328 | Bacteria | 3955 |
| 7 | Ga0070690_100069050 | 3300005330 | Bacteria | 2293 |
| 8 | Ga0070690_100151733 | 3300005330 | Bacteria | 1582 |
| 9 | Ga0070670_100015266 | 3300005331 | Bacteria | 6592 |
| 10 | Ga0070670_100045773 | 3300005331 | Bacteria | 3761 |
| 11 | Ga0070670_100084332 | 3300005331 | Bacteria | 2730 |
| 12 | Ga0068869_100001281 | 3300005334 | Bacteria | 14862 |
| 13 | Ga0068869_100030552 | 3300005334 | Bacteria | 3783 |
| 14 | Ga0068869_100079657 | 3300005334 | Bacteria | 2441 |
| 15 | Ga0070680_100011104 | 3300005336 | Bacteria | 6963 |
| 16 | Ga0070682_100000940 | 3300005337 | Bacteria | 16941 |
| 17 | Ga0070660_100006007 | 3300005339 | Bacteria | 8394 |
| 18 | Ga0070689_100047342 | 3300005340 | Bacteria | 3316 |
| 19 | Ga0070691_10003618 | 3300005341 | Bacteria | 6977 |
| 20 | Ga0070687_100018714 | 3300005343 | Bacteria | 3209 |
| 21 | Ga0070687_100043337 | 3300005343 | Bacteria | 2286 |
| 22 | Ga0070661_100005220 | 3300005344 | Bacteria | 8944 |
| 23 | Ga0070692_10000406 | 3300005345 | Bacteria | 12905 |
| 24 | Ga0070692_10006643 | 3300005345 | Bacteria | 5034 |
| 25 | Ga0070668_100106202 | 3300005347 | Bacteria | 2231 |
| 26 | Ga0070669_100021948 | 3300005353 | Bacteria | 4565 |
| 27 | Ga0070669_100051495 | 3300005353 | Bacteria | 3010 |
| 28 | Ga0070669_100295857 | 3300005353 | Bacteria | 1301 |
| 29 | Ga0070675_100001343 | 3300005354 | Bacteria | 18014 |
| 30 | Ga0070675_100004816 | 3300005354 | Bacteria | 10299 |
| 31 | Ga0070675_100046718 | 3300005354 | Bacteria | 3546 |
| 32 | Ga0070673_100014940 | 3300005364 | Bacteria | 5434 |
| 33 | Ga0070688_100053051 | 3300005365 | Bacteria | 2535 |
| 34 | Ga0070688_100076231 | 3300005365 | Bacteria | 2157 |
| 35 | Ga0070688_100126091 | 3300005365 | Bacteria | 1721 |
| 36 | Ga0070659_100003412 | 3300005366 | Bacteria | 11322 |
| 37 | Ga0070667_100137791 | 3300005367 | Bacteria | 2135 |
| 38 | Ga0070703_10001999 | 3300005406 | Bacteria | 5961 |
| 39 | Ga0070703_10035917 | 3300005406 | Bacteria | 1520 |
| 40 | Ga0070713_100032883 | 3300005436 | Bacteria | 4148 |
| 41 | Ga0070701_10008204 | 3300005438 | Bacteria | 4503 |
| 42 | Ga0070701_10050537 | 3300005438 | Bacteria | 2153 |
| 43 | Ga0070701_10136554 | 3300005438 | Bacteria | 1398 |
| 44 | Ga0070705_100002212 | 3300005440 | Bacteria | 9882 |
| 45 | Ga0070705_100026162 | 3300005440 | Bacteria | 3173 |
| 46 | Ga0070705_100097542 | 3300005440 | Bacteria | 1848 |
| 47 | Ga0070694_100000718 | 3300005444 | Bacteria | 18439 |
| 48 | Ga0070694_100082136 | 3300005444 | Bacteria | 2243 |
| 49 | Ga0070708_100005307 | 3300005445 | Bacteria | 10213 |
| 50 | Ga0070708_100023197 | 3300005445 | Bacteria | 5273 |
| 51 | Ga0070708_100026182 | 3300005445 | Bacteria | 4990 |
| 52 | Ga0070708_100065829 | 3300005445 | Bacteria | 3250 |
| 53 | Ga0070708_100096190 | 3300005445 | Bacteria | 2705 |
| 54 | Ga0070708_100153372 | 3300005445 | Bacteria | 2143 |
| 55 | Ga0070708_100177898 | 3300005445 | Bacteria | 1988 |
| 56 | Ga0070708_100339892 | 3300005445 | Bacteria | 1415 |
| 57 | Ga0070663_100012132 | 3300005455 | Bacteria | 5438 |
| 58 | Ga0070663_100017114 | 3300005455 | Bacteria | 4723 |
| 59 | Ga0070678_100028714 | 3300005456 | Bacteria | 3798 |
| 60 | Ga0070678_100139996 | 3300005456 | Bacteria | 1935 |
| 61 | Ga0070678_100269459 | 3300005456 | Bacteria | 1435 |
| 62 | Ga0070662_100039211 | 3300005457 | Bacteria | 3369 |
| 63 | Ga0070681_10054099 | 3300005458 | Bacteria | 3999 |
| 64 | Ga0068867_100051560 | 3300005459 | Bacteria | 3035 |
| 65 | Ga0068867_100069344 | 3300005459 | Bacteria | 2633 |
| 66 | Ga0070706_100009915 | 3300005467 | Bacteria | 8844 |
| 67 | Ga0070706_100022362 | 3300005467 | Bacteria | 5823 |
| 68 | Ga0070706_100042363 | 3300005467 | Bacteria | 4206 |
| 69 | Ga0070706_100088898 | 3300005467 | Bacteria | 2864 |
| 70 | Ga0070706_100093088 | 3300005467 | Bacteria | 2796 |
| 71 | Ga0070706_100123458 | 3300005467 | Bacteria | 2414 |
| 72 | Ga0070706_100362669 | 3300005467 | Bacteria | 1350 |
| 73 | Ga0070707_100001535 | 3300005468 | Bacteria | 22487 |
| 74 | Ga0070707_100011624 | 3300005468 | Bacteria | 8214 |
| 75 | Ga0070707_100053084 | 3300005468 | Bacteria | 3885 |
| 76 | Ga0070707_100147609 | 3300005468 | Bacteria | 2289 |
| 77 | Ga0070707_100203415 | 3300005468 | Bacteria | 1930 |
| 78 | Ga0070698_100000147 | 3300005471 | Bacteria | 63668 |
| 79 | Ga0070698_100009771 | 3300005471 | Bacteria | 10256 |
| 80 | Ga0070698_100057921 | 3300005471 | Bacteria | 3919 |
| 81 | Ga0070698_100075625 | 3300005471 | Bacteria | 3371 |
| 82 | Ga0070698_100149447 | 3300005471 | Bacteria | 2284 |
| 83 | Ga0070698_100386670 | 3300005471 | Bacteria | 1332 |
| 84 | Ga0070699_100006894 | 3300005518 | Bacteria | 9882 |
| 85 | Ga0070699_100012706 | 3300005518 | Bacteria | 7258 |
| 86 | Ga0070699_100020863 | 3300005518 | Bacteria | 5650 |
| 87 | Ga0070699_100029408 | 3300005518 | Bacteria | 4737 |
| 88 | Ga0070699_100029925 | 3300005518 | Bacteria | 4697 |
| 89 | Ga0070699_100064343 | 3300005518 | Bacteria | 3181 |
| 90 | Ga0070699_100120880 | 3300005518 | Bacteria | 2303 |
| 91 | Ga0070699_100220015 | 3300005518 | Bacteria | 1692 |
| 92 | Ga0070679_100000882 | 3300005530 | Bacteria | 26065 |
| 93 | Ga0070679_100076878 | 3300005530 | Bacteria | 3327 |
| 94 | Ga0070697_100006030 | 3300005536 | Bacteria | 9375 |
| 95 | Ga0070697_100015152 | 3300005536 | Bacteria | 6053 |
| 96 | Ga0070697_100028482 | 3300005536 | Bacteria | 4473 |
| 97 | Ga0070697_100054536 | 3300005536 | Bacteria | 3249 |
| 98 | Ga0070697_100186272 | 3300005536 | Bacteria | 1760 |
| 99 | Ga0070697_100284831 | 3300005536 | Bacteria | 1418 |
| 100 | Ga0068853_100000850 | 3300005539 | Bacteria | 21319 |
| 101 | Ga0070672_100013577 | 3300005543 | Bacteria | 5759 |
| 102 | Ga0070672_100067652 | 3300005543 | Bacteria | 2831 |
| 103 | Ga0070672_100137539 | 3300005543 | Bacteria | 2012 |
| 104 | Ga0070695_100002551 | 3300005545 | Bacteria | 10518 |
| 105 | Ga0070695_100003065 | 3300005545 | Bacteria | 9724 |
| 106 | Ga0070695_100008967 | 3300005545 | Bacteria | 5943 |
| 107 | Ga0070695_100104305 | 3300005545 | Bacteria | 1914 |
| 108 | Ga0070695_100297317 | 3300005545 | Bacteria | 1192 |
| 109 | Ga0070696_100003134 | 3300005546 | Bacteria | 11012 |
| 110 | Ga0070696_100044141 | 3300005546 | Bacteria | 3086 |
| 111 | Ga0070693_100000018 | 3300005547 | Bacteria | 62344 |
| 112 | Ga0070665_100035594 | 3300005548 | Bacteria | 5007 |
| 113 | Ga0070665_100122418 | 3300005548 | Bacteria | 2603 |
| 114 | Ga0070665_100281882 | 3300005548 | Bacteria | 1664 |
| 115 | Ga0070704_100013680 | 3300005549 | Bacteria | 5046 |
| 116 | Ga0070704_100015371 | 3300005549 | Bacteria | 4807 |
| 117 | Ga0070704_100231345 | 3300005549 | Bacteria | 1508 |
| 118 | Ga0068855_100000233 | 3300005563 | Bacteria | 70757 |
| 119 | Ga0070664_100026984 | 3300005564 | Bacteria | 4770 |
| 120 | Ga0068857_100034376 | 3300005577 | Bacteria | 4484 |
| 121 | Ga0068857_100111420 | 3300005577 | Bacteria | 2460 |
| 122 | Ga0068854_100000372 | 3300005578 | Bacteria | 28633 |
| 123 | Ga0068856_100002918 | 3300005614 | Bacteria | 17513 |
| 124 | Ga0068856_100245269 | 3300005614 | Bacteria | 1806 |
| 125 | Ga0070702_100111155 | 3300005615 | Bacteria | 1699 |
| 126 | Ga0068859_100014301 | 3300005617 | Bacteria | 7960 |
| 127 | Ga0068859_100070347 | 3300005617 | Bacteria | 3534 |
| 128 | Ga0068859_100219928 | 3300005617 | Bacteria | 1987 |
| 129 | Ga0068859_100484606 | 3300005617 | Bacteria | 1332 |
| 130 | Ga0068864_100031079 | 3300005618 | Bacteria | 4529 |
| 131 | Ga0068864_100082030 | 3300005618 | Bacteria | 2829 |
| 132 | Ga0068864_100137320 | 3300005618 | Bacteria | 2203 |
| 133 | Ga0068866_10053459 | 3300005718 | Bacteria | 2065 |
| 134 | Ga0068861_100042189 | 3300005719 | Bacteria | 3419 |
| 135 | Ga0068861_100085635 | 3300005719 | Bacteria | 2476 |
| 136 | Ga0068861_100177558 | 3300005719 | Bacteria | 1770 |
| 137 | Ga0068851_10021993 | 3300005834 | Bacteria | 3101 |
| 138 | Ga0068851_10126146 | 3300005834 | Bacteria | 1380 |
| 139 | Ga0068870_10000164 | 3300005840 | Bacteria | 23543 |
| 140 | Ga0068870_10140283 | 3300005840 | Bacteria | 1413 |
| 141 | Ga0068863_100018837 | 3300005841 | Bacteria | 6606 |
| 142 | Ga0068863_100039352 | 3300005841 | Bacteria | 4499 |
| 143 | Ga0068863_100110013 | 3300005841 | Bacteria | 2623 |
| 144 | Ga0068858_100060334 | 3300005842 | Bacteria | 3506 |
| 145 | Ga0068860_100023167 | 3300005843 | Bacteria | 6003 |
| 146 | Ga0068860_100039573 | 3300005843 | Bacteria | 4510 |
| 147 | Ga0068860_100220548 | 3300005843 | Bacteria | 1841 |
| 148 | Ga0068862_100035170 | 3300005844 | Bacteria | 4240 |
| 149 | Ga0068862_100113377 | 3300005844 | Bacteria | 2382 |
| 150 | Ga0068862_100118571 | 3300005844 | Bacteria | 2330 |
| 151 | Ga0068862_100204643 | 3300005844 | Bacteria | 1781 |
| 152 | Ga0068862_100354657 | 3300005844 | Bacteria | 1362 |
| 153 | Ga0081455_10001913 | 3300005937 | Bacteria | 25012 |
| 154 | Ga0081538_10002145 | 3300005981 | Bacteria | 19640 |
| 155 | Ga0081538_10004506 | 3300005981 | Bacteria | 12822 |
| 156 | Ga0081538_10024983 | 3300005981 | Unclassified | 4235 |
| 157 | Ga0081540_1006769 | 3300005983 | Bacteria | 8287 |
| 158 | Ga0081539_10000775 | 3300005985 | Bacteria | 62812 |
| 159 | Ga0097621_100154795 | 3300006237 | Bacteria | 1967 |
| 160 | Ga0097621_100182007 | 3300006237 | Bacteria | 1816 |
| 161 | Ga0097621_100299659 | 3300006237 | Bacteria | 1419 |
| 162 | Ga0075428_100003207 | 3300006844 | Bacteria | 17888 |
| 163 | Ga0075428_100010839 | 3300006844 | Bacteria | 10133 |
| 164 | Ga0075430_100003525 | 3300006846 | Bacteria | 13095 |
| 165 | Ga0075430_100008074 | 3300006846 | Bacteria | 8894 |
| 166 | Ga0075430_100046471 | 3300006846 | Bacteria | 3667 |
| 167 | Ga0075430_100085038 | 3300006846 | Bacteria | 2649 |
| 168 | Ga0075431_100003509 | 3300006847 | Bacteria | 15193 |
| 169 | Ga0075431_100007612 | 3300006847 | Bacteria | 10784 |
| 170 | Ga0075431_100011019 | 3300006847 | Bacteria | 9100 |
| 171 | Ga0075431_100022099 | 3300006847 | Bacteria | 6506 |
| 172 | Ga0075431_100023739 | 3300006847 | Bacteria | 6277 |
| 173 | Ga0075433_10000305 | 3300006852 | Bacteria | 29652 |
| 174 | Ga0075433_10032999 | 3300006852 | Bacteria | 4436 |
| 175 | Ga0075433_10043134 | 3300006852 | Bacteria | 3915 |
| 176 | Ga0075433_10066518 | 3300006852 | Bacteria | 3163 |
| 177 | Ga0075433_10235906 | 3300006852 | Bacteria | 1624 |
| 178 | Ga0075434_100000107 | 3300006871 | Bacteria | 47551 |
| 179 | Ga0075434_100004736 | 3300006871 | Bacteria | 12304 |
| 180 | Ga0075434_100012802 | 3300006871 | Bacteria | 7962 |
| 181 | Ga0075434_100032542 | 3300006871 | Bacteria | 5142 |
| 182 | Ga0075434_100079651 | 3300006871 | Bacteria | 3272 |
| 183 | Ga0075434_100174198 | 3300006871 | Bacteria | 2171 |
| 184 | Ga0075429_100011821 | 3300006880 | Bacteria | 7569 |
| 185 | Ga0075429_100017667 | 3300006880 | Bacteria | 6169 |
| 186 | Ga0075429_100219076 | 3300006880 | Bacteria | 1667 |
| 187 | Ga0068865_100006094 | 3300006881 | Bacteria | 7355 |
| 188 | Ga0075436_100079572 | 3300006914 | Bacteria | 2270 |
| 189 | Ga0075436_100201299 | 3300006914 | Bacteria | 1410 |
| 190 | Ga0097620_100014301 | 3300006931 | Bacteria | 7960 |
| 191 | Ga0097620_100070348 | 3300006931 | Bacteria | 3534 |
| 192 | Ga0097620_100219929 | 3300006931 | Bacteria | 1987 |
| 193 | Ga0097620_100484648 | 3300006931 | Bacteria | 1332 |
| 194 | Ga0075435_100002197 | 3300007076 | Bacteria | 12874 |
| 195 | Ga0075435_100008350 | 3300007076 | Bacteria | 7424 |
| 196 | Ga0075435_100025026 | 3300007076 | Bacteria | 4641 |
| 197 | Ga0075435_100058668 | 3300007076 | Bacteria | 3118 |
| 198 | Ga0075435_100239810 | 3300007076 | Bacteria | 1542 |
| 199 | Ga0099794_10009292 | 3300007265 | Bacteria | 4127 |
| 200 | Ga0099794_10011374 | 3300007265 | Bacteria | 3808 |
| 201 | Ga0099794_10033254 | 3300007265 | Bacteria | 2424 |
| 202 | Ga0105240_10039733 | 3300009093 | Bacteria | 6022 |
| 203 | Ga0105240_10075893 | 3300009093 | Bacteria | 4145 |
| 204 | Ga0111539_10001802 | 3300009094 | Bacteria | 28518 |
| 205 | Ga0111539_10007082 | 3300009094 | Bacteria | 14373 |
| 206 | Ga0111539_10014329 | 3300009094 | Bacteria | 9899 |
| 207 | Ga0111539_10096225 | 3300009094 | Bacteria | 3477 |
| 208 | Ga0111539_10500207 | 3300009094 | Bacteria | 1416 |
| 209 | Ga0114129_10000026 | 3300009147 | Bacteria | 113517 |
| 210 | Ga0114129_10005676 | 3300009147 | Bacteria | 17663 |
| 211 | Ga0114129_10006211 | 3300009147 | Bacteria | 16946 |
| 212 | Ga0114129_10008312 | 3300009147 | Bacteria | 14808 |
| 213 | Ga0114129_10023313 | 3300009147 | Bacteria | 8780 |
| 214 | Ga0114129_10033308 | 3300009147 | Bacteria | 7281 |
| 215 | Ga0114129_10056999 | 3300009147 | Bacteria | 5470 |
| 216 | Ga0114129_10057391 | 3300009147 | Bacteria | 5448 |
| 217 | Ga0114129_10067395 | 3300009147 | Bacteria | 4992 |
| 218 | Ga0114129_10094659 | 3300009147 | Bacteria | 4137 |
| 219 | Ga0114129_10116736 | 3300009147 | Bacteria | 3677 |
| 220 | Ga0114129_10129065 | 3300009147 | Bacteria | 3474 |
| 221 | Ga0114129_10250363 | 3300009147 | Bacteria | 2378 |
| 222 | Ga0114129_10879259 | 3300009147 | Bacteria | 1137 |
| 223 | Ga0105243_10065279 | 3300009148 | Bacteria | 2923 |
| 224 | Ga0105243_10111908 | 3300009148 | Bacteria | 2286 |
| 225 | Ga0105241_10203100 | 3300009174 | Bacteria | 1657 |
| 226 | Ga0105242_10014087 | 3300009176 | Bacteria | 6189 |
| 227 | Ga0105248_10104872 | 3300009177 | Bacteria | 3187 |
| 228 | Ga0105248_10453353 | 3300009177 | Bacteria | 1445 |
| 229 | Ga0105248_10527950 | 3300009177 | Bacteria | 1331 |
| 230 | Ga0105248_10701086 | 3300009177 | Bacteria | 1142 |
| 231 | Ga0105249_10032354 | 3300009553 | Bacteria | 4731 |
| 232 | Ga0105249_10249963 | 3300009553 | Bacteria | 1758 |
| 233 | Ga0105246_10031604 | 3300011119 | Bacteria | 3504 |
| 234 | Ga0105246_10056987 | 3300011119 | Bacteria | 2703 |
| 235 | Ga0157373_10000292 | 3300013100 | Bacteria | 40273 |
| 236 | Ga0157369_10043156 | 3300013105 | Bacteria | 4916 |
| 237 | Ga0163162_10097126 | 3300013306 | Bacteria | 3034 |
| 238 | Ga0163162_10159768 | 3300013306 | Bacteria | 2375 |
| 239 | Ga0157372_10001109 | 3300013307 | Bacteria | 29268 |
| 240 | Ga0157372_10010311 | 3300013307 | Bacteria | 9928 |
| 241 | Ga0157375_10088409 | 3300013308 | Bacteria | 3153 |
| 242 | Ga0157375_10096361 | 3300013308 | Bacteria | 3031 |
| 243 | Ga0157375_10302882 | 3300013308 | Bacteria | 1762 |
| 244 | Ga0157375_10622558 | 3300013308 | Bacteria | 1237 |
| 245 | Ga0163163_10015430 | 3300014325 | Bacteria | 7063 |
| 246 | Ga0163163_10138267 | 3300014325 | Bacteria | 2477 |
| 247 | Ga0157380_10005737 | 3300014326 | Bacteria | 8686 |
| 248 | Ga0157380_10106836 | 3300014326 | Bacteria | 2343 |
| 249 | Ga0157380_10140582 | 3300014326 | Bacteria | 2074 |
| 250 | Ga0157380_10367350 | 3300014326 | Bacteria | 1353 |
| 251 | Ga0157376_10010193 | 3300014969 | Bacteria | 6862 |
| 252 | Ga0157376_10042390 | 3300014969 | Bacteria | 3730 |
| 253 | Ga0207697_10047862 | 3300025315 | Bacteria | 1763 |
| 254 | Ga0207656_10034654 | 3300025321 | Bacteria | 2109 |
| 255 | Ga0207653_10015948 | 3300025885 | Bacteria | 2358 |
| 256 | Ga0207682_10005989 | 3300025893 | Bacteria | 4916 |
| 257 | Ga0207688_10046132 | 3300025901 | Bacteria | 2432 |
| 258 | Ga0207680_10080327 | 3300025903 | Bacteria | 2047 |
| 259 | Ga0207685_10036488 | 3300025905 | Bacteria | 1803 |
| 260 | Ga0207645_10017069 | 3300025907 | Bacteria | 4796 |
| 261 | Ga0207645_10023503 | 3300025907 | Bacteria | 4006 |
| 262 | Ga0207643_10007829 | 3300025908 | Bacteria | 5739 |
| 263 | Ga0207684_10000782 | 3300025910 | Bacteria | 36914 |
| 264 | Ga0207684_10002909 | 3300025910 | Bacteria | 16974 |
| 265 | Ga0207684_10004060 | 3300025910 | Bacteria | 13977 |
| 266 | Ga0207684_10006876 | 3300025910 | Bacteria | 10293 |
| 267 | Ga0207684_10013669 | 3300025910 | Bacteria | 7014 |
| 268 | Ga0207684_10019054 | 3300025910 | Bacteria | 5870 |
| 269 | Ga0207684_10040389 | 3300025910 | Bacteria | 3955 |
| 270 | Ga0207684_10160921 | 3300025910 | Bacteria | 1933 |
| 271 | Ga0207684_10198158 | 3300025910 | Bacteria | 1732 |
| 272 | Ga0207707_10010573 | 3300025912 | Bacteria | 8012 |
| 273 | Ga0207660_10001271 | 3300025917 | Bacteria | 16932 |
| 274 | Ga0207660_10023868 | 3300025917 | Bacteria | 4135 |
| 275 | Ga0207662_10036173 | 3300025918 | Bacteria | 2885 |
| 276 | Ga0207662_10059061 | 3300025918 | Bacteria | 2298 |
| 277 | Ga0207657_10029843 | 3300025919 | Bacteria | 4957 |
| 278 | Ga0207649_10010891 | 3300025920 | Bacteria | 5001 |
| 279 | Ga0207652_10001130 | 3300025921 | Bacteria | 24020 |
| 280 | Ga0207646_10000819 | 3300025922 | Bacteria | 40434 |
| 281 | Ga0207646_10017570 | 3300025922 | Bacteria | 6687 |
| 282 | Ga0207646_10039441 | 3300025922 | Bacteria | 4251 |
| 283 | Ga0207646_10048185 | 3300025922 | Bacteria | 3820 |
| 284 | Ga0207681_10017867 | 3300025923 | Bacteria | 4458 |
| 285 | Ga0207650_10035391 | 3300025925 | Bacteria | 3625 |
| 286 | Ga0207650_10043508 | 3300025925 | Bacteria | 3297 |
| 287 | Ga0207650_10231081 | 3300025925 | Bacteria | 1492 |
| 288 | Ga0207650_10245980 | 3300025925 | Bacteria | 1446 |
| 289 | Ga0207659_10001244 | 3300025926 | Bacteria | 15262 |
| 290 | Ga0207659_10085851 | 3300025926 | Bacteria | 2339 |
| 291 | Ga0207659_10245753 | 3300025926 | Bacteria | 1450 |
| 292 | Ga0207659_10373640 | 3300025926 | Bacteria | 1187 |
| 293 | Ga0207690_10007207 | 3300025932 | Bacteria | 6604 |
| 294 | Ga0207706_10002488 | 3300025933 | Bacteria | 17959 |
| 295 | Ga0207706_10153653 | 3300025933 | Bacteria | 2024 |
| 296 | Ga0207686_10210800 | 3300025934 | Bacteria | 1397 |
| 297 | Ga0207709_10019990 | 3300025935 | Bacteria | 3773 |
| 298 | Ga0207709_10067766 | 3300025935 | Bacteria | 2254 |
| 299 | Ga0207709_10254895 | 3300025935 | Bacteria | 1283 |
| 300 | Ga0207670_10095709 | 3300025936 | Bacteria | 2110 |
| 301 | Ga0207669_10029625 | 3300025937 | Bacteria | 3030 |
| 302 | Ga0207704_10127821 | 3300025938 | Bacteria | 1753 |
| 303 | Ga0207691_10110850 | 3300025940 | Bacteria | 2440 |
| 304 | Ga0207691_10130305 | 3300025940 | Bacteria | 2222 |
| 305 | Ga0207691_10149292 | 3300025940 | Bacteria | 2056 |
| 306 | Ga0207691_10156554 | 3300025940 | Bacteria | 2001 |
| 307 | Ga0207711_10044986 | 3300025941 | Bacteria | 3771 |
| 308 | Ga0207711_10052176 | 3300025941 | Bacteria | 3504 |
| 309 | Ga0207711_10110266 | 3300025941 | Bacteria | 2447 |
| 310 | Ga0207689_10001039 | 3300025942 | Bacteria | 26654 |
| 311 | Ga0207689_10021833 | 3300025942 | Bacteria | 5382 |
| 312 | Ga0207689_10029723 | 3300025942 | Bacteria | 4559 |
| 313 | Ga0207689_10044495 | 3300025942 | Bacteria | 3671 |
| 314 | Ga0207661_10076046 | 3300025944 | Bacteria | 2757 |
| 315 | Ga0207679_10002961 | 3300025945 | Bacteria | 10527 |
| 316 | Ga0207667_10003926 | 3300025949 | Bacteria | 18290 |
| 317 | Ga0207651_10021287 | 3300025960 | Bacteria | 3938 |
| 318 | Ga0207651_10305761 | 3300025960 | Bacteria | 1324 |
| 319 | Ga0207712_10039512 | 3300025961 | Bacteria | 3233 |
| 320 | Ga0207668_10088591 | 3300025972 | Bacteria | 2267 |
| 321 | Ga0207640_10021139 | 3300025981 | Bacteria | 3873 |
| 322 | Ga0207640_10298906 | 3300025981 | Bacteria | 1273 |
| 323 | Ga0207658_10049553 | 3300025986 | Bacteria | 3087 |
| 324 | Ga0207658_10089595 | 3300025986 | Bacteria | 2382 |
| 325 | Ga0207658_10118921 | 3300025986 | Bacteria | 2103 |
| 326 | Ga0207703_10036762 | 3300026035 | Bacteria | 3899 |
| 327 | Ga0207703_10110692 | 3300026035 | Bacteria | 2343 |
| 328 | Ga0207703_10243553 | 3300026035 | Bacteria | 1617 |
| 329 | Ga0207639_10011499 | 3300026041 | Bacteria | 6151 |
| 330 | Ga0207678_10008687 | 3300026067 | Bacteria | 8946 |
| 331 | Ga0207678_10030208 | 3300026067 | Bacteria | 4730 |
| 332 | Ga0207678_10128914 | 3300026067 | Bacteria | 2157 |
| 333 | Ga0207708_10002040 | 3300026075 | Bacteria | 14886 |
| 334 | Ga0207702_10007056 | 3300026078 | Bacteria | 9610 |
| 335 | Ga0207641_10067124 | 3300026088 | Bacteria | 3072 |
| 336 | Ga0207641_10146539 | 3300026088 | Bacteria | 2135 |
| 337 | Ga0207648_10000066 | 3300026089 | Bacteria | 98414 |
| 338 | Ga0207648_10033262 | 3300026089 | Bacteria | 4549 |
| 339 | Ga0207648_10206390 | 3300026089 | Bacteria | 1744 |
| 340 | Ga0207676_10020431 | 3300026095 | Bacteria | 4846 |
| 341 | Ga0207676_10045952 | 3300026095 | Bacteria | 3376 |
| 342 | Ga0207676_10115894 | 3300026095 | Bacteria | 2250 |
| 343 | Ga0207676_10137315 | 3300026095 | Bacteria | 2088 |
| 344 | Ga0207676_10392115 | 3300026095 | Bacteria | 1295 |
| 345 | Ga0207674_10003899 | 3300026116 | Bacteria | 18151 |
| 346 | Ga0207674_10129633 | 3300026116 | Bacteria | 2486 |
| 347 | Ga0207675_100006665 | 3300026118 | Bacteria | 10926 |
| 348 | Ga0207675_100045399 | 3300026118 | Bacteria | 4105 |
| 349 | Ga0207675_100136095 | 3300026118 | Bacteria | 2331 |
| 350 | Ga0207675_100190299 | 3300026118 | Bacteria | 1968 |
| 351 | Ga0207683_10004061 | 3300026121 | Bacteria | 12648 |
| 352 | Ga0207683_10018467 | 3300026121 | Bacteria | 5952 |
| 353 | Ga0207683_10046315 | 3300026121 | Bacteria | 3805 |
| 354 | Ga0207683_10276287 | 3300026121 | Bacteria | 1535 |
| 355 | Ga0207683_10379000 | 3300026121 | Bacteria | 1300 |
| 356 | Ga0209969_1012202 | 3300027360 | Bacteria | 1237 |
| 357 | Ga0209982_1003541 | 3300027552 | Bacteria | 2220 |
| 358 | Ga0209970_1001274 | 3300027614 | Bacteria | 4451 |
| 359 | Ga0209983_1003116 | 3300027665 | Bacteria | 3563 |
| 360 | Ga0209588_1009249 | 3300027671 | Bacteria | 2941 |
| 361 | Ga0209588_1017800 | 3300027671 | Bacteria | 2206 |
| 362 | Ga0209971_1000137 | 3300027682 | Bacteria | 21896 |
| 363 | Ga0209966_1000354 | 3300027695 | Bacteria | 14029 |
| 364 | Ga0209998_10000278 | 3300027717 | Bacteria | 16052 |
| 365 | Ga0209974_10007141 | 3300027876 | Bacteria | 3860 |
| 366 | Ga0207428_10000033 | 3300027907 | Bacteria | 232081 |
| 367 | Ga0207428_10002954 | 3300027907 | Bacteria | 16826 |
| 368 | Ga0207428_10122251 | 3300027907 | Bacteria | 1996 |
| 369 | Ga0268266_10028066 | 3300028379 | Bacteria | 4785 |
| 370 | Ga0268265_10017061 | 3300028380 | Bacteria | 5002 |
| 371 | Ga0268265_10301343 | 3300028380 | Bacteria | 1443 |
| 372 | Ga0268264_10025358 | 3300028381 | Bacteria | 4844 |
| 373 | Ga0268264_10037611 | 3300028381 | Bacteria | 3990 |
| 374 | Ga0268264_10112012 | 3300028381 | Bacteria | 2392 |
| 375 | Ga0268264_10190561 | 3300028381 | Bacteria | 1869 |
| 376 | Ga0268264_10456841 | 3300028381 | Bacteria | 1238 |
| 377 | Ga0268264_10538039 | 3300028381 | Bacteria | 1144 |
| 378 | Ga0307515_10049339 | 3300028794 | Bacteria | 6337 |
| 379 | Ga0307512_10031311 | 3300030522 | Bacteria | 4609 |
| 380 | Ga0265328_10035938 | 3300031239 | Bacteria | 1831 |
| 381 | Ga0307513_10029541 | 3300031456 | Bacteria | 6248 |
| 382 | Ga0307408_100010076 | 3300031548 | Bacteria | 6230 |
| 383 | Ga0307408_100148423 | 3300031548 | Bacteria | 1848 |
| 384 | Ga0307405_10024796 | 3300031731 | Bacteria | 3433 |
| 385 | Ga0307405_10189894 | 3300031731 | Bacteria | 1483 |
| 386 | Ga0307413_10167763 | 3300031824 | Bacteria | 1550 |
| 387 | Ga0307410_10042958 | 3300031852 | Bacteria | 2991 |
| 388 | Ga0307410_10085475 | 3300031852 | Bacteria | 2226 |
| 389 | Ga0307406_10225755 | 3300031901 | Bacteria | 1395 |
| 390 | Ga0307412_10016513 | 3300031911 | Bacteria | 4399 |
| 391 | Ga0307409_100078399 | 3300031995 | Bacteria | 2657 |
| 392 | Ga0307409_100091023 | 3300031995 | Bacteria | 2499 |
| 393 | Ga0307409_100098836 | 3300031995 | Bacteria | 2415 |
| 394 | Ga0307416_100007740 | 3300032002 | Bacteria | 6867 |
| 395 | Ga0307416_100064162 | 3300032002 | Bacteria | 3012 |
| 396 | Ga0307416_100298176 | 3300032002 | Bacteria | 1600 |
| 397 | Ga0307411_10085568 | 3300032005 | Bacteria | 2184 |
| 398 | Ga0307411_10086825 | 3300032005 | Bacteria | 2171 |
| 399 | Ga0307415_100054902 | 3300032126 | Bacteria | 2722 |
| 400 | Ga0307415_100302346 | 3300032126 | Bacteria | 1326 |
| 401 | Ga0373958_0012670 | 3300034819 | Bacteria | 1447 |
| 402 | Ga0373959_0003281 | 3300034820 | Bacteria | 2572 |
| 403 | Ga0373940_0022042 | 3300035088 | Bacteria | 1634 |
| 404 | Ga0373949_0003845 | 3300035090 | Bacteria | 3490 |
| 405 | Ga0373949_0037316 | 3300035090 | Bacteria | 1181 |
| 406 | Ga0373951_0003206 | 3300035091 | Bacteria | 4001 |
| 407 | Ga0373931_0007813 | 3300035691 | Bacteria | 5054 |
| 408 | Ga0373937_0151723 | 3300036401 | Bacteria | 2171 |
| 409 | Ga0395899_0024461 | 3300037312 | Bacteria | 4566 |
| 410 | Ga0395900_0037014 | 3300037418 | Bacteria | 5031 |
| 411 | Ga0395900_0124565 | 3300037418 | Bacteria | 2643 |
| 412 | Ga0395898_0022130 | 3300037466 | Bacteria | 6440 |
| 413 | Ga0395901_0000800 | 3300038443 | Bacteria | 34936 |
| 414 | Ga0451853_0590954 | 3300041512 | Bacteria | 3599 |
| 415 | Ga0439463_052271 | 3300042016 | Bacteria | 1042 |
| 416 | Ga0439458_0000856 | 3300042157 | Bacteria | 7869 |
| 417 | Ga0439434_0027643 | 3300042435 | Bacteria | 1716 |
| 418 | Ga0439464_0003106 | 3300042439 | Bacteria | 4156 |
| 419 | Ga0439460_0001555 | 3300042461 | Bacteria | 5409 |
| 420 | Ga0451577_0033452 | 3300042876 | Bacteria | 4634 |
| 421 | Ga0451577_0082237 | 3300042876 | Bacteria | 2872 |
| 422 | Ga0451577_0087060 | 3300042876 | Bacteria | 2787 |
| 423 | Ga0451577_0243300 | 3300042876 | Bacteria | 1628 |
| 424 | Ga0451577_0268561 | 3300042876 | Bacteria | 1545 |
| 425 | Ga0453683_0035844 | 3300044673 | Bacteria | 3124 |
| 426 | Ga0453683_0139244 | 3300044673 | Bacteria | 1531 |
| 427 | Ga0453684_0160502 | 3300044712 | Bacteria | 2660 |
| 428 | Ga0453684_0234930 | 3300044712 | Bacteria | 2114 |
| 429 | Ga0466957_0221388 | 3300044842 | Bacteria | 1250 |
| 430 | Ga0451576_0006452 | 3300045051 | Bacteria | 14383 |
| 431 | Ga0451576_0050144 | 3300045051 | Bacteria | 4379 |
| 432 | Ga0451576_0079038 | 3300045051 | Bacteria | 3422 |
| 433 | Ga0451576_0086331 | 3300045051 | Bacteria | 3263 |
| 434 | Ga0451576_0220849 | 3300045051 | Bacteria | 1978 |
| 435 | Ga0451576_0239194 | 3300045051 | Bacteria | 1897 |
| 436 | Ga0451576_0339570 | 3300045051 | Bacteria | 1572 |
| 437 | Ga0495603_0091807 | 3300046455 | Bacteria | 1775 |
| 438 | Ga0495638_0089174 | 3300046460 | Bacteria | 1861 |
| 439 | Ga0495580_0001704 | 3300046472 | Bacteria | 19309 |
| 440 | Ga0495580_0004134 | 3300046472 | Bacteria | 12232 |
| 441 | Ga0495580_0021322 | 3300046472 | Bacteria | 4781 |
| 442 | Ga0495662_0096726 | 3300046476 | Bacteria | 1443 |
| 443 | Ga0495608_0006020 | 3300046511 | Bacteria | 8621 |
| 444 | Ga0495628_0001735 | 3300046516 | Bacteria | 19829 |
| 445 | Ga0495628_0012923 | 3300046516 | Bacteria | 7030 |
| 446 | Ga0495628_0159152 | 3300046516 | Bacteria | 1717 |
| 447 | Ga0495642_0035352 | 3300046528 | Bacteria | 2016 |
| 448 | Ga0495640_0035527 | 3300046533 | Bacteria | 3527 |
| 449 | Ga0495640_0102881 | 3300046533 | Bacteria | 1873 |
| 450 | Ga0495667_0062495 | 3300046559 | Bacteria | 2440 |
| 451 | Ga0495656_0055350 | 3300046615 | Bacteria | 1710 |
| 452 | Ga0495635_0212766 | 3300046663 | Bacteria | 1309 |
| 453 | Ga0495659_0037464 | 3300046664 | Bacteria | 1718 |
| 454 | Ga0495588_0092919 | 3300046674 | Bacteria | 1581 |
| 455 | Ga0495669_0058935 | 3300046684 | Bacteria | 1733 |
| 456 | Ga0495674_0160825 | 3300047319 | Bacteria | 1879 |
| 457 | Ga0495614_0098382 | 3300048089 | Bacteria | 1277 |
| 458 | Ga0496101_0038412 | 3300048904 | Bacteria | 3401 |
| 459 | Ga0496104_0027085 | 3300048907 | Bacteria | 5301 |
| 460 | Ga0496106_0056733 | 3300048909 | Bacteria | 2961 |
| 461 | Ga0496107_0256157 | 3300048910 | Bacteria | 1302 |
| 462 | Ga0496108_0020778 | 3300048911 | Bacteria | 5397 |
| 463 | Ga0496109_0001763 | 3300048912 | Bacteria | 17979 |
| 464 | Ga0496110_0043201 | 3300048913 | Bacteria | 3935 |
| 465 | Ga0496112_0001651 | 3300048915 | Bacteria | 17324 |
| 466 | Ga0496113_0056221 | 3300048916 | Bacteria | 2953 |
| 467 | Ga0496114_0203591 | 3300048917 | Bacteria | 1734 |
| 468 | Ga0496114_0359884 | 3300048917 | Bacteria | 1287 |
| 469 | Ga0501033_0033751 | 3300049570 | Bacteria | 3842 |
| 470 | Ga0501033_0043722 | 3300049570 | Bacteria | 3336 |
| 471 | Ga0501033_0049919 | 3300049570 | Bacteria | 3105 |
| 472 | Ga0501033_0230787 | 3300049570 | Bacteria | 1315 |
| 473 | Ga0501033_0243433 | 3300049570 | Bacteria | 1276 |
| 474 | Ga0501034_0028788 | 3300049571 | Bacteria | 5652 |
| 475 | Ga0501036_0009822 | 3300049572 | Bacteria | 7880 |
| 476 | Ga0501036_0030397 | 3300049572 | Bacteria | 4563 |
| 477 | Ga0501036_0114144 | 3300049572 | Bacteria | 2283 |
| 478 | Ga0501036_0152082 | 3300049572 | Bacteria | 1952 |
| 479 | Ga0501036_0161392 | 3300049572 | Bacteria | 1890 |
| 480 | Ga0501036_0250896 | 3300049572 | Bacteria | 1483 |
| 481 | Ga0501036_0342010 | 3300049572 | Bacteria | 1250 |
| 482 | Ga0501037_0166525 | 3300049573 | Bacteria | 1569 |
| 483 | Ga0501038_0056475 | 3300049574 | Bacteria | 3371 |
| 484 | Ga0501038_0268471 | 3300049574 | Bacteria | 1346 |
| 485 | Ga0501039_0038953 | 3300049575 | Bacteria | 3671 |
| 486 | Ga0501039_0332974 | 3300049575 | Bacteria | 1193 |
| 487 | Ga0501040_0001869 | 3300049576 | Bacteria | 13503 |
| 488 | Ga0501040_0003568 | 3300049576 | Bacteria | 10063 |
| 489 | Ga0501040_0004654 | 3300049576 | Bacteria | 8903 |
| 490 | Ga0501040_0073285 | 3300049576 | Bacteria | 2366 |
| 491 | Ga0501040_0147158 | 3300049576 | Bacteria | 1661 |
| 492 | Ga0501041_0009193 | 3300049577 | Bacteria | 5821 |
| 493 | Ga0501041_0014660 | 3300049577 | Bacteria | 4654 |
| 494 | Ga0501041_0044228 | 3300049577 | Bacteria | 2707 |
| 495 | Ga0501041_0215551 | 3300049577 | Bacteria | 1204 |
| 496 | Ga0501042_0001174 | 3300049578 | Bacteria | 15170 |
| 497 | Ga0501042_0002362 | 3300049578 | Bacteria | 11573 |
| 498 | Ga0501042_0003676 | 3300049578 | Bacteria | 9671 |
| 499 | Ga0501042_0028657 | 3300049578 | Bacteria | 3926 |
| 500 | Ga0501042_0322487 | 3300049578 | Bacteria | 1116 |
| 501 | Ga0501046_0009939 | 3300049580 | Bacteria | 8197 |
| 502 | Ga0501046_0046076 | 3300049580 | Bacteria | 3462 |
| 503 | Ga0501046_0109902 | 3300049580 | Bacteria | 2107 |
| 504 | Ga0501046_0150184 | 3300049580 | Bacteria | 1758 |
| 505 | Ga0501047_0033160 | 3300049581 | Bacteria | 4985 |
| 506 | Ga0501047_0379649 | 3300049581 | Bacteria | 1248 |
| 507 | Ga0501048_0035731 | 3300049582 | Bacteria | 3575 |
| 508 | Ga0501048_0237094 | 3300049582 | Bacteria | 1294 |
| 509 | Ga0501067_0009421 | 3300049583 | Bacteria | 5411 |
| 510 | Ga0501068_0014096 | 3300049584 | Bacteria | 4564 |
| 511 | Ga0501068_0015010 | 3300049584 | Bacteria | 4440 |
| 512 | Ga0501068_0052752 | 3300049584 | Bacteria | 2461 |
| 513 | Ga0501071_0007644 | 3300049587 | Bacteria | 7122 |
| 514 | Ga0501071_0049024 | 3300049587 | Bacteria | 3039 |
| 515 | Ga0501071_0113915 | 3300049587 | Bacteria | 2000 |
| 516 | Ga0501071_0179048 | 3300049587 | Bacteria | 1588 |
| 517 | Ga0501071_0224263 | 3300049587 | Bacteria | 1415 |
| 518 | Ga0501071_0261554 | 3300049587 | Bacteria | 1307 |
| 519 | Ga0501072_0001344 | 3300049588 | Bacteria | 18413 |
| 520 | Ga0501072_0003788 | 3300049588 | Bacteria | 11420 |
| 521 | Ga0501072_0016206 | 3300049588 | Bacteria | 5717 |
| 522 | Ga0501072_0038075 | 3300049588 | Bacteria | 3775 |
| 523 | Ga0501072_0061364 | 3300049588 | Bacteria | 2965 |
| 524 | Ga0501072_0094873 | 3300049588 | Bacteria | 2371 |
| 525 | Ga0501073_0124322 | 3300049589 | Bacteria | 1788 |
| 526 | Ga0501074_0013593 | 3300049590 | Bacteria | 5918 |
| 527 | Ga0501074_0058038 | 3300049590 | Bacteria | 2788 |
| 528 | Ga0501074_0126110 | 3300049590 | Bacteria | 1831 |
| 529 | Ga0501075_0004490 | 3300049591 | Bacteria | 9450 |
| 530 | Ga0501075_0007341 | 3300049591 | Bacteria | 7645 |
| 531 | Ga0501075_0016313 | 3300049591 | Bacteria | 5348 |
| 532 | Ga0501075_0024123 | 3300049591 | Bacteria | 4455 |
| 533 | Ga0501075_0034077 | 3300049591 | Bacteria | 3790 |
| 534 | Ga0501075_0123861 | 3300049591 | Bacteria | 1968 |
| 535 | Ga0501075_0154890 | 3300049591 | Bacteria | 1747 |
| 536 | Ga0501075_0298052 | 3300049591 | Bacteria | 1228 |
| 537 | Ga0501075_0328099 | 3300049591 | Bacteria | 1166 |
| 538 | Ga0501075_0403613 | 3300049591 | Bacteria | 1042 |
| 539 | Ga0501076_0003486 | 3300049592 | Bacteria | 11051 |
| 540 | Ga0501076_0009184 | 3300049592 | Bacteria | 7289 |
| 541 | Ga0501076_0022777 | 3300049592 | Bacteria | 4818 |
| 542 | Ga0501076_0024869 | 3300049592 | Bacteria | 4632 |
| 543 | Ga0501076_0030135 | 3300049592 | Bacteria | 4225 |
| 544 | Ga0501076_0055384 | 3300049592 | Bacteria | 3145 |
| 545 | Ga0501076_0088951 | 3300049592 | Bacteria | 2482 |
| 546 | Ga0501076_0185539 | 3300049592 | Bacteria | 1696 |
| 547 | Ga0501076_0423857 | 3300049592 | Bacteria | 1095 |
| 548 | Ga0501077_0010203 | 3300049593 | Bacteria | 5849 |
| 549 | Ga0501077_0022486 | 3300049593 | Bacteria | 3994 |
| 550 | Ga0501077_0037763 | 3300049593 | Bacteria | 3075 |
| 551 | Ga0501079_0006450 | 3300049741 | Bacteria | 8812 |
| 552 | Ga0501079_0007316 | 3300049741 | Bacteria | 8341 |
| 553 | Ga0501079_0019688 | 3300049741 | Bacteria | 5155 |
| 554 | Ga0501079_0111906 | 3300049741 | Bacteria | 2122 |
| 555 | Ga0501079_0126509 | 3300049741 | Bacteria | 1988 |
| 556 | Ga0501079_0181078 | 3300049741 | Bacteria | 1644 |
| 557 | Ga0501080_0038130 | 3300049742 | Bacteria | 4488 |
| 558 | Ga0501080_0086478 | 3300049742 | Bacteria | 2913 |
| 559 | Ga0501080_0088096 | 3300049742 | Bacteria | 2884 |
| 560 | Ga0501080_0136483 | 3300049742 | Bacteria | 2270 |
| 561 | Ga0501081_0002753 | 3300049743 | Bacteria | 11146 |
| 562 | Ga0501081_0003490 | 3300049743 | Bacteria | 10051 |
| 563 | Ga0501081_0006156 | 3300049743 | Bacteria | 7773 |
| 564 | Ga0501081_0006694 | 3300049743 | Bacteria | 7490 |
| 565 | Ga0501081_0006909 | 3300049743 | Bacteria | 7374 |
| 566 | Ga0501081_0097109 | 3300049743 | Bacteria | 2079 |
| 567 | Ga0501081_0117111 | 3300049743 | Bacteria | 1895 |
| 568 | Ga0501081_0147783 | 3300049743 | Bacteria | 1687 |
| 569 | Ga0501081_0222429 | 3300049743 | Bacteria | 1373 |
| 570 | Ga0501081_0301912 | 3300049743 | Bacteria | 1175 |
| 571 | Ga0501081_0312634 | 3300049743 | Bacteria | 1154 |
| 572 | Ga0501081_0324829 | 3300049743 | Bacteria | 1131 |
| 573 | Ga0501035_0444547 | 3300049822 | Bacteria | 1073 |
| 574 | Ga0501044_0016417 | 3300049823 | Bacteria | 7948 |
| 575 | Ga0501045_0000340 | 3300049824 | Bacteria | 27693 |
| 576 | Ga0501045_0022534 | 3300049824 | Bacteria | 4511 |
| 577 | Ga0501045_0035346 | 3300049824 | Bacteria | 3628 |
| 578 | Ga0501045_0052866 | 3300049824 | Bacteria | 2967 |
| 579 | Ga0501045_0157311 | 3300049824 | Bacteria | 1691 |
| 580 | nmdc:mga05p37_120524_c1 | 3300050507 | Bacteria | 3223 |
| 581 | nmdc:mga05p37_134102_c1 | 3300050507 | Bacteria | 3038 |
| 582 | nmdc:mga05p37_13734_c1 | 3300050507 | Bacteria | 9703 |
| 583 | nmdc:mga05p37_30941_c1 | 3300050507 | Bacteria | 6535 |
| 584 | nmdc:mga05p37_35081_c1 | 3300050507 | Bacteria | 6149 |
| 585 | nmdc:mga05p37_3828_c1 | 3300050507 | Bacteria | 17597 |
| 586 | nmdc:mga05p37_39684_c1 | 3300050507 | Bacteria | 5780 |
| 587 | nmdc:mga05p37_486453_c1 | 3300050507 | Bacteria | 1420 |
| 588 | nmdc:mga05p37_546910_c1 | 3300050507 | Bacteria | 1319 |
| 589 | nmdc:mga05p37_683066_c1 | 3300050507 | Bacteria | 1144 |
| 590 | nmdc:mga05p37_7057_c1 | 3300050507 | Bacteria | 13242 |
| 591 | nmdc:mga05p37_9544_c1 | 3300050507 | Bacteria | 11492 |
| 592 | nmdc:mga09592_1842_c1 | 3300050508 | Bacteria | 17047 |
| 593 | nmdc:mga09592_27860_c1 | 3300050508 | Bacteria | 4690 |
| 594 | nmdc:mga09592_299673_c1 | 3300050508 | Bacteria | 1394 |
| 595 | nmdc:mga09592_360504_c1 | 3300050508 | Bacteria | 1258 |
| 596 | nmdc:mga09592_90362_c1 | 3300050508 | Bacteria | 2616 |
| 597 | nmdc:mga0qj67_151403_c1 | 3300050509 | Bacteria | 1882 |
| 598 | nmdc:mga0qj67_2581_c1 | 3300050509 | Bacteria | 12955 |
| 599 | nmdc:mga0qj67_66067_c1 | 3300050509 | Bacteria | 2880 |
| 600 | nmdc:mga0qj67_9351_c1 | 3300050509 | Bacteria | 7289 |
| 601 | nmdc:mga06r32_118866_c1 | 3300050510 | Bacteria | 2606 |
| 602 | nmdc:mga06r32_164351_c1 | 3300050510 | Bacteria | 2202 |
| 603 | nmdc:mga06r32_16710_c1 | 3300050510 | Bacteria | 6689 |
| 604 | nmdc:mga06r32_21876_c1 | 3300050510 | Bacteria | 5906 |
| 605 | nmdc:mga06r32_27719_c1 | 3300050510 | Bacteria | 5295 |
| 606 | nmdc:mga06r32_50067_c1 | 3300050510 | Bacteria | 3996 |
| 607 | nmdc:mga06r32_8196_c1 | 3300050510 | Bacteria | 9404 |
| 608 | nmdc:mga06r32_99737_c1 | 3300050510 | Bacteria | 2849 |
| 609 | nmdc:mga08y16_2189_c1 | 3300050511 | Bacteria | 20051 |
| 610 | nmdc:mga08y16_43295_c1 | 3300050511 | Bacteria | 4718 |
| 611 | nmdc:mga08y16_5112_c1 | 3300050511 | Bacteria | 13706 |
| 612 | nmdc:mga08y16_60756_c1 | 3300050511 | Bacteria | 3947 |
| 613 | nmdc:mga08y16_90648_c1 | 3300050511 | Bacteria | 3187 |
| 614 | nmdc:mga0n895_108653_c1 | 3300050512 | Bacteria | 2789 |
| 615 | nmdc:mga0n895_25456_c1 | 3300050512 | Bacteria | 5591 |
| 616 | nmdc:mga0n895_3140_c1 | 3300050512 | Bacteria | 13183 |
| 617 | nmdc:mga0n895_74813_c1 | 3300050512 | Bacteria | 3366 |
| 618 | nmdc:mga0rr50_107886_c1 | 3300050513 | Bacteria | 2199 |
| 619 | nmdc:mga0rr50_110799_c1 | 3300050513 | Bacteria | 2172 |
| 620 | nmdc:mga0rr50_158228_c1 | 3300050513 | Bacteria | 1837 |
| 621 | nmdc:mga0rr50_28588_c1 | 3300050513 | Bacteria | 3920 |
| 622 | nmdc:mga0rr50_46108_c1 | 3300050513 | Bacteria | 3208 |
| 623 | nmdc:mga0rr50_51144_c1 | 3300050513 | Bacteria | 3065 |
| 624 | nmdc:mga0rr50_6438_c1 | 3300050513 | Bacteria | 7148 |
| 625 | nmdc:mga0rr50_79833_c1 | 3300050513 | Bacteria | 2521 |
| 626 | nmdc:mga08x19_17940_c1 | 3300050514 | Bacteria | 4334 |
| 627 | nmdc:mga08x19_67016_c1 | 3300050514 | Bacteria | 2335 |
| 628 | nmdc:mga08x19_98478_c1 | 3300050514 | Bacteria | 1937 |
| 629 | nmdc:mga0a205_14434_c1 | 3300050515 | Bacteria | 7368 |
| 630 | nmdc:mga0a205_175563_c1 | 3300050515 | Unclassified | 2038 |
| 631 | nmdc:mga0a205_20368_c1 | 3300050515 | Bacteria | 6256 |
| 632 | nmdc:mga0a205_261593_c1 | 3300050515 | Bacteria | 1608 |
| 633 | nmdc:mga0a205_28188_c2 | 3300050515 | Bacteria | 4329 |
| 634 | nmdc:mga0a205_32_c1 | 3300050515 | Bacteria | 79060 |
| 635 | nmdc:mga0a205_64122_c1 | 3300050515 | Bacteria | 3549 |
| 636 | Ga0495601_0066542 | 3300053077 | Bacteria | 2294 |
| 637 | Ga0495595_0031552 | 3300053084 | Bacteria | 2382 |
| 638 | Ga0495619_0055479 | 3300053085 | Bacteria | 2624 |
| 639 | Ga0500568_0002127 | 3300053139 | Bacteria | 11957 |
| 640 | Ga0501084_0006596 | 3300054114 | Bacteria | 9540 |
| 641 | Ga0501084_0008353 | 3300054114 | Bacteria | 8547 |
| 642 | Ga0501084_0013589 | 3300054114 | Bacteria | 6737 |
| 643 | Ga0501084_0018144 | 3300054114 | Bacteria | 5860 |
| 644 | Ga0501084_0107065 | 3300054114 | Bacteria | 2349 |
| 645 | Ga0501084_0116990 | 3300054114 | Bacteria | 2241 |
| 646 | Ga0501084_0142449 | 3300054114 | Bacteria | 2019 |
| 647 | Ga0501084_0174837 | 3300054114 | Bacteria | 1812 |
| 648 | Ga0501084_0228081 | 3300054114 | Bacteria | 1572 |
| 649 | Ga0501084_0382226 | 3300054114 | Bacteria | 1190 |
| 650 | Ga0590071_012209 | 3300059421 | Bacteria | 2013 |
| 651 | Ga0590075_006024 | 3300059424 | Bacteria | 2870 |
| 652 | Ga0590077_001701 | 3300059426 | Bacteria | 5003 |
| 653 | Ga0590077_002796 | 3300059426 | Bacteria | 3673 |
| 654 | Ga0501082_0002155 | 3300060353 | Bacteria | 17252 |
| 655 | Ga0501082_0004795 | 3300060353 | Bacteria | 11797 |
| 656 | Ga0501082_0066055 | 3300060353 | Bacteria | 3115 |
| 657 | Ga0501082_0115887 | 3300060353 | Bacteria | 2320 |
| 658 | Ga0501082_0152616 | 3300060353 | Bacteria | 2007 |
| 659 | Ga0501082_0177809 | 3300060353 | Bacteria | 1850 |
| 660 | Ga0501082_0275053 | 3300060353 | Bacteria | 1466 |
| 661 | Ga0501082_0411911 | 3300060353 | Bacteria | 1180 |
| 662 | Ga0530510_0001210 | 3300061734 | Bacteria | 17226 |
| 663 | Ga0530510_0013034 | 3300061734 | Bacteria | 5848 |
| 664 | Ga0530510_0038469 | 3300061734 | Bacteria | 3454 |
| 665 | Ga0530510_0115266 | 3300061734 | Bacteria | 1970 |
| 666 | Ga0530510_0176812 | 3300061734 | Bacteria | 1582 |
| 667 | Ga0530510_0200404 | 3300061734 | Bacteria | 1482 |
| 668 | Ga0530510_0218830 | 3300061734 | Bacteria | 1415 |
| 669 | Ga0530510_0352543 | 3300061734 | Bacteria | 1105 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10879259 | Ga0114129_108792592 | 279 |
| 2 | 3300050515 | nmdc:mga0a205_175563_c1 | nmdc:mga0a205_175563_c1_11_862 | 279 |
| 3 | 3300049587 | Ga0501071_0261554 | Ga0501071_0261554_14_892 | 291 |
| 4 | 3300045051 | Ga0451576_0220849 | Ga0451576_0220849_1070_1960 | 295 |
| 5 | 3300049574 | Ga0501038_0056475 | Ga0501038_0056475_555_1487 | 299 |
| 6 | 3300049580 | Ga0501046_0046076 | Ga0501046_0046076_2248_3171 | 306 |
| 7 | 3300049592 | Ga0501076_0055384 | Ga0501076_0055384_650_1576 | 306 |
| 8 | 3300049592 | Ga0501076_0024869 | Ga0501076_0024869_3692_4621 | 308 |
| 9 | 3300005445 | Ga0070708_100096190 | Ga0070708_1000961902 | 310 |
| 10 | 3300005467 | Ga0070706_100022362 | Ga0070706_1000223622 | 310 |
| 11 | 3300005468 | Ga0070707_100147609 | Ga0070707_1001476092 | 310 |
| 12 | 3300005536 | Ga0070697_100284831 | Ga0070697_1002848311 | 310 |
| 13 | 3300007076 | Ga0075435_100239810 | Ga0075435_1002398102 | 310 |
| 14 | 3300025910 | Ga0207684_10019054 | Ga0207684_100190542 | 310 |
| 15 | 3300025910 | Ga0207684_10040389 | Ga0207684_100403892 | 310 |
| 16 | 3300025910 | Ga0207684_10198158 | Ga0207684_101981582 | 310 |
| 17 | 3300025922 | Ga0207646_10039441 | Ga0207646_100394413 | 310 |
| 18 | 3300044673 | Ga0453683_0139244 | Ga0453683_0139244_524_1459 | 310 |
| 19 | 3300049576 | Ga0501040_0147158 | Ga0501040_0147158_674_1609 | 310 |
| 20 | 3300049577 | Ga0501041_0215551 | Ga0501041_0215551_207_1142 | 310 |
| 21 | 3300049591 | Ga0501075_0403613 | Ga0501075_0403613_86_1021 | 310 |
| 22 | 3300049592 | Ga0501076_0423857 | Ga0501076_0423857_23_958 | 310 |
| 23 | 3300049741 | Ga0501079_0126509 | Ga0501079_0126509_1034_1969 | 310 |
| 24 | 3300049743 | Ga0501081_0147783 | Ga0501081_0147783_43_978 | 310 |
| 25 | 3300049743 | Ga0501081_0222429 | Ga0501081_0222429_425_1360 | 310 |
| 26 | 3300049743 | Ga0501081_0301912 | Ga0501081_0301912_40_975 | 310 |
| 27 | 3300049743 | Ga0501081_0312634 | Ga0501081_0312634_187_1122 | 310 |
| 28 | 3300049743 | Ga0501081_0324829 | Ga0501081_0324829_142_1077 | 310 |
| 29 | 3300049822 | Ga0501035_0444547 | Ga0501035_0444547_53_988 | 310 |
| 30 | 3300050507 | nmdc:mga05p37_683066_c1 | nmdc:mga05p37_683066_c1_99_1034 | 310 |
| 31 | 3300050507 | nmdc:mga05p37_7057_c1 | nmdc:mga05p37_7057_c1_5347_6282 | 310 |
| 32 | 3300050508 | nmdc:mga09592_360504_c1 | nmdc:mga09592_360504_c1_303_1238 | 310 |
| 33 | 3300050509 | nmdc:mga0qj67_151403_c1 | nmdc:mga0qj67_151403_c1_772_1707 | 310 |
| 34 | 3300050510 | nmdc:mga06r32_50067_c1 | nmdc:mga06r32_50067_c1_1819_2754 | 310 |
| 35 | 3300050512 | nmdc:mga0n895_25456_c1 | nmdc:mga0n895_25456_c1_258_1193 | 310 |
| 36 | 3300050513 | nmdc:mga0rr50_107886_c1 | nmdc:mga0rr50_107886_c1_346_1368 | 310 |
| 37 | 3300050513 | nmdc:mga0rr50_51144_c1 | nmdc:mga0rr50_51144_c1_1852_2787 | 310 |
| 38 | 3300050514 | nmdc:mga08x19_98478_c1 | nmdc:mga08x19_98478_c1_74_1096 | 310 |
| 39 | 3300050515 | nmdc:mga0a205_14434_c1 | nmdc:mga0a205_14434_c1_258_1193 | 310 |
| 40 | 3300060353 | Ga0501082_0177809 | Ga0501082_0177809_50_985 | 310 |
| 41 | 3300061734 | Ga0530510_0218830 | Ga0530510_0218830_453_1388 | 310 |
| 42 | 3300006871 | Ga0075434_100012802 | Ga0075434_1000128026 | 314 |
| 43 | 3300007076 | Ga0075435_100025026 | Ga0075435_1000250262 | 314 |
| 44 | 3300035088 | Ga0373940_0022042 | Ga0373940_0022042_145_1167 | 314 |
| 45 | 3300042876 | Ga0451577_0268561 | Ga0451577_0268561_139_1161 | 314 |
| 46 | 3300045051 | Ga0451576_0086331 | Ga0451576_0086331_995_2017 | 314 |
| 47 | 3300046472 | Ga0495580_0004134 | Ga0495580_0004134_2300_3322 | 314 |
| 48 | 3300046528 | Ga0495642_0035352 | Ga0495642_0035352_149_1171 | 314 |
| 49 | 3300046516 | Ga0495628_0012923 | Ga0495628_0012923_5870_6892 | 318 |
| 50 | 3300009177 | Ga0105248_10527950 | Ga0105248_105279501 | 319 |
| 51 | 3300005471 | Ga0070698_100386670 | Ga0070698_1003866701 | 324 |
| 52 | 3300009553 | Ga0105249_10249963 | Ga0105249_102499632 | 324 |
| 53 | 3300005549 | Ga0070704_100231345 | Ga0070704_1002313452 | 325 |
| 54 | 3300005436 | Ga0070713_100032883 | Ga0070713_1000328834 | 326 |
| 55 | 3300005844 | Ga0068862_100118571 | Ga0068862_1001185712 | 326 |
| 56 | 3300028380 | Ga0268265_10301343 | Ga0268265_103013431 | 326 |
| 57 | 3300049570 | Ga0501033_0049919 | Ga0501033_0049919_198_1214 | 327 |
| 58 | 3300049572 | Ga0501036_0009822 | Ga0501036_0009822_313_1329 | 327 |
| 59 | 3300049573 | Ga0501037_0166525 | Ga0501037_0166525_95_1111 | 327 |
| 60 | 3300049576 | Ga0501040_0003568 | Ga0501040_0003568_6312_7328 | 327 |
| 61 | 3300049577 | Ga0501041_0009193 | Ga0501041_0009193_4315_5331 | 327 |
| 62 | 3300049578 | Ga0501042_0002362 | Ga0501042_0002362_4093_5109 | 327 |
| 63 | 3300049580 | Ga0501046_0009939 | Ga0501046_0009939_3543_4559 | 327 |
| 64 | 3300049587 | Ga0501071_0007644 | Ga0501071_0007644_3803_4819 | 327 |
| 65 | 3300049588 | Ga0501072_0003788 | Ga0501072_0003788_6733_7749 | 327 |
| 66 | 3300049590 | Ga0501074_0126110 | Ga0501074_0126110_294_1310 | 327 |
| 67 | 3300049592 | Ga0501076_0030135 | Ga0501076_0030135_1344_2360 | 327 |
| 68 | 3300049593 | Ga0501077_0037763 | Ga0501077_0037763_491_1507 | 327 |
| 69 | 3300049741 | Ga0501079_0019688 | Ga0501079_0019688_494_1510 | 327 |
| 70 | 3300049742 | Ga0501080_0038130 | Ga0501080_0038130_519_1535 | 327 |
| 71 | 3300049743 | Ga0501081_0002753 | Ga0501081_0002753_6484_7500 | 327 |
| 72 | 3300049824 | Ga0501045_0022534 | Ga0501045_0022534_2999_4015 | 327 |
| 73 | 3300054114 | Ga0501084_0008353 | Ga0501084_0008353_1580_2596 | 327 |
| 74 | 3300060353 | Ga0501082_0004795 | Ga0501082_0004795_6467_7483 | 327 |
| 75 | 3300061734 | Ga0530510_0001210 | Ga0530510_0001210_14104_15120 | 327 |
| 76 | 3300005330 | Ga0070690_100151733 | Ga0070690_1001517332 | 329 |
| 77 | 3300005340 | Ga0070689_100047342 | Ga0070689_1000473423 | 329 |
| 78 | 3300005365 | Ga0070688_100076231 | Ga0070688_1000762313 | 329 |
| 79 | 3300005367 | Ga0070667_100137791 | Ga0070667_1001377913 | 329 |
| 80 | 3300005548 | Ga0070665_100122418 | Ga0070665_1001224184 | 329 |
| 81 | 3300005617 | Ga0068859_100070347 | Ga0068859_1000703473 | 329 |
| 82 | 3300005834 | Ga0068851_10126146 | Ga0068851_101261462 | 329 |
| 83 | 3300005841 | Ga0068863_100039352 | Ga0068863_1000393521 | 329 |
| 84 | 3300006237 | Ga0097621_100299659 | Ga0097621_1002996592 | 329 |
| 85 | 3300006931 | Ga0097620_100070348 | Ga0097620_1000703482 | 329 |
| 86 | 3300013308 | Ga0157375_10096361 | Ga0157375_100963612 | 329 |
| 87 | 3300014969 | Ga0157376_10042390 | Ga0157376_100423904 | 329 |
| 88 | 3300025903 | Ga0207680_10080327 | Ga0207680_100803272 | 329 |
| 89 | 3300025926 | Ga0207659_10373640 | Ga0207659_103736401 | 329 |
| 90 | 3300025940 | Ga0207691_10130305 | Ga0207691_101303053 | 329 |
| 91 | 3300025941 | Ga0207711_10052176 | Ga0207711_100521763 | 329 |
| 92 | 3300025986 | Ga0207658_10089595 | Ga0207658_100895952 | 329 |
| 93 | 3300026067 | Ga0207678_10128914 | Ga0207678_101289141 | 329 |
| 94 | 3300026095 | Ga0207676_10137315 | Ga0207676_101373152 | 329 |
| 95 | 3300026121 | Ga0207683_10004061 | Ga0207683_100040611 | 329 |
| 96 | 3300028379 | Ga0268266_10028066 | Ga0268266_100280664 | 329 |
| 97 | 3300050515 | nmdc:mga0a205_20368_c1 | nmdc:mga0a205_20368_c1_30_1025 | 330 |
| 98 | 3300046533 | Ga0495640_0035527 | Ga0495640_0035527_1898_2914 | 333 |
| 99 | 3300046663 | Ga0495635_0212766 | Ga0495635_0212766_70_1086 | 333 |
| 100 | 3300005293 | Ga0065715_10001125 | Ga0065715_100011258 | 334 |
| 101 | 3300005331 | Ga0070670_100045773 | Ga0070670_1000457735 | 334 |
| 102 | 3300005343 | Ga0070687_100043337 | Ga0070687_1000433373 | 334 |
| 103 | 3300005354 | Ga0070675_100004816 | Ga0070675_1000048162 | 334 |
| 104 | 3300005365 | Ga0070688_100053051 | Ga0070688_1000530513 | 334 |
| 105 | 3300005365 | Ga0070688_100126091 | Ga0070688_1001260912 | 334 |
| 106 | 3300005438 | Ga0070701_10136554 | Ga0070701_101365541 | 334 |
| 107 | 3300005456 | Ga0070678_100028714 | Ga0070678_1000287144 | 334 |
| 108 | 3300005543 | Ga0070672_100013577 | Ga0070672_1000135773 | 334 |
| 109 | 3300005548 | Ga0070665_100035594 | Ga0070665_1000355944 | 334 |
| 110 | 3300005614 | Ga0068856_100245269 | Ga0068856_1002452692 | 334 |
| 111 | 3300005617 | Ga0068859_100484606 | Ga0068859_1004846061 | 334 |
| 112 | 3300005618 | Ga0068864_100082030 | Ga0068864_1000820303 | 334 |
| 113 | 3300005719 | Ga0068861_100085635 | Ga0068861_1000856353 | 334 |
| 114 | 3300005841 | Ga0068863_100110013 | Ga0068863_1001100133 | 334 |
| 115 | 3300005844 | Ga0068862_100204643 | Ga0068862_1002046433 | 334 |
| 116 | 3300006237 | Ga0097621_100182007 | Ga0097621_1001820072 | 334 |
| 117 | 3300006852 | Ga0075433_10235906 | Ga0075433_102359062 | 334 |
| 118 | 3300006914 | Ga0075436_100201299 | Ga0075436_1002012992 | 334 |
| 119 | 3300006931 | Ga0097620_100484648 | Ga0097620_1004846481 | 334 |
| 120 | 3300009093 | Ga0105240_10075893 | Ga0105240_100758933 | 334 |
| 121 | 3300009147 | Ga0114129_10250363 | Ga0114129_102503632 | 334 |
| 122 | 3300009177 | Ga0105248_10104872 | Ga0105248_101048722 | 334 |
| 123 | 3300009177 | Ga0105248_10701086 | Ga0105248_107010861 | 334 |
| 124 | 3300009553 | Ga0105249_10032354 | Ga0105249_100323544 | 334 |
| 125 | 3300011119 | Ga0105246_10031604 | Ga0105246_100316045 | 334 |
| 126 | 3300013306 | Ga0163162_10097126 | Ga0163162_100971264 | 334 |
| 127 | 3300013308 | Ga0157375_10302882 | Ga0157375_103028821 | 334 |
| 128 | 3300014325 | Ga0163163_10138267 | Ga0163163_101382674 | 334 |
| 129 | 3300014326 | Ga0157380_10106836 | Ga0157380_101068362 | 334 |
| 130 | 3300025315 | Ga0207697_10047862 | Ga0207697_100478622 | 334 |
| 131 | 3300025918 | Ga0207662_10059061 | Ga0207662_100590611 | 334 |
| 132 | 3300025925 | Ga0207650_10043508 | Ga0207650_100435082 | 334 |
| 133 | 3300025925 | Ga0207650_10231081 | Ga0207650_102310812 | 334 |
| 134 | 3300025926 | Ga0207659_10085851 | Ga0207659_100858512 | 334 |
| 135 | 3300025936 | Ga0207670_10095709 | Ga0207670_100957093 | 334 |
| 136 | 3300025940 | Ga0207691_10110850 | Ga0207691_101108503 | 334 |
| 137 | 3300025941 | Ga0207711_10044986 | Ga0207711_100449865 | 334 |
| 138 | 3300025944 | Ga0207661_10076046 | Ga0207661_100760463 | 334 |
| 139 | 3300025960 | Ga0207651_10021287 | Ga0207651_100212871 | 334 |
| 140 | 3300025961 | Ga0207712_10039512 | Ga0207712_100395123 | 334 |
| 141 | 3300025972 | Ga0207668_10088591 | Ga0207668_100885912 | 334 |
| 142 | 3300026088 | Ga0207641_10067124 | Ga0207641_100671243 | 334 |
| 143 | 3300026095 | Ga0207676_10045952 | Ga0207676_100459523 | 334 |
| 144 | 3300026121 | Ga0207683_10018467 | Ga0207683_100184674 | 334 |
| 145 | 3300026121 | Ga0207683_10046315 | Ga0207683_100463151 | 334 |
| 146 | 3300036401 | Ga0373937_0151723 | Ga0373937_0151723_359_1372 | 334 |
| 147 | 3300044842 | Ga0466957_0221388 | Ga0466957_0221388_201_1217 | 334 |
| 148 | 3300048904 | Ga0496101_0038412 | Ga0496101_0038412_297_1331 | 334 |
| 149 | 3300048907 | Ga0496104_0027085 | Ga0496104_0027085_1676_2710 | 334 |
| 150 | 3300048910 | Ga0496107_0256157 | Ga0496107_0256157_218_1252 | 334 |
| 151 | 3300048911 | Ga0496108_0020778 | Ga0496108_0020778_1952_2986 | 334 |
| 152 | 3300048912 | Ga0496109_0001763 | Ga0496109_0001763_3231_4265 | 334 |
| 153 | 3300048913 | Ga0496110_0043201 | Ga0496110_0043201_341_1375 | 334 |
| 154 | 3300048915 | Ga0496112_0001651 | Ga0496112_0001651_12904_13938 | 334 |
| 155 | 3300048916 | Ga0496113_0056221 | Ga0496113_0056221_177_1211 | 334 |
| 156 | 3300049571 | Ga0501034_0028788 | Ga0501034_0028788_1038_2054 | 334 |
| 157 | 3300049581 | Ga0501047_0379649 | Ga0501047_0379649_60_1076 | 334 |
| 158 | 3300049823 | Ga0501044_0016417 | Ga0501044_0016417_6456_7472 | 334 |
| 159 | 3300050511 | nmdc:mga08y16_90648_c1 | nmdc:mga08y16_90648_c1_1168_2184 | 334 |
| 160 | 3300050513 | nmdc:mga0rr50_46108_c1 | nmdc:mga0rr50_46108_c1_542_1558 | 334 |
| 161 | 3300054114 | Ga0501084_0382226 | Ga0501084_0382226_152_1168 | 334 |
| 162 | 3300059421 | Ga0590071_012209 | Ga0590071_012209_611_1696 | 334 |
| 163 | 3300060353 | Ga0501082_0411911 | Ga0501082_0411911_89_1105 | 334 |
| 164 | 3300003503 | JGI26141J51220_1000130 | JGI26141J51220_10001304 | 335 |
| 165 | 3300005457 | Ga0070662_100039211 | Ga0070662_1000392113 | 335 |
| 166 | 3300005530 | Ga0070679_100076878 | Ga0070679_1000768783 | 335 |
| 167 | 3300005545 | Ga0070695_100002551 | Ga0070695_1000025517 | 335 |
| 168 | 3300005937 | Ga0081455_10001913 | Ga0081455_100019136 | 335 |
| 169 | 3300009093 | Ga0105240_10039733 | Ga0105240_100397334 | 335 |
| 170 | 3300009147 | Ga0114129_10033308 | Ga0114129_100333086 | 335 |
| 171 | 3300013307 | Ga0157372_10010311 | Ga0157372_100103118 | 335 |
| 172 | 3300025933 | Ga0207706_10153653 | Ga0207706_101536531 | 335 |
| 173 | 3300027360 | Ga0209969_1012202 | Ga0209969_10122022 | 335 |
| 174 | 3300027552 | Ga0209982_1003541 | Ga0209982_10035413 | 335 |
| 175 | 3300027614 | Ga0209970_1001274 | Ga0209970_10012748 | 335 |
| 176 | 3300027665 | Ga0209983_1003116 | Ga0209983_10031163 | 335 |
| 177 | 3300027682 | Ga0209971_1000137 | Ga0209971_100013723 | 335 |
| 178 | 3300027695 | Ga0209966_1000354 | Ga0209966_10003544 | 335 |
| 179 | 3300027717 | Ga0209998_10000278 | Ga0209998_1000027815 | 335 |
| 180 | 3300027876 | Ga0209974_10007141 | Ga0209974_100071414 | 335 |
| 181 | 3300042439 | Ga0439464_0003106 | Ga0439464_0003106_2240_3253 | 335 |
| 182 | 3300042461 | Ga0439460_0001555 | Ga0439460_0001555_1584_2597 | 335 |
| 183 | 3300042876 | Ga0451577_0087060 | Ga0451577_0087060_1604_2617 | 335 |
| 184 | 3300049570 | Ga0501033_0043722 | Ga0501033_0043722_2078_3091 | 335 |
| 185 | 3300049572 | Ga0501036_0152082 | Ga0501036_0152082_543_1556 | 335 |
| 186 | 3300049572 | Ga0501036_0342010 | Ga0501036_0342010_70_1092 | 335 |
| 187 | 3300049576 | Ga0501040_0001869 | Ga0501040_0001869_137_1150 | 335 |
| 188 | 3300049577 | Ga0501041_0044228 | Ga0501041_0044228_519_1532 | 335 |
| 189 | 3300049578 | Ga0501042_0001174 | Ga0501042_0001174_54_1067 | 335 |
| 190 | 3300049581 | Ga0501047_0033160 | Ga0501047_0033160_1789_2802 | 335 |
| 191 | 3300049582 | Ga0501048_0035731 | Ga0501048_0035731_2181_3194 | 335 |
| 192 | 3300049584 | Ga0501068_0015010 | Ga0501068_0015010_1032_2045 | 335 |
| 193 | 3300049587 | Ga0501071_0049024 | Ga0501071_0049024_1679_2692 | 335 |
| 194 | 3300049588 | Ga0501072_0061364 | Ga0501072_0061364_365_1378 | 335 |
| 195 | 3300049589 | Ga0501073_0124322 | Ga0501073_0124322_223_1236 | 335 |
| 196 | 3300049590 | Ga0501074_0013593 | Ga0501074_0013593_2729_3742 | 335 |
| 197 | 3300049591 | Ga0501075_0024123 | Ga0501075_0024123_589_1602 | 335 |
| 198 | 3300049591 | Ga0501075_0328099 | Ga0501075_0328099_122_1144 | 335 |
| 199 | 3300049593 | Ga0501077_0022486 | Ga0501077_0022486_420_1433 | 335 |
| 200 | 3300049741 | Ga0501079_0007316 | Ga0501079_0007316_5108_6121 | 335 |
| 201 | 3300049742 | Ga0501080_0088096 | Ga0501080_0088096_1618_2631 | 335 |
| 202 | 3300049743 | Ga0501081_0006909 | Ga0501081_0006909_2177_3190 | 335 |
| 203 | 3300049824 | Ga0501045_0000340 | Ga0501045_0000340_8425_9438 | 335 |
| 204 | 3300050508 | nmdc:mga09592_299673_c1 | nmdc:mga09592_299673_c1_304_1332 | 335 |
| 205 | 3300054114 | Ga0501084_0013589 | Ga0501084_0013589_3448_4461 | 335 |
| 206 | 3300054114 | Ga0501084_0142449 | Ga0501084_0142449_865_1878 | 335 |
| 207 | 3300060353 | Ga0501082_0002155 | Ga0501082_0002155_13553_14566 | 335 |
| 208 | 3300061734 | Ga0530510_0352543 | Ga0530510_0352543_69_1091 | 335 |
| 209 | 3300005328 | Ga0070676_10017001 | Ga0070676_100170015 | 336 |
| 210 | 3300005330 | Ga0070690_100069050 | Ga0070690_1000690502 | 336 |
| 211 | 3300005331 | Ga0070670_100084332 | Ga0070670_1000843324 | 336 |
| 212 | 3300005334 | Ga0068869_100079657 | Ga0068869_1000796574 | 336 |
| 213 | 3300005353 | Ga0070669_100021948 | Ga0070669_1000219485 | 336 |
| 214 | 3300005353 | Ga0070669_100295857 | Ga0070669_1002958571 | 336 |
| 215 | 3300005354 | Ga0070675_100001343 | Ga0070675_10000134310 | 336 |
| 216 | 3300005354 | Ga0070675_100046718 | Ga0070675_1000467183 | 336 |
| 217 | 3300005364 | Ga0070673_100014940 | Ga0070673_1000149405 | 336 |
| 218 | 3300005406 | Ga0070703_10035917 | Ga0070703_100359172 | 336 |
| 219 | 3300005440 | Ga0070705_100097542 | Ga0070705_1000975421 | 336 |
| 220 | 3300005455 | Ga0070663_100017114 | Ga0070663_1000171144 | 336 |
| 221 | 3300005456 | Ga0070678_100139996 | Ga0070678_1001399962 | 336 |
| 222 | 3300005456 | Ga0070678_100269459 | Ga0070678_1002694592 | 336 |
| 223 | 3300005459 | Ga0068867_100069344 | Ga0068867_1000693443 | 336 |
| 224 | 3300005467 | Ga0070706_100362669 | Ga0070706_1003626691 | 336 |
| 225 | 3300005468 | Ga0070707_100203415 | Ga0070707_1002034152 | 336 |
| 226 | 3300005471 | Ga0070698_100075625 | Ga0070698_1000756252 | 336 |
| 227 | 3300005543 | Ga0070672_100067652 | Ga0070672_1000676523 | 336 |
| 228 | 3300005545 | Ga0070695_100297317 | Ga0070695_1002973171 | 336 |
| 229 | 3300005548 | Ga0070665_100281882 | Ga0070665_1002818822 | 336 |
| 230 | 3300005615 | Ga0070702_100111155 | Ga0070702_1001111551 | 336 |
| 231 | 3300005617 | Ga0068859_100219928 | Ga0068859_1002199283 | 336 |
| 232 | 3300005618 | Ga0068864_100137320 | Ga0068864_1001373203 | 336 |
| 233 | 3300005718 | Ga0068866_10053459 | Ga0068866_100534592 | 336 |
| 234 | 3300005719 | Ga0068861_100042189 | Ga0068861_1000421893 | 336 |
| 235 | 3300005719 | Ga0068861_100177558 | Ga0068861_1001775582 | 336 |
| 236 | 3300005834 | Ga0068851_10021993 | Ga0068851_100219932 | 336 |
| 237 | 3300005840 | Ga0068870_10140283 | Ga0068870_101402831 | 336 |
| 238 | 3300005841 | Ga0068863_100018837 | Ga0068863_1000188378 | 336 |
| 239 | 3300006881 | Ga0068865_100006094 | Ga0068865_1000060948 | 336 |
| 240 | 3300006931 | Ga0097620_100219929 | Ga0097620_1002199292 | 336 |
| 241 | 3300009094 | Ga0111539_10001802 | Ga0111539_100018025 | 336 |
| 242 | 3300009176 | Ga0105242_10014087 | Ga0105242_100140874 | 336 |
| 243 | 3300009177 | Ga0105248_10453353 | Ga0105248_104533532 | 336 |
| 244 | 3300013308 | Ga0157375_10088409 | Ga0157375_100884093 | 336 |
| 245 | 3300013308 | Ga0157375_10622558 | Ga0157375_106225581 | 336 |
| 246 | 3300014325 | Ga0163163_10015430 | Ga0163163_100154309 | 336 |
| 247 | 3300014326 | Ga0157380_10005737 | Ga0157380_100057372 | 336 |
| 248 | 3300014326 | Ga0157380_10140582 | Ga0157380_101405823 | 336 |
| 249 | 3300014326 | Ga0157380_10367350 | Ga0157380_103673501 | 336 |
| 250 | 3300025321 | Ga0207656_10034654 | Ga0207656_100346542 | 336 |
| 251 | 3300025893 | Ga0207682_10005989 | Ga0207682_100059895 | 336 |
| 252 | 3300025907 | Ga0207645_10017069 | Ga0207645_100170695 | 336 |
| 253 | 3300025925 | Ga0207650_10245980 | Ga0207650_102459802 | 336 |
| 254 | 3300025926 | Ga0207659_10001244 | Ga0207659_100012449 | 336 |
| 255 | 3300025926 | Ga0207659_10245753 | Ga0207659_102457531 | 336 |
| 256 | 3300025934 | Ga0207686_10210800 | Ga0207686_102108002 | 336 |
| 257 | 3300025935 | Ga0207709_10067766 | Ga0207709_100677663 | 336 |
| 258 | 3300025937 | Ga0207669_10029625 | Ga0207669_100296252 | 336 |
| 259 | 3300025938 | Ga0207704_10127821 | Ga0207704_101278212 | 336 |
| 260 | 3300025940 | Ga0207691_10156554 | Ga0207691_101565542 | 336 |
| 261 | 3300025942 | Ga0207689_10021833 | Ga0207689_100218333 | 336 |
| 262 | 3300025942 | Ga0207689_10029723 | Ga0207689_100297236 | 336 |
| 263 | 3300025960 | Ga0207651_10305761 | Ga0207651_103057611 | 336 |
| 264 | 3300025981 | Ga0207640_10298906 | Ga0207640_102989062 | 336 |
| 265 | 3300025986 | Ga0207658_10049553 | Ga0207658_100495532 | 336 |
| 266 | 3300026035 | Ga0207703_10110692 | Ga0207703_101106921 | 336 |
| 267 | 3300026035 | Ga0207703_10243553 | Ga0207703_102435532 | 336 |
| 268 | 3300026067 | Ga0207678_10030208 | Ga0207678_100302085 | 336 |
| 269 | 3300026088 | Ga0207641_10146539 | Ga0207641_101465391 | 336 |
| 270 | 3300026089 | Ga0207648_10000066 | Ga0207648_100000663 | 336 |
| 271 | 3300026089 | Ga0207648_10206390 | Ga0207648_102063901 | 336 |
| 272 | 3300026095 | Ga0207676_10020431 | Ga0207676_100204312 | 336 |
| 273 | 3300026095 | Ga0207676_10392115 | Ga0207676_103921151 | 336 |
| 274 | 3300026118 | Ga0207675_100006665 | Ga0207675_1000066654 | 336 |
| 275 | 3300026118 | Ga0207675_100136095 | Ga0207675_1001360951 | 336 |
| 276 | 3300026118 | Ga0207675_100190299 | Ga0207675_1001902993 | 336 |
| 277 | 3300026121 | Ga0207683_10276287 | Ga0207683_102762872 | 336 |
| 278 | 3300026121 | Ga0207683_10379000 | Ga0207683_103790001 | 336 |
| 279 | 3300027907 | Ga0207428_10002954 | Ga0207428_100029542 | 336 |
| 280 | 3300028381 | Ga0268264_10456841 | Ga0268264_104568412 | 336 |
| 281 | 3300028794 | Ga0307515_10049339 | Ga0307515_100493394 | 336 |
| 282 | 3300031731 | Ga0307405_10024796 | Ga0307405_100247962 | 336 |
| 283 | 3300031852 | Ga0307410_10042958 | Ga0307410_100429582 | 336 |
| 284 | 3300031911 | Ga0307412_10016513 | Ga0307412_100165132 | 336 |
| 285 | 3300031995 | Ga0307409_100078399 | Ga0307409_1000783992 | 336 |
| 286 | 3300031995 | Ga0307409_100091023 | Ga0307409_1000910231 | 336 |
| 287 | 3300032002 | Ga0307416_100007740 | Ga0307416_1000077404 | 336 |
| 288 | 3300032002 | Ga0307416_100298176 | Ga0307416_1002981761 | 336 |
| 289 | 3300032005 | Ga0307411_10086825 | Ga0307411_100868251 | 336 |
| 290 | 3300032126 | Ga0307415_100054902 | Ga0307415_1000549021 | 336 |
| 291 | 3300041512 | Ga0451853_0590954 | Ga0451853_0590954_1320_2336 | 336 |
| 292 | 3300042876 | Ga0451577_0082237 | Ga0451577_0082237_65_1084 | 336 |
| 293 | 3300044712 | Ga0453684_0160502 | Ga0453684_0160502_671_1687 | 336 |
| 294 | 3300046455 | Ga0495603_0091807 | Ga0495603_0091807_134_1150 | 336 |
| 295 | 3300046460 | Ga0495638_0089174 | Ga0495638_0089174_386_1408 | 336 |
| 296 | 3300046511 | Ga0495608_0006020 | Ga0495608_0006020_3221_4243 | 336 |
| 297 | 3300046559 | Ga0495667_0062495 | Ga0495667_0062495_583_1605 | 336 |
| 298 | 3300046674 | Ga0495588_0092919 | Ga0495588_0092919_396_1412 | 336 |
| 299 | 3300048089 | Ga0495614_0098382 | Ga0495614_0098382_231_1247 | 336 |
| 300 | 3300048917 | Ga0496114_0359884 | Ga0496114_0359884_128_1177 | 336 |
| 301 | 3300049570 | Ga0501033_0230787 | Ga0501033_0230787_213_1244 | 336 |
| 302 | 3300049572 | Ga0501036_0114144 | Ga0501036_0114144_1115_2146 | 336 |
| 303 | 3300049576 | Ga0501040_0004654 | Ga0501040_0004654_316_1341 | 336 |
| 304 | 3300049577 | Ga0501041_0014660 | Ga0501041_0014660_1417_2442 | 336 |
| 305 | 3300049578 | Ga0501042_0003676 | Ga0501042_0003676_3766_4791 | 336 |
| 306 | 3300049582 | Ga0501048_0237094 | Ga0501048_0237094_21_1052 | 336 |
| 307 | 3300049587 | Ga0501071_0113915 | Ga0501071_0113915_953_1978 | 336 |
| 308 | 3300049591 | Ga0501075_0007341 | Ga0501075_0007341_4742_5767 | 336 |
| 309 | 3300049592 | Ga0501076_0022777 | Ga0501076_0022777_1486_2511 | 336 |
| 310 | 3300049743 | Ga0501081_0003490 | Ga0501081_0003490_3949_4974 | 336 |
| 311 | 3300050511 | nmdc:mga08y16_2189_c1 | nmdc:mga08y16_2189_c1_15444_16469 | 336 |
| 312 | 3300053139 | Ga0500568_0002127 | Ga0500568_0002127_9089_10111 | 336 |
| 313 | 3300059424 | Ga0590075_006024 | Ga0590075_006024_644_1660 | 336 |
| 314 | 3300059426 | Ga0590077_001701 | Ga0590077_001701_2468_3484 | 336 |
| 315 | 3300059426 | Ga0590077_002796 | Ga0590077_002796_758_1774 | 336 |
| 316 | 3300061734 | Ga0530510_0115266 | Ga0530510_0115266_495_1520 | 336 |
| 317 | 3300003203 | JGI25406J46586_10023907 | JGI25406J46586_100239072 | 337 |
| 318 | 3300003373 | JGI25407J50210_10009937 | JGI25407J50210_100099371 | 337 |
| 319 | 3300005328 | Ga0070676_10017597 | Ga0070676_100175972 | 337 |
| 320 | 3300005331 | Ga0070670_100015266 | Ga0070670_1000152666 | 337 |
| 321 | 3300005334 | Ga0068869_100001281 | Ga0068869_1000012817 | 337 |
| 322 | 3300005334 | Ga0068869_100030552 | Ga0068869_1000305524 | 337 |
| 323 | 3300005336 | Ga0070680_100011104 | Ga0070680_1000111043 | 337 |
| 324 | 3300005337 | Ga0070682_100000940 | Ga0070682_10000094017 | 337 |
| 325 | 3300005339 | Ga0070660_100006007 | Ga0070660_1000060077 | 337 |
| 326 | 3300005341 | Ga0070691_10003618 | Ga0070691_100036184 | 337 |
| 327 | 3300005343 | Ga0070687_100018714 | Ga0070687_1000187144 | 337 |
| 328 | 3300005344 | Ga0070661_100005220 | Ga0070661_1000052207 | 337 |
| 329 | 3300005345 | Ga0070692_10000406 | Ga0070692_100004068 | 337 |
| 330 | 3300005345 | Ga0070692_10006643 | Ga0070692_100066432 | 337 |
| 331 | 3300005347 | Ga0070668_100106202 | Ga0070668_1001062022 | 337 |
| 332 | 3300005353 | Ga0070669_100051495 | Ga0070669_1000514952 | 337 |
| 333 | 3300005366 | Ga0070659_100003412 | Ga0070659_1000034123 | 337 |
| 334 | 3300005406 | Ga0070703_10001999 | Ga0070703_100019997 | 337 |
| 335 | 3300005438 | Ga0070701_10008204 | Ga0070701_100082043 | 337 |
| 336 | 3300005438 | Ga0070701_10050537 | Ga0070701_100505372 | 337 |
| 337 | 3300005440 | Ga0070705_100002212 | Ga0070705_1000022124 | 337 |
| 338 | 3300005440 | Ga0070705_100026162 | Ga0070705_1000261623 | 337 |
| 339 | 3300005444 | Ga0070694_100000718 | Ga0070694_10000071812 | 337 |
| 340 | 3300005444 | Ga0070694_100082136 | Ga0070694_1000821363 | 337 |
| 341 | 3300005445 | Ga0070708_100005307 | Ga0070708_1000053072 | 337 |
| 342 | 3300005445 | Ga0070708_100023197 | Ga0070708_1000231975 | 337 |
| 343 | 3300005445 | Ga0070708_100026182 | Ga0070708_1000261825 | 337 |
| 344 | 3300005445 | Ga0070708_100065829 | Ga0070708_1000658292 | 337 |
| 345 | 3300005445 | Ga0070708_100153372 | Ga0070708_1001533723 | 337 |
| 346 | 3300005445 | Ga0070708_100177898 | Ga0070708_1001778982 | 337 |
| 347 | 3300005445 | Ga0070708_100339892 | Ga0070708_1003398922 | 337 |
| 348 | 3300005455 | Ga0070663_100012132 | Ga0070663_1000121326 | 337 |
| 349 | 3300005458 | Ga0070681_10054099 | Ga0070681_100540995 | 337 |
| 350 | 3300005459 | Ga0068867_100051560 | Ga0068867_1000515604 | 337 |
| 351 | 3300005467 | Ga0070706_100009915 | Ga0070706_1000099154 | 337 |
| 352 | 3300005467 | Ga0070706_100042363 | Ga0070706_1000423632 | 337 |
| 353 | 3300005467 | Ga0070706_100088898 | Ga0070706_1000888982 | 337 |
| 354 | 3300005467 | Ga0070706_100093088 | Ga0070706_1000930882 | 337 |
| 355 | 3300005467 | Ga0070706_100123458 | Ga0070706_1001234583 | 337 |
| 356 | 3300005468 | Ga0070707_100001535 | Ga0070707_10000153524 | 337 |
| 357 | 3300005468 | Ga0070707_100011624 | Ga0070707_1000116245 | 337 |
| 358 | 3300005468 | Ga0070707_100053084 | Ga0070707_1000530844 | 337 |
| 359 | 3300005471 | Ga0070698_100000147 | Ga0070698_10000014716 | 337 |
| 360 | 3300005471 | Ga0070698_100009771 | Ga0070698_1000097717 | 337 |
| 361 | 3300005471 | Ga0070698_100057921 | Ga0070698_1000579214 | 337 |
| 362 | 3300005471 | Ga0070698_100149447 | Ga0070698_1001494473 | 337 |
| 363 | 3300005518 | Ga0070699_100006894 | Ga0070699_1000068944 | 337 |
| 364 | 3300005518 | Ga0070699_100012706 | Ga0070699_1000127067 | 337 |
| 365 | 3300005518 | Ga0070699_100020863 | Ga0070699_1000208635 | 337 |
| 366 | 3300005518 | Ga0070699_100029408 | Ga0070699_1000294083 | 337 |
| 367 | 3300005518 | Ga0070699_100029925 | Ga0070699_1000299252 | 337 |
| 368 | 3300005518 | Ga0070699_100064343 | Ga0070699_1000643432 | 337 |
| 369 | 3300005518 | Ga0070699_100120880 | Ga0070699_1001208803 | 337 |
| 370 | 3300005518 | Ga0070699_100220015 | Ga0070699_1002200152 | 337 |
| 371 | 3300005530 | Ga0070679_100000882 | Ga0070679_1000008827 | 337 |
| 372 | 3300005536 | Ga0070697_100006030 | Ga0070697_1000060307 | 337 |
| 373 | 3300005536 | Ga0070697_100015152 | Ga0070697_1000151523 | 337 |
| 374 | 3300005536 | Ga0070697_100028482 | Ga0070697_1000284823 | 337 |
| 375 | 3300005536 | Ga0070697_100054536 | Ga0070697_1000545362 | 337 |
| 376 | 3300005536 | Ga0070697_100186272 | Ga0070697_1001862722 | 337 |
| 377 | 3300005539 | Ga0068853_100000850 | Ga0068853_1000008503 | 337 |
| 378 | 3300005543 | Ga0070672_100137539 | Ga0070672_1001375392 | 337 |
| 379 | 3300005545 | Ga0070695_100003065 | Ga0070695_1000030657 | 337 |
| 380 | 3300005545 | Ga0070695_100008967 | Ga0070695_1000089676 | 337 |
| 381 | 3300005545 | Ga0070695_100104305 | Ga0070695_1001043052 | 337 |
| 382 | 3300005546 | Ga0070696_100003134 | Ga0070696_1000031347 | 337 |
| 383 | 3300005546 | Ga0070696_100044141 | Ga0070696_1000441413 | 337 |
| 384 | 3300005547 | Ga0070693_100000018 | Ga0070693_1000000187 | 337 |
| 385 | 3300005549 | Ga0070704_100013680 | Ga0070704_1000136805 | 337 |
| 386 | 3300005549 | Ga0070704_100015371 | Ga0070704_1000153713 | 337 |
| 387 | 3300005563 | Ga0068855_100000233 | Ga0068855_10000023356 | 337 |
| 388 | 3300005564 | Ga0070664_100026984 | Ga0070664_1000269845 | 337 |
| 389 | 3300005577 | Ga0068857_100034376 | Ga0068857_1000343763 | 337 |
| 390 | 3300005577 | Ga0068857_100111420 | Ga0068857_1001114203 | 337 |
| 391 | 3300005578 | Ga0068854_100000372 | Ga0068854_1000003726 | 337 |
| 392 | 3300005614 | Ga0068856_100002918 | Ga0068856_10000291812 | 337 |
| 393 | 3300005617 | Ga0068859_100014301 | Ga0068859_1000143016 | 337 |
| 394 | 3300005618 | Ga0068864_100031079 | Ga0068864_1000310794 | 337 |
| 395 | 3300005840 | Ga0068870_10000164 | Ga0068870_1000016413 | 337 |
| 396 | 3300005842 | Ga0068858_100060334 | Ga0068858_1000603342 | 337 |
| 397 | 3300005843 | Ga0068860_100023167 | Ga0068860_1000231676 | 337 |
| 398 | 3300005843 | Ga0068860_100039573 | Ga0068860_1000395734 | 337 |
| 399 | 3300005843 | Ga0068860_100220548 | Ga0068860_1002205482 | 337 |
| 400 | 3300005844 | Ga0068862_100035170 | Ga0068862_1000351703 | 337 |
| 401 | 3300005844 | Ga0068862_100113377 | Ga0068862_1001133773 | 337 |
| 402 | 3300005844 | Ga0068862_100354657 | Ga0068862_1003546572 | 337 |
| 403 | 3300005981 | Ga0081538_10002145 | Ga0081538_100021457 | 337 |
| 404 | 3300005981 | Ga0081538_10004506 | Ga0081538_100045063 | 337 |
| 405 | 3300005981 | Ga0081538_10024983 | Ga0081538_100249833 | 337 |
| 406 | 3300005983 | Ga0081540_1006769 | Ga0081540_10067693 | 337 |
| 407 | 3300005985 | Ga0081539_10000775 | Ga0081539_1000077519 | 337 |
| 408 | 3300006237 | Ga0097621_100154795 | Ga0097621_1001547952 | 337 |
| 409 | 3300006844 | Ga0075428_100003207 | Ga0075428_1000032073 | 337 |
| 410 | 3300006844 | Ga0075428_100010839 | Ga0075428_10001083910 | 337 |
| 411 | 3300006846 | Ga0075430_100003525 | Ga0075430_10000352510 | 337 |
| 412 | 3300006846 | Ga0075430_100008074 | Ga0075430_1000080746 | 337 |
| 413 | 3300006846 | Ga0075430_100046471 | Ga0075430_1000464714 | 337 |
| 414 | 3300006846 | Ga0075430_100085038 | Ga0075430_1000850382 | 337 |
| 415 | 3300006847 | Ga0075431_100003509 | Ga0075431_1000035093 | 337 |
| 416 | 3300006847 | Ga0075431_100007612 | Ga0075431_1000076122 | 337 |
| 417 | 3300006847 | Ga0075431_100011019 | Ga0075431_1000110198 | 337 |
| 418 | 3300006847 | Ga0075431_100022099 | Ga0075431_1000220995 | 337 |
| 419 | 3300006847 | Ga0075431_100023739 | Ga0075431_1000237398 | 337 |
| 420 | 3300006852 | Ga0075433_10000305 | Ga0075433_1000030511 | 337 |
| 421 | 3300006852 | Ga0075433_10032999 | Ga0075433_100329993 | 337 |
| 422 | 3300006852 | Ga0075433_10043134 | Ga0075433_100431342 | 337 |
| 423 | 3300006852 | Ga0075433_10066518 | Ga0075433_100665182 | 337 |
| 424 | 3300006871 | Ga0075434_100000107 | Ga0075434_10000010748 | 337 |
| 425 | 3300006871 | Ga0075434_100004736 | Ga0075434_1000047366 | 337 |
| 426 | 3300006871 | Ga0075434_100032542 | Ga0075434_1000325423 | 337 |
| 427 | 3300006871 | Ga0075434_100079651 | Ga0075434_1000796512 | 337 |
| 428 | 3300006871 | Ga0075434_100174198 | Ga0075434_1001741982 | 337 |
| 429 | 3300006880 | Ga0075429_100011821 | Ga0075429_1000118212 | 337 |
| 430 | 3300006880 | Ga0075429_100017667 | Ga0075429_1000176675 | 337 |
| 431 | 3300006880 | Ga0075429_100219076 | Ga0075429_1002190762 | 337 |
| 432 | 3300006914 | Ga0075436_100079572 | Ga0075436_1000795723 | 337 |
| 433 | 3300006931 | Ga0097620_100014301 | Ga0097620_1000143016 | 337 |
| 434 | 3300007076 | Ga0075435_100002197 | Ga0075435_1000021971 | 337 |
| 435 | 3300007076 | Ga0075435_100008350 | Ga0075435_1000083503 | 337 |
| 436 | 3300007076 | Ga0075435_100058668 | Ga0075435_1000586682 | 337 |
| 437 | 3300007265 | Ga0099794_10009292 | Ga0099794_100092926 | 337 |
| 438 | 3300007265 | Ga0099794_10011374 | Ga0099794_100113744 | 337 |
| 439 | 3300007265 | Ga0099794_10033254 | Ga0099794_100332543 | 337 |
| 440 | 3300009094 | Ga0111539_10007082 | Ga0111539_100070828 | 337 |
| 441 | 3300009094 | Ga0111539_10014329 | Ga0111539_100143298 | 337 |
| 442 | 3300009094 | Ga0111539_10096225 | Ga0111539_100962252 | 337 |
| 443 | 3300009094 | Ga0111539_10500207 | Ga0111539_105002072 | 337 |
| 444 | 3300009147 | Ga0114129_10000026 | Ga0114129_1000002613 | 337 |
| 445 | 3300009147 | Ga0114129_10005676 | Ga0114129_100056762 | 337 |
| 446 | 3300009147 | Ga0114129_10006211 | Ga0114129_100062117 | 337 |
| 447 | 3300009147 | Ga0114129_10008312 | Ga0114129_100083122 | 337 |
| 448 | 3300009147 | Ga0114129_10023313 | Ga0114129_100233134 | 337 |
| 449 | 3300009147 | Ga0114129_10056999 | Ga0114129_100569994 | 337 |
| 450 | 3300009147 | Ga0114129_10057391 | Ga0114129_100573912 | 337 |
| 451 | 3300009147 | Ga0114129_10067395 | Ga0114129_100673953 | 337 |
| 452 | 3300009147 | Ga0114129_10094659 | Ga0114129_100946596 | 337 |
| 453 | 3300009147 | Ga0114129_10116736 | Ga0114129_101167363 | 337 |
| 454 | 3300009147 | Ga0114129_10129065 | Ga0114129_101290652 | 337 |
| 455 | 3300009148 | Ga0105243_10065279 | Ga0105243_100652792 | 337 |
| 456 | 3300009148 | Ga0105243_10111908 | Ga0105243_101119082 | 337 |
| 457 | 3300009174 | Ga0105241_10203100 | Ga0105241_102031002 | 337 |
| 458 | 3300011119 | Ga0105246_10056987 | Ga0105246_100569874 | 337 |
| 459 | 3300013100 | Ga0157373_10000292 | Ga0157373_1000029219 | 337 |
| 460 | 3300013105 | Ga0157369_10043156 | Ga0157369_100431566 | 337 |
| 461 | 3300013306 | Ga0163162_10159768 | Ga0163162_101597683 | 337 |
| 462 | 3300013307 | Ga0157372_10001109 | Ga0157372_100011097 | 337 |
| 463 | 3300014969 | Ga0157376_10010193 | Ga0157376_100101933 | 337 |
| 464 | 3300025885 | Ga0207653_10015948 | Ga0207653_100159483 | 337 |
| 465 | 3300025901 | Ga0207688_10046132 | Ga0207688_100461323 | 337 |
| 466 | 3300025905 | Ga0207685_10036488 | Ga0207685_100364882 | 337 |
| 467 | 3300025907 | Ga0207645_10023503 | Ga0207645_100235032 | 337 |
| 468 | 3300025908 | Ga0207643_10007829 | Ga0207643_100078293 | 337 |
| 469 | 3300025910 | Ga0207684_10000782 | Ga0207684_1000078213 | 337 |
| 470 | 3300025910 | Ga0207684_10002909 | Ga0207684_1000290911 | 337 |
| 471 | 3300025910 | Ga0207684_10004060 | Ga0207684_100040607 | 337 |
| 472 | 3300025910 | Ga0207684_10006876 | Ga0207684_100068767 | 337 |
| 473 | 3300025910 | Ga0207684_10013669 | Ga0207684_100136697 | 337 |
| 474 | 3300025910 | Ga0207684_10160921 | Ga0207684_101609212 | 337 |
| 475 | 3300025912 | Ga0207707_10010573 | Ga0207707_100105733 | 337 |
| 476 | 3300025917 | Ga0207660_10001271 | Ga0207660_1000127117 | 337 |
| 477 | 3300025917 | Ga0207660_10023868 | Ga0207660_100238682 | 337 |
| 478 | 3300025918 | Ga0207662_10036173 | Ga0207662_100361733 | 337 |
| 479 | 3300025919 | Ga0207657_10029843 | Ga0207657_100298435 | 337 |
| 480 | 3300025920 | Ga0207649_10010891 | Ga0207649_100108913 | 337 |
| 481 | 3300025921 | Ga0207652_10001130 | Ga0207652_1000113018 | 337 |
| 482 | 3300025922 | Ga0207646_10000819 | Ga0207646_1000081917 | 337 |
| 483 | 3300025922 | Ga0207646_10017570 | Ga0207646_100175703 | 337 |
| 484 | 3300025922 | Ga0207646_10048185 | Ga0207646_100481852 | 337 |
| 485 | 3300025923 | Ga0207681_10017867 | Ga0207681_100178672 | 337 |
| 486 | 3300025925 | Ga0207650_10035391 | Ga0207650_100353913 | 337 |
| 487 | 3300025932 | Ga0207690_10007207 | Ga0207690_100072073 | 337 |
| 488 | 3300025933 | Ga0207706_10002488 | Ga0207706_100024883 | 337 |
| 489 | 3300025935 | Ga0207709_10019990 | Ga0207709_100199904 | 337 |
| 490 | 3300025935 | Ga0207709_10254895 | Ga0207709_102548952 | 337 |
| 491 | 3300025940 | Ga0207691_10149292 | Ga0207691_101492922 | 337 |
| 492 | 3300025941 | Ga0207711_10110266 | Ga0207711_101102663 | 337 |
| 493 | 3300025942 | Ga0207689_10001039 | Ga0207689_100010393 | 337 |
| 494 | 3300025942 | Ga0207689_10044495 | Ga0207689_100444954 | 337 |
| 495 | 3300025945 | Ga0207679_10002961 | Ga0207679_100029617 | 337 |
| 496 | 3300025949 | Ga0207667_10003926 | Ga0207667_100039267 | 337 |
| 497 | 3300025981 | Ga0207640_10021139 | Ga0207640_100211394 | 337 |
| 498 | 3300025986 | Ga0207658_10118921 | Ga0207658_101189212 | 337 |
| 499 | 3300026035 | Ga0207703_10036762 | Ga0207703_100367622 | 337 |
| 500 | 3300026041 | Ga0207639_10011499 | Ga0207639_100114993 | 337 |
| 501 | 3300026067 | Ga0207678_10008687 | Ga0207678_100086873 | 337 |
| 502 | 3300026075 | Ga0207708_10002040 | Ga0207708_1000204015 | 337 |
| 503 | 3300026078 | Ga0207702_10007056 | Ga0207702_100070567 | 337 |
| 504 | 3300026089 | Ga0207648_10033262 | Ga0207648_100332626 | 337 |
| 505 | 3300026095 | Ga0207676_10115894 | Ga0207676_101158942 | 337 |
| 506 | 3300026116 | Ga0207674_10003899 | Ga0207674_100038993 | 337 |
| 507 | 3300026116 | Ga0207674_10129633 | Ga0207674_101296332 | 337 |
| 508 | 3300026118 | Ga0207675_100045399 | Ga0207675_1000453992 | 337 |
| 509 | 3300027671 | Ga0209588_1009249 | Ga0209588_10092493 | 337 |
| 510 | 3300027671 | Ga0209588_1017800 | Ga0209588_10178003 | 337 |
| 511 | 3300027907 | Ga0207428_10000033 | Ga0207428_100000332 | 337 |
| 512 | 3300027907 | Ga0207428_10122251 | Ga0207428_101222512 | 337 |
| 513 | 3300028380 | Ga0268265_10017061 | Ga0268265_100170616 | 337 |
| 514 | 3300028381 | Ga0268264_10025358 | Ga0268264_100253586 | 337 |
| 515 | 3300028381 | Ga0268264_10037611 | Ga0268264_100376112 | 337 |
| 516 | 3300028381 | Ga0268264_10112012 | Ga0268264_101120121 | 337 |
| 517 | 3300028381 | Ga0268264_10190561 | Ga0268264_101905611 | 337 |
| 518 | 3300028381 | Ga0268264_10538039 | Ga0268264_105380391 | 337 |
| 519 | 3300030522 | Ga0307512_10031311 | Ga0307512_100313112 | 337 |
| 520 | 3300031239 | Ga0265328_10035938 | Ga0265328_100359382 | 337 |
| 521 | 3300031456 | Ga0307513_10029541 | Ga0307513_100295416 | 337 |
| 522 | 3300031548 | Ga0307408_100010076 | Ga0307408_1000100764 | 337 |
| 523 | 3300031548 | Ga0307408_100148423 | Ga0307408_1001484232 | 337 |
| 524 | 3300031731 | Ga0307405_10189894 | Ga0307405_101898941 | 337 |
| 525 | 3300031824 | Ga0307413_10167763 | Ga0307413_101677631 | 337 |
| 526 | 3300031852 | Ga0307410_10085475 | Ga0307410_100854752 | 337 |
| 527 | 3300031901 | Ga0307406_10225755 | Ga0307406_102257551 | 337 |
| 528 | 3300031995 | Ga0307409_100098836 | Ga0307409_1000988362 | 337 |
| 529 | 3300032002 | Ga0307416_100064162 | Ga0307416_1000641624 | 337 |
| 530 | 3300032005 | Ga0307411_10085568 | Ga0307411_100855683 | 337 |
| 531 | 3300032126 | Ga0307415_100302346 | Ga0307415_1003023462 | 337 |
| 532 | 3300034819 | Ga0373958_0012670 | Ga0373958_0012670_220_1242 | 337 |
| 533 | 3300034820 | Ga0373959_0003281 | Ga0373959_0003281_775_1800 | 337 |
| 534 | 3300035090 | Ga0373949_0003845 | Ga0373949_0003845_1545_2567 | 337 |
| 535 | 3300035090 | Ga0373949_0037316 | Ga0373949_0037316_85_1104 | 337 |
| 536 | 3300035091 | Ga0373951_0003206 | Ga0373951_0003206_2201_3220 | 337 |
| 537 | 3300035691 | Ga0373931_0007813 | Ga0373931_0007813_2072_3097 | 337 |
| 538 | 3300037312 | Ga0395899_0024461 | Ga0395899_0024461_2092_3114 | 337 |
| 539 | 3300037418 | Ga0395900_0037014 | Ga0395900_0037014_3644_4666 | 337 |
| 540 | 3300037418 | Ga0395900_0124565 | Ga0395900_0124565_1076_2104 | 337 |
| 541 | 3300037466 | Ga0395898_0022130 | Ga0395898_0022130_83_1105 | 337 |
| 542 | 3300038443 | Ga0395901_0000800 | Ga0395901_0000800_15119_16141 | 337 |
| 543 | 3300042016 | Ga0439463_052271 | Ga0439463_052271_12_1031 | 337 |
| 544 | 3300042157 | Ga0439458_0000856 | Ga0439458_0000856_1837_2856 | 337 |
| 545 | 3300042435 | Ga0439434_0027643 | Ga0439434_0027643_576_1610 | 337 |
| 546 | 3300042876 | Ga0451577_0033452 | Ga0451577_0033452_1866_2885 | 337 |
| 547 | 3300042876 | Ga0451577_0243300 | Ga0451577_0243300_52_1077 | 337 |
| 548 | 3300044673 | Ga0453683_0035844 | Ga0453683_0035844_1502_2521 | 337 |
| 549 | 3300044712 | Ga0453684_0234930 | Ga0453684_0234930_335_1354 | 337 |
| 550 | 3300045051 | Ga0451576_0006452 | Ga0451576_0006452_4204_5235 | 337 |
| 551 | 3300045051 | Ga0451576_0050144 | Ga0451576_0050144_581_1615 | 337 |
| 552 | 3300045051 | Ga0451576_0079038 | Ga0451576_0079038_2142_3161 | 337 |
| 553 | 3300045051 | Ga0451576_0239194 | Ga0451576_0239194_33_1061 | 337 |
| 554 | 3300045051 | Ga0451576_0339570 | Ga0451576_0339570_193_1218 | 337 |
| 555 | 3300046472 | Ga0495580_0001704 | Ga0495580_0001704_13253_14275 | 337 |
| 556 | 3300046472 | Ga0495580_0021322 | Ga0495580_0021322_2864_3895 | 337 |
| 557 | 3300046476 | Ga0495662_0096726 | Ga0495662_0096726_303_1325 | 337 |
| 558 | 3300046516 | Ga0495628_0001735 | Ga0495628_0001735_17537_18568 | 337 |
| 559 | 3300046516 | Ga0495628_0159152 | Ga0495628_0159152_166_1188 | 337 |
| 560 | 3300046533 | Ga0495640_0102881 | Ga0495640_0102881_719_1741 | 337 |
| 561 | 3300046615 | Ga0495656_0055350 | Ga0495656_0055350_488_1513 | 337 |
| 562 | 3300046664 | Ga0495659_0037464 | Ga0495659_0037464_172_1194 | 337 |
| 563 | 3300046684 | Ga0495669_0058935 | Ga0495669_0058935_248_1273 | 337 |
| 564 | 3300047319 | Ga0495674_0160825 | Ga0495674_0160825_629_1651 | 337 |
| 565 | 3300048909 | Ga0496106_0056733 | Ga0496106_0056733_1527_2546 | 337 |
| 566 | 3300048917 | Ga0496114_0203591 | Ga0496114_0203591_141_1163 | 337 |
| 567 | 3300049570 | Ga0501033_0033751 | Ga0501033_0033751_2485_3507 | 337 |
| 568 | 3300049570 | Ga0501033_0243433 | Ga0501033_0243433_137_1171 | 337 |
| 569 | 3300049572 | Ga0501036_0030397 | Ga0501036_0030397_2721_3743 | 337 |
| 570 | 3300049572 | Ga0501036_0161392 | Ga0501036_0161392_745_1767 | 337 |
| 571 | 3300049572 | Ga0501036_0250896 | Ga0501036_0250896_348_1373 | 337 |
| 572 | 3300049574 | Ga0501038_0268471 | Ga0501038_0268471_277_1311 | 337 |
| 573 | 3300049575 | Ga0501039_0038953 | Ga0501039_0038953_229_1251 | 337 |
| 574 | 3300049575 | Ga0501039_0332974 | Ga0501039_0332974_34_1056 | 337 |
| 575 | 3300049576 | Ga0501040_0073285 | Ga0501040_0073285_732_1769 | 337 |
| 576 | 3300049578 | Ga0501042_0028657 | Ga0501042_0028657_845_1867 | 337 |
| 577 | 3300049578 | Ga0501042_0322487 | Ga0501042_0322487_45_1076 | 337 |
| 578 | 3300049580 | Ga0501046_0109902 | Ga0501046_0109902_593_1615 | 337 |
| 579 | 3300049580 | Ga0501046_0150184 | Ga0501046_0150184_275_1297 | 337 |
| 580 | 3300049583 | Ga0501067_0009421 | Ga0501067_0009421_1157_2179 | 337 |
| 581 | 3300049584 | Ga0501068_0014096 | Ga0501068_0014096_270_1292 | 337 |
| 582 | 3300049584 | Ga0501068_0052752 | Ga0501068_0052752_760_1779 | 337 |
| 583 | 3300049587 | Ga0501071_0179048 | Ga0501071_0179048_272_1297 | 337 |
| 584 | 3300049587 | Ga0501071_0224263 | Ga0501071_0224263_323_1345 | 337 |
| 585 | 3300049588 | Ga0501072_0001344 | Ga0501072_0001344_5806_6828 | 337 |
| 586 | 3300049588 | Ga0501072_0016206 | Ga0501072_0016206_4429_5454 | 337 |
| 587 | 3300049588 | Ga0501072_0038075 | Ga0501072_0038075_2463_3485 | 337 |
| 588 | 3300049588 | Ga0501072_0094873 | Ga0501072_0094873_358_1395 | 337 |
| 589 | 3300049590 | Ga0501074_0058038 | Ga0501074_0058038_1041_2063 | 337 |
| 590 | 3300049591 | Ga0501075_0004490 | Ga0501075_0004490_5253_6275 | 337 |
| 591 | 3300049591 | Ga0501075_0016313 | Ga0501075_0016313_3454_4476 | 337 |
| 592 | 3300049591 | Ga0501075_0034077 | Ga0501075_0034077_254_1279 | 337 |
| 593 | 3300049591 | Ga0501075_0123861 | Ga0501075_0123861_226_1263 | 337 |
| 594 | 3300049591 | Ga0501075_0154890 | Ga0501075_0154890_667_1689 | 337 |
| 595 | 3300049591 | Ga0501075_0298052 | Ga0501075_0298052_170_1189 | 337 |
| 596 | 3300049592 | Ga0501076_0003486 | Ga0501076_0003486_1854_2876 | 337 |
| 597 | 3300049592 | Ga0501076_0009184 | Ga0501076_0009184_3575_4600 | 337 |
| 598 | 3300049592 | Ga0501076_0088951 | Ga0501076_0088951_883_1905 | 337 |
| 599 | 3300049592 | Ga0501076_0185539 | Ga0501076_0185539_237_1271 | 337 |
| 600 | 3300049593 | Ga0501077_0010203 | Ga0501077_0010203_3915_4937 | 337 |
| 601 | 3300049741 | Ga0501079_0006450 | Ga0501079_0006450_6083_7105 | 337 |
| 602 | 3300049741 | Ga0501079_0111906 | Ga0501079_0111906_556_1578 | 337 |
| 603 | 3300049741 | Ga0501079_0181078 | Ga0501079_0181078_388_1410 | 337 |
| 604 | 3300049742 | Ga0501080_0086478 | Ga0501080_0086478_460_1479 | 337 |
| 605 | 3300049742 | Ga0501080_0136483 | Ga0501080_0136483_935_1957 | 337 |
| 606 | 3300049743 | Ga0501081_0006156 | Ga0501081_0006156_4270_5292 | 337 |
| 607 | 3300049743 | Ga0501081_0006694 | Ga0501081_0006694_5719_6741 | 337 |
| 608 | 3300049743 | Ga0501081_0097109 | Ga0501081_0097109_272_1294 | 337 |
| 609 | 3300049743 | Ga0501081_0117111 | Ga0501081_0117111_226_1248 | 337 |
| 610 | 3300049824 | Ga0501045_0035346 | Ga0501045_0035346_2144_3166 | 337 |
| 611 | 3300049824 | Ga0501045_0052866 | Ga0501045_0052866_1258_2283 | 337 |
| 612 | 3300049824 | Ga0501045_0157311 | Ga0501045_0157311_542_1579 | 337 |
| 613 | 3300050507 | nmdc:mga05p37_120524_c1 | nmdc:mga05p37_120524_c1_1036_2058 | 337 |
| 614 | 3300050507 | nmdc:mga05p37_134102_c1 | nmdc:mga05p37_134102_c1_1026_2051 | 337 |
| 615 | 3300050507 | nmdc:mga05p37_13734_c1 | nmdc:mga05p37_13734_c1_3817_4842 | 337 |
| 616 | 3300050507 | nmdc:mga05p37_30941_c1 | nmdc:mga05p37_30941_c1_750_1769 | 337 |
| 617 | 3300050507 | nmdc:mga05p37_35081_c1 | nmdc:mga05p37_35081_c1_4002_5024 | 337 |
| 618 | 3300050507 | nmdc:mga05p37_3828_c1 | nmdc:mga05p37_3828_c1_12150_13175 | 337 |
| 619 | 3300050507 | nmdc:mga05p37_39684_c1 | nmdc:mga05p37_39684_c1_665_1687 | 337 |
| 620 | 3300050507 | nmdc:mga05p37_486453_c1 | nmdc:mga05p37_486453_c1_170_1204 | 337 |
| 621 | 3300050507 | nmdc:mga05p37_546910_c1 | nmdc:mga05p37_546910_c1_49_1083 | 337 |
| 622 | 3300050507 | nmdc:mga05p37_9544_c1 | nmdc:mga05p37_9544_c1_7325_8347 | 337 |
| 623 | 3300050508 | nmdc:mga09592_1842_c1 | nmdc:mga09592_1842_c1_15251_16270 | 337 |
| 624 | 3300050508 | nmdc:mga09592_27860_c1 | nmdc:mga09592_27860_c1_561_1583 | 337 |
| 625 | 3300050508 | nmdc:mga09592_90362_c1 | nmdc:mga09592_90362_c1_1100_2134 | 337 |
| 626 | 3300050509 | nmdc:mga0qj67_2581_c1 | nmdc:mga0qj67_2581_c1_7048_8070 | 337 |
| 627 | 3300050509 | nmdc:mga0qj67_66067_c1 | nmdc:mga0qj67_66067_c1_1168_2193 | 337 |
| 628 | 3300050509 | nmdc:mga0qj67_9351_c1 | nmdc:mga0qj67_9351_c1_4113_5138 | 337 |
| 629 | 3300050510 | nmdc:mga06r32_118866_c1 | nmdc:mga06r32_118866_c1_1475_2494 | 337 |
| 630 | 3300050510 | nmdc:mga06r32_164351_c1 | nmdc:mga06r32_164351_c1_714_1736 | 337 |
| 631 | 3300050510 | nmdc:mga06r32_16710_c1 | nmdc:mga06r32_16710_c1_3374_4399 | 337 |
| 632 | 3300050510 | nmdc:mga06r32_21876_c1 | nmdc:mga06r32_21876_c1_3699_4721 | 337 |
| 633 | 3300050510 | nmdc:mga06r32_27719_c1 | nmdc:mga06r32_27719_c1_2143_3165 | 337 |
| 634 | 3300050510 | nmdc:mga06r32_8196_c1 | nmdc:mga06r32_8196_c1_5879_6901 | 337 |
| 635 | 3300050510 | nmdc:mga06r32_99737_c1 | nmdc:mga06r32_99737_c1_548_1573 | 337 |
| 636 | 3300050511 | nmdc:mga08y16_43295_c1 | nmdc:mga08y16_43295_c1_2026_3045 | 337 |
| 637 | 3300050511 | nmdc:mga08y16_5112_c1 | nmdc:mga08y16_5112_c1_11809_12831 | 337 |
| 638 | 3300050511 | nmdc:mga08y16_60756_c1 | nmdc:mga08y16_60756_c1_2320_3345 | 337 |
| 639 | 3300050512 | nmdc:mga0n895_108653_c1 | nmdc:mga0n895_108653_c1_617_1639 | 337 |
| 640 | 3300050512 | nmdc:mga0n895_3140_c1 | nmdc:mga0n895_3140_c1_3215_4234 | 337 |
| 641 | 3300050512 | nmdc:mga0n895_74813_c1 | nmdc:mga0n895_74813_c1_818_1849 | 337 |
| 642 | 3300050513 | nmdc:mga0rr50_110799_c1 | nmdc:mga0rr50_110799_c1_344_1366 | 337 |
| 643 | 3300050513 | nmdc:mga0rr50_158228_c1 | nmdc:mga0rr50_158228_c1_264_1283 | 337 |
| 644 | 3300050513 | nmdc:mga0rr50_28588_c1 | nmdc:mga0rr50_28588_c1_156_1181 | 337 |
| 645 | 3300050513 | nmdc:mga0rr50_6438_c1 | nmdc:mga0rr50_6438_c1_2353_3384 | 337 |
| 646 | 3300050513 | nmdc:mga0rr50_79833_c1 | nmdc:mga0rr50_79833_c1_1413_2432 | 337 |
| 647 | 3300050514 | nmdc:mga08x19_17940_c1 | nmdc:mga08x19_17940_c1_1646_2677 | 337 |
| 648 | 3300050514 | nmdc:mga08x19_67016_c1 | nmdc:mga08x19_67016_c1_520_1551 | 337 |
| 649 | 3300050515 | nmdc:mga0a205_261593_c1 | nmdc:mga0a205_261593_c1_475_1497 | 337 |
| 650 | 3300050515 | nmdc:mga0a205_28188_c2 | nmdc:mga0a205_28188_c2_235_1257 | 337 |
| 651 | 3300050515 | nmdc:mga0a205_32_c1 | nmdc:mga0a205_32_c1_45506_46525 | 337 |
| 652 | 3300050515 | nmdc:mga0a205_64122_c1 | nmdc:mga0a205_64122_c1_800_1831 | 337 |
| 653 | 3300053077 | Ga0495601_0066542 | Ga0495601_0066542_967_1989 | 337 |
| 654 | 3300053084 | Ga0495595_0031552 | Ga0495595_0031552_90_1112 | 337 |
| 655 | 3300053085 | Ga0495619_0055479 | Ga0495619_0055479_1568_2590 | 337 |
| 656 | 3300054114 | Ga0501084_0006596 | Ga0501084_0006596_6037_7059 | 337 |
| 657 | 3300054114 | Ga0501084_0018144 | Ga0501084_0018144_744_1766 | 337 |
| 658 | 3300054114 | Ga0501084_0107065 | Ga0501084_0107065_1180_2202 | 337 |
| 659 | 3300054114 | Ga0501084_0116990 | Ga0501084_0116990_232_1257 | 337 |
| 660 | 3300054114 | Ga0501084_0174837 | Ga0501084_0174837_624_1649 | 337 |
| 661 | 3300054114 | Ga0501084_0228081 | Ga0501084_0228081_341_1363 | 337 |
| 662 | 3300060353 | Ga0501082_0066055 | Ga0501082_0066055_25_1047 | 337 |
| 663 | 3300060353 | Ga0501082_0115887 | Ga0501082_0115887_682_1704 | 337 |
| 664 | 3300060353 | Ga0501082_0152616 | Ga0501082_0152616_865_1902 | 337 |
| 665 | 3300060353 | Ga0501082_0275053 | Ga0501082_0275053_39_1064 | 337 |
| 666 | 3300061734 | Ga0530510_0013034 | Ga0530510_0013034_102_1124 | 337 |
| 667 | 3300061734 | Ga0530510_0038469 | Ga0530510_0038469_733_1755 | 337 |
| 668 | 3300061734 | Ga0530510_0176812 | Ga0530510_0176812_31_1056 | 337 |
| 669 | 3300061734 | Ga0530510_0200404 | Ga0530510_0200404_382_1404 | 337 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tv8-assembly1.cif.gz_A | structure of moaa in complex with s-adenosylmethionine | 0.9278 | 1 | 304 |
| 2fb2-assembly1.cif.gz_B | structure of the moaa arg17/266/268/ala triple mutant | 0.9151 | 1 | 310 |
| 2fb2-assembly1.cif.gz_B | structure of the moaa arg17/266/268/ala triple mutant | 0.8693 | 1 | 310 |
| 1tv8-assembly1.cif.gz_A | structure of moaa in complex with s-adenosylmethionine | 0.862 | 1 | 304 |
| 7tom-assembly1.cif.gz_A | x-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (gdgt-mas) from methanocaldococcus jannaschii with bacterial lipid substrate analog, 5'deoxyadenosine, and methionine bound | 0.8476 | 6 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJS3_16_359_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9841 | 1 | 337 | 3.20.20.70 |
| af_P9WJS3_16_359_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9812 | 1 | 337 | 3.20.20.70 |
| 1tv8A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9278 | 1 | 304 | 3.20.20.70 |
| af_I1KTQ5_72_400_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9213 | 2 | 318 | 3.20.20.70 |
| af_P9WJS1_27_360_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9148 | 2 | 322 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7TLS8-F1-model_v4 | Cyclic pyranopterin phosphate synthase MoaA | 0.9906 | 1 | 108 |
GO:0006777
GO:0046872 GO:0051539 GO:0061798 GO:0061799 |
| AF-W4L4M7-F1-model_v4 | Radical SAM core domain-containing protein | 0.9884 | 1 | 220 |
GO:0006777
GO:0046872 GO:0051539 GO:0061798 GO:0061799 |
| AF-A0A7W1JS71-F1-model_v4 | Radical SAM protein | 0.9759 | 1 | 188 |
GO:0006777
GO:0046872 GO:0051539 GO:0061798 GO:0061799 |
| AF-A0A2V5MKD8-F1-model_v4 | GTP 3',8-cyclase MoaA | 0.9758 | 1 | 184 |
GO:0006777
GO:0046872 GO:0051536 GO:0061798 GO:0061799 |
| AF-A0A7S4F4U7-F1-model_v4 | Radical SAM core domain-containing protein | 0.9758 | 3 | 157 |
GO:0006777
GO:0046872 GO:0051536 GO:0061798 GO:0061799 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar