F474032
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 669 | 231 | 669 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300046525|Ga0495663_0000285|Ga0495663_0000285_9903_10862 |
| Length | 307 |
| Sequence | MTSPNLSTNGNTSVIEIDKLTKDYDVGFWRKRKVRALDGLSLSVQQGEIFGFLGANGAGKTTTLKLLMRLIFPTDGSARILGHDIMDVSMHNRIGYLPENPYFYDYLTAREFLNFCGQIFGLSNATRDSRSRALLRRVGLDESKWNTQLRKFALVNDPEIVFLDEPMSGLDPIGRREVRDLIAGLREEGKTVFMCSHILSDIEVLCDRVAILKGGRLAQVGYLDELRQQVSGKNLVEVMVSGVDETTLAKHLPGETGFQITSTPAGLRIEVSDEKDVDRVLTALRQTTGKLVSVQPLRQSLEELFLN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 187 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 190 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 191 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 192 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 193 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 194 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 212 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 213 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 215 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 216 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 219 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 222 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 223 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 0.75 |
| Rhizosphere | 98.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1000585 | 3300000532 | Bacteria | 3528 |
| 2 | JGI24748J21848_1000008 | 3300002074 | Bacteria | 191483 |
| 3 | JGI24034J26672_10000002 | 3300002239 | Bacteria | 925353 |
| 4 | JGI24751J29686_10000008 | 3300002459 | Bacteria | 128004 |
| 5 | JGI24751J29686_10000029 | 3300002459 | Bacteria | 93445 |
| 6 | JGI25406J46586_10016165 | 3300003203 | Bacteria | 3119 |
| 7 | Ga0065714_10002184 | 3300005288 | Bacteria | 284511 |
| 8 | Ga0065704_10019236 | 3300005289 | Bacteria | 2224 |
| 9 | Ga0065712_10000112 | 3300005290 | Bacteria | 340011 |
| 10 | Ga0065712_10008051 | 3300005290 | Bacteria | 5170 |
| 11 | Ga0065712_10068391 | 3300005290 | Bacteria | 10973 |
| 12 | Ga0065715_10001931 | 3300005293 | Bacteria | 5387 |
| 13 | Ga0065715_10004857 | 3300005293 | Bacteria | 5107 |
| 14 | Ga0065715_10089752 | 3300005293 | Bacteria | 8609 |
| 15 | Ga0065715_10089793 | 3300005293 | Bacteria | 8470 |
| 16 | Ga0065715_10093681 | 3300005293 | Bacteria | 4599 |
| 17 | Ga0065715_10093762 | 3300005293 | Bacteria | 4568 |
| 18 | Ga0065715_10113745 | 3300005293 | Unclassified | 2476 |
| 19 | Ga0065715_10180225 | 3300005293 | Unclassified | 1471 |
| 20 | Ga0065715_10185231 | 3300005293 | Bacteria | 1435 |
| 21 | Ga0065715_10315577 | 3300005293 | Bacteria | 1012 |
| 22 | Ga0070683_100199655 | 3300005329 | Unclassified | 1899 |
| 23 | Ga0070690_100006141 | 3300005330 | Bacteria | 6801 |
| 24 | Ga0070690_100033794 | 3300005330 | Bacteria | 3203 |
| 25 | Ga0070690_100037139 | 3300005330 | Bacteria | 3068 |
| 26 | Ga0070690_100244678 | 3300005330 | Bacteria | 1266 |
| 27 | Ga0070670_100000136 | 3300005331 | Bacteria | 68887 |
| 28 | Ga0070670_100000441 | 3300005331 | Bacteria | 33901 |
| 29 | Ga0070670_100390381 | 3300005331 | Bacteria | 1227 |
| 30 | Ga0070670_100575419 | 3300005331 | Bacteria | 1006 |
| 31 | Ga0070677_10059292 | 3300005333 | Bacteria | 1574 |
| 32 | Ga0068869_100013796 | 3300005334 | Bacteria | 5384 |
| 33 | Ga0068869_100015469 | 3300005334 | Bacteria | 5119 |
| 34 | Ga0068869_100020343 | 3300005334 | Bacteria | 4550 |
| 35 | Ga0068869_100029552 | 3300005334 | Bacteria | 3841 |
| 36 | Ga0068869_100115062 | 3300005334 | Bacteria | 2051 |
| 37 | Ga0068869_100270294 | 3300005334 | Bacteria | 1364 |
| 38 | Ga0070666_10016258 | 3300005335 | Bacteria | 4758 |
| 39 | Ga0070680_100002480 | 3300005336 | Bacteria | 13672 |
| 40 | Ga0070680_100017225 | 3300005336 | Bacteria | 5694 |
| 41 | Ga0070680_100020003 | 3300005336 | Bacteria | 5307 |
| 42 | Ga0070680_100089143 | 3300005336 | Bacteria | 2552 |
| 43 | Ga0070680_100126791 | 3300005336 | Unclassified | 2133 |
| 44 | Ga0070682_100000524 | 3300005337 | Bacteria | 23980 |
| 45 | Ga0070682_100056989 | 3300005337 | Bacteria | 2460 |
| 46 | Ga0068868_100032331 | 3300005338 | Bacteria | 4024 |
| 47 | Ga0068868_100035851 | 3300005338 | Bacteria | 3836 |
| 48 | Ga0070689_100001207 | 3300005340 | Bacteria | 16357 |
| 49 | Ga0070689_100014111 | 3300005340 | Bacteria | 5796 |
| 50 | Ga0070689_100046434 | 3300005340 | Bacteria | 3347 |
| 51 | Ga0070689_100078063 | 3300005340 | Unclassified | 2596 |
| 52 | Ga0070687_100008800 | 3300005343 | Bacteria | 4290 |
| 53 | Ga0070687_100063555 | 3300005343 | Bacteria | 1958 |
| 54 | Ga0070687_100121365 | 3300005343 | Bacteria | 1495 |
| 55 | Ga0070687_100128618 | 3300005343 | Bacteria | 1459 |
| 56 | Ga0070661_100030511 | 3300005344 | Unclassified | 3895 |
| 57 | Ga0070661_100267260 | 3300005344 | Bacteria | 1323 |
| 58 | Ga0070692_10092666 | 3300005345 | Bacteria | 1644 |
| 59 | Ga0070692_10114106 | 3300005345 | Unclassified | 1498 |
| 60 | Ga0070692_10221910 | 3300005345 | Bacteria | 1118 |
| 61 | Ga0070692_10246732 | 3300005345 | Bacteria | 1067 |
| 62 | Ga0070669_100018464 | 3300005353 | Bacteria | 4983 |
| 63 | Ga0070669_100022032 | 3300005353 | Bacteria | 4557 |
| 64 | Ga0070669_100066425 | 3300005353 | Bacteria | 2658 |
| 65 | Ga0070675_100037759 | 3300005354 | Bacteria | 3936 |
| 66 | Ga0070675_100205132 | 3300005354 | Bacteria | 1712 |
| 67 | Ga0070671_100004945 | 3300005355 | Bacteria | 10604 |
| 68 | Ga0070671_100012372 | 3300005355 | Bacteria | 6873 |
| 69 | Ga0070671_100031819 | 3300005355 | Bacteria | 4361 |
| 70 | Ga0070671_100178039 | 3300005355 | Unclassified | 1800 |
| 71 | Ga0070674_100112801 | 3300005356 | Bacteria | 1999 |
| 72 | Ga0070673_100052782 | 3300005364 | Bacteria | 3191 |
| 73 | Ga0070673_100083508 | 3300005364 | Bacteria | 2595 |
| 74 | Ga0070673_100102947 | 3300005364 | Unclassified | 2355 |
| 75 | Ga0070688_100002981 | 3300005365 | Bacteria | 8629 |
| 76 | Ga0070659_100003483 | 3300005366 | Bacteria | 11202 |
| 77 | Ga0070667_100015290 | 3300005367 | Bacteria | 6343 |
| 78 | Ga0070703_10000059 | 3300005406 | Bacteria | 54442 |
| 79 | Ga0070703_10040190 | 3300005406 | Bacteria | 1453 |
| 80 | Ga0070701_10016248 | 3300005438 | Bacteria | 3456 |
| 81 | Ga0070701_10075930 | 3300005438 | Bacteria | 1808 |
| 82 | Ga0070711_100389994 | 3300005439 | Bacteria | 1128 |
| 83 | Ga0070705_100015078 | 3300005440 | Bacteria | 3988 |
| 84 | Ga0070705_100207484 | 3300005440 | Bacteria | 1348 |
| 85 | Ga0070705_100277560 | 3300005440 | Unclassified | 1190 |
| 86 | Ga0070700_100005818 | 3300005441 | Bacteria | 6546 |
| 87 | Ga0070700_100011361 | 3300005441 | Bacteria | 4931 |
| 88 | Ga0070700_100016838 | 3300005441 | Bacteria | 4169 |
| 89 | Ga0070700_100029174 | 3300005441 | Bacteria | 3288 |
| 90 | Ga0070700_100094023 | 3300005441 | Bacteria | 1962 |
| 91 | Ga0070700_100221376 | 3300005441 | Bacteria | 1341 |
| 92 | Ga0070700_100230486 | 3300005441 | Unclassified | 1318 |
| 93 | Ga0070694_100023245 | 3300005444 | Bacteria | 3984 |
| 94 | Ga0070694_100101908 | 3300005444 | Unclassified | 2032 |
| 95 | Ga0070694_100122832 | 3300005444 | Bacteria | 1865 |
| 96 | Ga0070694_100135931 | 3300005444 | Unclassified | 1781 |
| 97 | Ga0070694_100337627 | 3300005444 | Bacteria | 1164 |
| 98 | Ga0070708_100000455 | 3300005445 | Bacteria | 30656 |
| 99 | Ga0070708_100036694 | 3300005445 | Bacteria | 4275 |
| 100 | Ga0070708_100091327 | 3300005445 | Bacteria | 2773 |
| 101 | Ga0070662_100029005 | 3300005457 | Bacteria | 3858 |
| 102 | Ga0070662_100127195 | 3300005457 | Bacteria | 1960 |
| 103 | Ga0070681_10000410 | 3300005458 | Bacteria | 34833 |
| 104 | Ga0070681_10000956 | 3300005458 | Bacteria | 24322 |
| 105 | Ga0070681_10040975 | 3300005458 | Bacteria | 4640 |
| 106 | Ga0070681_10092442 | 3300005458 | Bacteria | 2974 |
| 107 | Ga0070681_10121305 | 3300005458 | Unclassified | 2549 |
| 108 | Ga0068867_100032828 | 3300005459 | Bacteria | 3756 |
| 109 | Ga0068867_100081841 | 3300005459 | Bacteria | 2435 |
| 110 | Ga0068867_100154345 | 3300005459 | Bacteria | 1806 |
| 111 | Ga0068867_100205392 | 3300005459 | Bacteria | 1579 |
| 112 | Ga0070685_10021815 | 3300005466 | Bacteria | 3484 |
| 113 | Ga0070706_100000358 | 3300005467 | Bacteria | 55073 |
| 114 | Ga0070706_100030144 | 3300005467 | Bacteria | 4997 |
| 115 | Ga0070706_100053561 | 3300005467 | Bacteria | 3724 |
| 116 | Ga0070706_100113050 | 3300005467 | Bacteria | 2528 |
| 117 | Ga0070706_100443147 | 3300005467 | Bacteria | 1209 |
| 118 | Ga0070707_100037232 | 3300005468 | Bacteria | 4643 |
| 119 | Ga0070707_100055949 | 3300005468 | Bacteria | 3782 |
| 120 | Ga0070707_100089645 | 3300005468 | Bacteria | 2976 |
| 121 | Ga0070698_100000720 | 3300005471 | Bacteria | 35533 |
| 122 | Ga0070698_100005931 | 3300005471 | Bacteria | 13326 |
| 123 | Ga0070698_100011587 | 3300005471 | Bacteria | 9358 |
| 124 | Ga0070698_100016323 | 3300005471 | Bacteria | 7840 |
| 125 | Ga0070698_100056932 | 3300005471 | Bacteria | 3957 |
| 126 | Ga0070698_100101515 | 3300005471 | Unclassified | 2848 |
| 127 | Ga0070698_100287023 | 3300005471 | Bacteria | 1577 |
| 128 | Ga0070699_100000488 | 3300005518 | Bacteria | 37711 |
| 129 | Ga0070699_100002881 | 3300005518 | Bacteria | 15333 |
| 130 | Ga0070699_100012643 | 3300005518 | Bacteria | 7281 |
| 131 | Ga0070699_100023012 | 3300005518 | Bacteria | 5369 |
| 132 | Ga0070679_100002026 | 3300005530 | Bacteria | 18180 |
| 133 | Ga0070679_100048827 | 3300005530 | Bacteria | 4216 |
| 134 | Ga0070684_100176076 | 3300005535 | Bacteria | 1944 |
| 135 | Ga0070697_100000109 | 3300005536 | Bacteria | 63972 |
| 136 | Ga0070697_100001352 | 3300005536 | Bacteria | 18559 |
| 137 | Ga0070697_100070341 | 3300005536 | Bacteria | 2868 |
| 138 | Ga0070697_100096038 | 3300005536 | Bacteria | 2459 |
| 139 | Ga0070697_100182072 | 3300005536 | Unclassified | 1781 |
| 140 | Ga0070697_100203505 | 3300005536 | Archaea | 1683 |
| 141 | Ga0070697_100361956 | 3300005536 | Bacteria | 1254 |
| 142 | Ga0070697_100459993 | 3300005536 | Bacteria | 1109 |
| 143 | Ga0068853_100002384 | 3300005539 | Bacteria | 14043 |
| 144 | Ga0068853_100009668 | 3300005539 | Bacteria | 7772 |
| 145 | Ga0068853_100010391 | 3300005539 | Bacteria | 7531 |
| 146 | Ga0068853_100019109 | 3300005539 | Bacteria | 5677 |
| 147 | Ga0068853_100252337 | 3300005539 | Bacteria | 1619 |
| 148 | Ga0070686_100002441 | 3300005544 | Bacteria | 10246 |
| 149 | Ga0070686_100024137 | 3300005544 | Unclassified | 3642 |
| 150 | Ga0070686_100029278 | 3300005544 | Bacteria | 3348 |
| 151 | Ga0070695_100023861 | 3300005545 | Bacteria | 3765 |
| 152 | Ga0070695_100063763 | 3300005545 | Bacteria | 2396 |
| 153 | Ga0070695_100196935 | 3300005545 | Bacteria | 1437 |
| 154 | Ga0070695_100277027 | 3300005545 | Bacteria | 1231 |
| 155 | Ga0070696_100036894 | 3300005546 | Bacteria | 3372 |
| 156 | Ga0070696_100040888 | 3300005546 | Bacteria | 3202 |
| 157 | Ga0070696_100059260 | 3300005546 | Bacteria | 2675 |
| 158 | Ga0070696_100065546 | 3300005546 | Bacteria | 2546 |
| 159 | Ga0070696_100110607 | 3300005546 | Unclassified | 1978 |
| 160 | Ga0070696_100248563 | 3300005546 | Bacteria | 1344 |
| 161 | Ga0070693_100004270 | 3300005547 | Bacteria | 6743 |
| 162 | Ga0070693_100009683 | 3300005547 | Bacteria | 4798 |
| 163 | Ga0070693_100019333 | 3300005547 | Bacteria | 3568 |
| 164 | Ga0070693_100028367 | 3300005547 | Bacteria | 3043 |
| 165 | Ga0070693_100075068 | 3300005547 | Bacteria | 2001 |
| 166 | Ga0070665_100093974 | 3300005548 | Bacteria | 3004 |
| 167 | Ga0070704_100052511 | 3300005549 | Bacteria | 2876 |
| 168 | Ga0070704_100081117 | 3300005549 | Bacteria | 2388 |
| 169 | Ga0070704_100092917 | 3300005549 | Bacteria | 2253 |
| 170 | Ga0070704_100094658 | 3300005549 | Bacteria | 2235 |
| 171 | Ga0070704_100134084 | 3300005549 | Unclassified | 1924 |
| 172 | Ga0070704_100140583 | 3300005549 | Bacteria | 1884 |
| 173 | Ga0070704_100141764 | 3300005549 | Bacteria | 1878 |
| 174 | Ga0070704_100220831 | 3300005549 | Bacteria | 1541 |
| 175 | Ga0070704_100386983 | 3300005549 | Bacteria | 1190 |
| 176 | Ga0070704_100441549 | 3300005549 | Unclassified | 1118 |
| 177 | Ga0068855_100047483 | 3300005563 | Bacteria | 5072 |
| 178 | Ga0070664_100002140 | 3300005564 | Bacteria | 15821 |
| 179 | Ga0070664_100014093 | 3300005564 | Bacteria | 6520 |
| 180 | Ga0070664_100023076 | 3300005564 | Bacteria | 5135 |
| 181 | Ga0070664_100158886 | 3300005564 | Bacteria | 1999 |
| 182 | Ga0068857_100000660 | 3300005577 | Bacteria | 25499 |
| 183 | Ga0068857_100070475 | 3300005577 | Bacteria | 3114 |
| 184 | Ga0068857_100143019 | 3300005577 | Bacteria | 2163 |
| 185 | Ga0068857_100304425 | 3300005577 | Bacteria | 1470 |
| 186 | Ga0068854_100132244 | 3300005578 | Bacteria | 1906 |
| 187 | Ga0068854_100309077 | 3300005578 | Bacteria | 1281 |
| 188 | Ga0070702_100032831 | 3300005615 | Bacteria | 2851 |
| 189 | Ga0070702_100079975 | 3300005615 | Bacteria | 1955 |
| 190 | Ga0070702_100107582 | 3300005615 | Bacteria | 1722 |
| 191 | Ga0068852_100121870 | 3300005616 | Bacteria | 2389 |
| 192 | Ga0068852_100414802 | 3300005616 | Bacteria | 1327 |
| 193 | Ga0068859_100006153 | 3300005617 | Bacteria | 12203 |
| 194 | Ga0068859_100019388 | 3300005617 | Bacteria | 6833 |
| 195 | Ga0068859_100020821 | 3300005617 | Bacteria | 6582 |
| 196 | Ga0068859_100039240 | 3300005617 | Unclassified | 4750 |
| 197 | Ga0068859_100067200 | 3300005617 | Bacteria | 3619 |
| 198 | Ga0068859_100076653 | 3300005617 | Bacteria | 3384 |
| 199 | Ga0068859_100086168 | 3300005617 | Bacteria | 3187 |
| 200 | Ga0068859_100098202 | 3300005617 | Unclassified | 2982 |
| 201 | Ga0068859_100165631 | 3300005617 | Bacteria | 2290 |
| 202 | Ga0068859_100223522 | 3300005617 | Bacteria | 1971 |
| 203 | Ga0068859_100302110 | 3300005617 | Unclassified | 1694 |
| 204 | Ga0068859_100435480 | 3300005617 | Bacteria | 1407 |
| 205 | Ga0068859_100621561 | 3300005617 | Bacteria | 1173 |
| 206 | Ga0068864_100000679 | 3300005618 | Bacteria | 28500 |
| 207 | Ga0068864_100004285 | 3300005618 | Bacteria | 11727 |
| 208 | Ga0068864_100051816 | 3300005618 | Bacteria | 3536 |
| 209 | Ga0068864_100077115 | 3300005618 | Bacteria | 2914 |
| 210 | Ga0068864_100165773 | 3300005618 | Bacteria | 2011 |
| 211 | Ga0068864_100190381 | 3300005618 | Bacteria | 1880 |
| 212 | Ga0068864_100339290 | 3300005618 | Bacteria | 1416 |
| 213 | Ga0068864_100400909 | 3300005618 | Bacteria | 1303 |
| 214 | Ga0068864_100410073 | 3300005618 | Bacteria | 1289 |
| 215 | Ga0068866_10011197 | 3300005718 | Bacteria | 3872 |
| 216 | Ga0068866_10045751 | 3300005718 | Bacteria | 2197 |
| 217 | Ga0068866_10101492 | 3300005718 | Bacteria | 1588 |
| 218 | Ga0068861_100018116 | 3300005719 | Bacteria | 5009 |
| 219 | Ga0068861_100037071 | 3300005719 | Bacteria | 3624 |
| 220 | Ga0068861_100062314 | 3300005719 | Unclassified | 2864 |
| 221 | Ga0068861_100299333 | 3300005719 | Bacteria | 1393 |
| 222 | Ga0068851_10001687 | 3300005834 | Bacteria | 9663 |
| 223 | Ga0068851_10191516 | 3300005834 | Bacteria | 1137 |
| 224 | Ga0068863_100014751 | 3300005841 | Bacteria | 7516 |
| 225 | Ga0068863_100052139 | 3300005841 | Unclassified | 3878 |
| 226 | Ga0068863_100140903 | 3300005841 | Bacteria | 2304 |
| 227 | Ga0068863_100193495 | 3300005841 | Bacteria | 1955 |
| 228 | Ga0068863_100282824 | 3300005841 | Bacteria | 1607 |
| 229 | Ga0068863_100355474 | 3300005841 | Bacteria | 1427 |
| 230 | Ga0068858_100000055 | 3300005842 | Bacteria | 118619 |
| 231 | Ga0068858_100036159 | 3300005842 | Bacteria | 4579 |
| 232 | Ga0068858_100075620 | 3300005842 | Bacteria | 3128 |
| 233 | Ga0068858_100078020 | 3300005842 | Bacteria | 3077 |
| 234 | Ga0068858_100554874 | 3300005842 | Bacteria | 1112 |
| 235 | Ga0068858_100583093 | 3300005842 | Bacteria | 1084 |
| 236 | Ga0068860_100057419 | 3300005843 | Bacteria | 3700 |
| 237 | Ga0068860_100063230 | 3300005843 | Bacteria | 3516 |
| 238 | Ga0068860_100100867 | 3300005843 | Bacteria | 2754 |
| 239 | Ga0068860_100111768 | 3300005843 | Bacteria | 2612 |
| 240 | Ga0068862_100022869 | 3300005844 | Bacteria | 5233 |
| 241 | Ga0068862_100024435 | 3300005844 | Bacteria | 5071 |
| 242 | Ga0068862_100058963 | 3300005844 | Unclassified | 3294 |
| 243 | Ga0081540_1039264 | 3300005983 | Unclassified | 2482 |
| 244 | Ga0081539_10000697 | 3300005985 | Bacteria | 67380 |
| 245 | Ga0081539_10092694 | 3300005985 | Bacteria | 1557 |
| 246 | Ga0070715_10000060 | 3300006163 | Bacteria | 39036 |
| 247 | Ga0070716_100000002 | 3300006173 | Bacteria | 396037 |
| 248 | Ga0097621_100001606 | 3300006237 | Bacteria | 15484 |
| 249 | Ga0097621_100004434 | 3300006237 | Bacteria | 9770 |
| 250 | Ga0068871_100006452 | 3300006358 | Bacteria | 8303 |
| 251 | Ga0068871_100026456 | 3300006358 | Bacteria | 4526 |
| 252 | Ga0075428_100047810 | 3300006844 | Unclassified | 4697 |
| 253 | Ga0075428_100167962 | 3300006844 | Bacteria | 2379 |
| 254 | Ga0075430_100045196 | 3300006846 | Bacteria | 3721 |
| 255 | Ga0075431_100032160 | 3300006847 | Bacteria | 5407 |
| 256 | Ga0075431_100074007 | 3300006847 | Bacteria | 3515 |
| 257 | Ga0075433_10009221 | 3300006852 | Bacteria | 7887 |
| 258 | Ga0075433_10012104 | 3300006852 | Bacteria | 6958 |
| 259 | Ga0075433_10021661 | 3300006852 | Bacteria | 5391 |
| 260 | Ga0075433_10059528 | 3300006852 | Bacteria | 3341 |
| 261 | Ga0075433_10175036 | 3300006852 | Unclassified | 1910 |
| 262 | Ga0075434_100009348 | 3300006871 | Bacteria | 9138 |
| 263 | Ga0075434_100129327 | 3300006871 | Unclassified | 2543 |
| 264 | Ga0075434_100252334 | 3300006871 | Bacteria | 1783 |
| 265 | Ga0075429_100032578 | 3300006880 | Bacteria | 4530 |
| 266 | Ga0075429_100059092 | 3300006880 | Unclassified | 3340 |
| 267 | Ga0075429_100226734 | 3300006880 | Bacteria | 1637 |
| 268 | Ga0068865_100014218 | 3300006881 | Bacteria | 5052 |
| 269 | Ga0097620_100006152 | 3300006931 | Bacteria | 12203 |
| 270 | Ga0097620_100019388 | 3300006931 | Bacteria | 6833 |
| 271 | Ga0097620_100020822 | 3300006931 | Bacteria | 6582 |
| 272 | Ga0097620_100039238 | 3300006931 | Unclassified | 4750 |
| 273 | Ga0097620_100067198 | 3300006931 | Bacteria | 3619 |
| 274 | Ga0097620_100076660 | 3300006931 | Bacteria | 3384 |
| 275 | Ga0097620_100086169 | 3300006931 | Bacteria | 3187 |
| 276 | Ga0097620_100098201 | 3300006931 | Unclassified | 2982 |
| 277 | Ga0097620_100165628 | 3300006931 | Bacteria | 2290 |
| 278 | Ga0097620_100223541 | 3300006931 | Bacteria | 1971 |
| 279 | Ga0097620_100302115 | 3300006931 | Unclassified | 1694 |
| 280 | Ga0097620_100435479 | 3300006931 | Bacteria | 1407 |
| 281 | Ga0097620_100621548 | 3300006931 | Bacteria | 1173 |
| 282 | Ga0075435_100023341 | 3300007076 | Bacteria | 4782 |
| 283 | Ga0075435_100159906 | 3300007076 | Unclassified | 1897 |
| 284 | Ga0105251_10074341 | 3300009011 | Bacteria | 1578 |
| 285 | Ga0105240_10042809 | 3300009093 | Bacteria | 5768 |
| 286 | Ga0105240_10123214 | 3300009093 | Bacteria | 3119 |
| 287 | Ga0105240_10279215 | 3300009093 | Bacteria | 1920 |
| 288 | Ga0111539_10009389 | 3300009094 | Bacteria | 12347 |
| 289 | Ga0111539_10044639 | 3300009094 | Bacteria | 5309 |
| 290 | Ga0111539_10058758 | 3300009094 | Bacteria | 4561 |
| 291 | Ga0111539_10095139 | 3300009094 | Bacteria | 3500 |
| 292 | Ga0111539_10158626 | 3300009094 | Bacteria | 2647 |
| 293 | Ga0111539_10192261 | 3300009094 | Bacteria | 2381 |
| 294 | Ga0111539_10196967 | 3300009094 | Bacteria | 2349 |
| 295 | Ga0105245_10010782 | 3300009098 | Bacteria | 7953 |
| 296 | Ga0105245_10390981 | 3300009098 | Unclassified | 1387 |
| 297 | Ga0105247_10000001 | 3300009101 | Bacteria | 739726 |
| 298 | Ga0105247_10004251 | 3300009101 | Bacteria | 9177 |
| 299 | Ga0105247_10062449 | 3300009101 | Unclassified | 2311 |
| 300 | Ga0114129_10003197 | 3300009147 | Bacteria | 22986 |
| 301 | Ga0114129_10028380 | 3300009147 | Bacteria | 7930 |
| 302 | Ga0114129_10114835 | 3300009147 | Bacteria | 3712 |
| 303 | Ga0114129_10154258 | 3300009147 | Bacteria | 3142 |
| 304 | Ga0114129_10181484 | 3300009147 | Bacteria | 2863 |
| 305 | Ga0114129_10354098 | 3300009147 | Bacteria | 1944 |
| 306 | Ga0114129_10431576 | 3300009147 | Bacteria | 1731 |
| 307 | Ga0114129_10581003 | 3300009147 | Bacteria | 1454 |
| 308 | Ga0105243_10000019 | 3300009148 | Bacteria | 217107 |
| 309 | Ga0105243_10002025 | 3300009148 | Bacteria | 17213 |
| 310 | Ga0105243_10006485 | 3300009148 | Bacteria | 9048 |
| 311 | Ga0105243_10132854 | 3300009148 | Unclassified | 2114 |
| 312 | Ga0105243_10168090 | 3300009148 | Bacteria | 1897 |
| 313 | Ga0105241_10042086 | 3300009174 | Bacteria | 3454 |
| 314 | Ga0105241_10057362 | 3300009174 | Bacteria | 2987 |
| 315 | Ga0105241_10183964 | 3300009174 | Bacteria | 1735 |
| 316 | Ga0105241_10392324 | 3300009174 | Bacteria | 1216 |
| 317 | Ga0105241_10447275 | 3300009174 | Bacteria | 1142 |
| 318 | Ga0105242_10000007 | 3300009176 | Bacteria | 177073 |
| 319 | Ga0105242_10004220 | 3300009176 | Bacteria | 11202 |
| 320 | Ga0105242_10004974 | 3300009176 | Bacteria | 10277 |
| 321 | Ga0105242_10041696 | 3300009176 | Bacteria | 3703 |
| 322 | Ga0105242_10238998 | 3300009176 | Bacteria | 1632 |
| 323 | Ga0105242_10374475 | 3300009176 | Bacteria | 1322 |
| 324 | Ga0105248_10009745 | 3300009177 | Bacteria | 10583 |
| 325 | Ga0105248_10026181 | 3300009177 | Bacteria | 6489 |
| 326 | Ga0105248_10029526 | 3300009177 | Bacteria | 6116 |
| 327 | Ga0105248_10032794 | 3300009177 | Bacteria | 5803 |
| 328 | Ga0105248_10054605 | 3300009177 | Bacteria | 4480 |
| 329 | Ga0105248_10057358 | 3300009177 | Bacteria | 4371 |
| 330 | Ga0105248_10127924 | 3300009177 | Bacteria | 2866 |
| 331 | Ga0105248_10360592 | 3300009177 | Bacteria | 1636 |
| 332 | Ga0105248_10383283 | 3300009177 | Bacteria | 1583 |
| 333 | Ga0105237_10006392 | 3300009545 | Bacteria | 13077 |
| 334 | Ga0105237_10031278 | 3300009545 | Bacteria | 5398 |
| 335 | Ga0105237_10134931 | 3300009545 | Unclassified | 2463 |
| 336 | Ga0105237_10722213 | 3300009545 | Bacteria | 1003 |
| 337 | Ga0105238_10017007 | 3300009551 | Bacteria | 7383 |
| 338 | Ga0105238_10021171 | 3300009551 | Bacteria | 6627 |
| 339 | Ga0105249_10000107 | 3300009553 | Bacteria | 114573 |
| 340 | Ga0105249_10048917 | 3300009553 | Bacteria | 3855 |
| 341 | Ga0105249_10094571 | 3300009553 | Bacteria | 2801 |
| 342 | Ga0105249_10202012 | 3300009553 | Unclassified | 1945 |
| 343 | Ga0105249_10205214 | 3300009553 | Bacteria | 1931 |
| 344 | Ga0105249_10280051 | 3300009553 | Bacteria | 1665 |
| 345 | Ga0105249_10381677 | 3300009553 | Unclassified | 1435 |
| 346 | Ga0105239_10098522 | 3300010375 | Bacteria | 3232 |
| 347 | Ga0105239_10123744 | 3300010375 | Bacteria | 2874 |
| 348 | Ga0105239_10314500 | 3300010375 | Unclassified | 1765 |
| 349 | Ga0105239_10495885 | 3300010375 | Bacteria | 1388 |
| 350 | Ga0105246_10036695 | 3300011119 | Unclassified | 3285 |
| 351 | Ga0105246_10052408 | 3300011119 | Bacteria | 2805 |
| 352 | Ga0157373_10001131 | 3300013100 | Bacteria | 20507 |
| 353 | Ga0157373_10004127 | 3300013100 | Bacteria | 10952 |
| 354 | Ga0157373_10022534 | 3300013100 | Bacteria | 4569 |
| 355 | Ga0157373_10099466 | 3300013100 | Unclassified | 2047 |
| 356 | Ga0157373_10123041 | 3300013100 | Bacteria | 1824 |
| 357 | Ga0157373_10172593 | 3300013100 | Bacteria | 1521 |
| 358 | Ga0157371_10105104 | 3300013102 | Bacteria | 2003 |
| 359 | Ga0157369_10195986 | 3300013105 | Bacteria | 2121 |
| 360 | Ga0157369_10250896 | 3300013105 | Bacteria | 1847 |
| 361 | Ga0157374_10005684 | 3300013296 | Bacteria | 10514 |
| 362 | Ga0157374_10417297 | 3300013296 | Unclassified | 1340 |
| 363 | Ga0157378_10000176 | 3300013297 | Bacteria | 60614 |
| 364 | Ga0157378_10000681 | 3300013297 | Bacteria | 31934 |
| 365 | Ga0157378_10001399 | 3300013297 | Bacteria | 21715 |
| 366 | Ga0157378_10001720 | 3300013297 | Bacteria | 19659 |
| 367 | Ga0157378_10012967 | 3300013297 | Bacteria | 7292 |
| 368 | Ga0157378_10041373 | 3300013297 | Bacteria | 4087 |
| 369 | Ga0157378_10045113 | 3300013297 | Bacteria | 3916 |
| 370 | Ga0157378_10049614 | 3300013297 | Bacteria | 3734 |
| 371 | Ga0157378_10055088 | 3300013297 | Unclassified | 3541 |
| 372 | Ga0157378_10149393 | 3300013297 | Bacteria | 2176 |
| 373 | Ga0157378_10425425 | 3300013297 | Bacteria | 1313 |
| 374 | Ga0157378_10531564 | 3300013297 | Bacteria | 1179 |
| 375 | Ga0163162_10000006 | 3300013306 | Bacteria | 410012 |
| 376 | Ga0163162_10000966 | 3300013306 | Bacteria | 26676 |
| 377 | Ga0163162_10016251 | 3300013306 | Bacteria | 7279 |
| 378 | Ga0163162_10027965 | 3300013306 | Bacteria | 5578 |
| 379 | Ga0163162_10047954 | 3300013306 | Bacteria | 4280 |
| 380 | Ga0163162_10066061 | 3300013306 | Bacteria | 3666 |
| 381 | Ga0163162_10098520 | 3300013306 | Bacteria | 3013 |
| 382 | Ga0163162_10233631 | 3300013306 | Bacteria | 1969 |
| 383 | Ga0163162_10362899 | 3300013306 | Bacteria | 1581 |
| 384 | Ga0163162_10511509 | 3300013306 | Unclassified | 1331 |
| 385 | Ga0163162_10590986 | 3300013306 | Bacteria | 1237 |
| 386 | Ga0157372_10008816 | 3300013307 | Bacteria | 10713 |
| 387 | Ga0157372_10012433 | 3300013307 | Bacteria | 9074 |
| 388 | Ga0157375_10001758 | 3300013308 | Bacteria | 18593 |
| 389 | Ga0157375_10005745 | 3300013308 | Bacteria | 10792 |
| 390 | Ga0157375_10005943 | 3300013308 | Bacteria | 10637 |
| 391 | Ga0157375_10085500 | 3300013308 | Unclassified | 3204 |
| 392 | Ga0157375_10125224 | 3300013308 | Bacteria | 2684 |
| 393 | Ga0157375_10593436 | 3300013308 | Bacteria | 1267 |
| 394 | Ga0163163_10001194 | 3300014325 | Bacteria | 22003 |
| 395 | Ga0163163_10002791 | 3300014325 | Bacteria | 14753 |
| 396 | Ga0163163_10003423 | 3300014325 | Bacteria | 13484 |
| 397 | Ga0163163_10006276 | 3300014325 | Bacteria | 10375 |
| 398 | Ga0163163_10006974 | 3300014325 | Bacteria | 9925 |
| 399 | Ga0163163_10007025 | 3300014325 | Bacteria | 9892 |
| 400 | Ga0163163_10019449 | 3300014325 | Bacteria | 6379 |
| 401 | Ga0163163_10057894 | 3300014325 | Bacteria | 3832 |
| 402 | Ga0157380_10001155 | 3300014326 | Bacteria | 17080 |
| 403 | Ga0157380_10001325 | 3300014326 | Bacteria | 16086 |
| 404 | Ga0157380_10015572 | 3300014326 | Bacteria | 5591 |
| 405 | Ga0157377_10005619 | 3300014745 | Bacteria | 5909 |
| 406 | Ga0157377_10061326 | 3300014745 | Bacteria | 2149 |
| 407 | Ga0157379_10021400 | 3300014968 | Bacteria | 5724 |
| 408 | Ga0157376_10057395 | 3300014969 | Bacteria | 3256 |
| 409 | Ga0157376_10091970 | 3300014969 | Bacteria | 2629 |
| 410 | Ga0182006_1082602 | 3300015261 | Bacteria | 1170 |
| 411 | Ga0163161_10008832 | 3300017792 | Bacteria | 6967 |
| 412 | Ga0163161_10009081 | 3300017792 | Bacteria | 6875 |
| 413 | Ga0163161_10114864 | 3300017792 | Bacteria | 2017 |
| 414 | Ga0163161_10188862 | 3300017792 | Bacteria | 1583 |
| 415 | Ga0207672_1000452 | 3300025223 | Bacteria | 5241 |
| 416 | Ga0207697_10012562 | 3300025315 | Bacteria | 3548 |
| 417 | Ga0207656_10005191 | 3300025321 | Bacteria | 4581 |
| 418 | Ga0207653_10000095 | 3300025885 | Bacteria | 64003 |
| 419 | Ga0207653_10006563 | 3300025885 | Bacteria | 3632 |
| 420 | Ga0207710_10000003 | 3300025900 | Bacteria | 1071597 |
| 421 | Ga0207710_10000370 | 3300025900 | Bacteria | 31536 |
| 422 | Ga0207688_10083884 | 3300025901 | Bacteria | 1823 |
| 423 | Ga0207680_10009612 | 3300025903 | Bacteria | 4804 |
| 424 | Ga0207647_10018148 | 3300025904 | Unclassified | 4766 |
| 425 | Ga0207685_10000047 | 3300025905 | Bacteria | 45930 |
| 426 | Ga0207643_10004644 | 3300025908 | Bacteria | 7378 |
| 427 | Ga0207684_10000168 | 3300025910 | Bacteria | 110284 |
| 428 | Ga0207684_10001610 | 3300025910 | Bacteria | 23961 |
| 429 | Ga0207684_10052985 | 3300025910 | Bacteria | 3444 |
| 430 | Ga0207684_10059965 | 3300025910 | Bacteria | 3231 |
| 431 | Ga0207684_10209815 | 3300025910 | Bacteria | 1680 |
| 432 | Ga0207654_10046572 | 3300025911 | Bacteria | 2473 |
| 433 | Ga0207654_10182604 | 3300025911 | Bacteria | 1369 |
| 434 | Ga0207707_10000037 | 3300025912 | Bacteria | 144937 |
| 435 | Ga0207707_10016470 | 3300025912 | Bacteria | 6446 |
| 436 | Ga0207707_10265252 | 3300025912 | Bacteria | 1489 |
| 437 | Ga0207695_10040145 | 3300025913 | Bacteria | 5022 |
| 438 | Ga0207695_10245840 | 3300025913 | Bacteria | 1689 |
| 439 | Ga0207671_10002825 | 3300025914 | Bacteria | 18059 |
| 440 | Ga0207660_10005412 | 3300025917 | Bacteria | 8286 |
| 441 | Ga0207660_10071855 | 3300025917 | Unclassified | 2519 |
| 442 | Ga0207660_10103717 | 3300025917 | Unclassified | 2128 |
| 443 | Ga0207660_10121811 | 3300025917 | Bacteria | 1976 |
| 444 | Ga0207662_10002070 | 3300025918 | Bacteria | 9943 |
| 445 | Ga0207662_10030622 | 3300025918 | Bacteria | 3124 |
| 446 | Ga0207662_10161093 | 3300025918 | Bacteria | 1433 |
| 447 | Ga0207649_10021925 | 3300025920 | Bacteria | 3686 |
| 448 | Ga0207652_10000200 | 3300025921 | Bacteria | 63144 |
| 449 | Ga0207652_10071803 | 3300025921 | Unclassified | 3008 |
| 450 | Ga0207646_10000681 | 3300025922 | Bacteria | 44059 |
| 451 | Ga0207646_10022174 | 3300025922 | Bacteria | 5855 |
| 452 | Ga0207646_10144689 | 3300025922 | Bacteria | 2142 |
| 453 | Ga0207681_10000872 | 3300025923 | Bacteria | 19820 |
| 454 | Ga0207681_10033469 | 3300025923 | Unclassified | 3370 |
| 455 | Ga0207681_10109339 | 3300025923 | Bacteria | 2008 |
| 456 | Ga0207694_10007325 | 3300025924 | Bacteria | 8373 |
| 457 | Ga0207694_10025798 | 3300025924 | Bacteria | 4468 |
| 458 | Ga0207650_10000087 | 3300025925 | Bacteria | 123505 |
| 459 | Ga0207650_10188201 | 3300025925 | Bacteria | 1648 |
| 460 | Ga0207650_10199803 | 3300025925 | Bacteria | 1601 |
| 461 | Ga0207659_10101139 | 3300025926 | Bacteria | 2173 |
| 462 | Ga0207687_10332644 | 3300025927 | Bacteria | 1233 |
| 463 | Ga0207644_10000257 | 3300025931 | Bacteria | 35725 |
| 464 | Ga0207644_10010626 | 3300025931 | Bacteria | 6070 |
| 465 | Ga0207644_10052688 | 3300025931 | Bacteria | 2925 |
| 466 | Ga0207690_10024903 | 3300025932 | Bacteria | 3752 |
| 467 | Ga0207706_10044507 | 3300025933 | Bacteria | 3934 |
| 468 | Ga0207706_10047044 | 3300025933 | Bacteria | 3818 |
| 469 | Ga0207686_10000002 | 3300025934 | Bacteria | 453961 |
| 470 | Ga0207686_10000030 | 3300025934 | Bacteria | 159065 |
| 471 | Ga0207686_10004309 | 3300025934 | Bacteria | 7632 |
| 472 | Ga0207686_10004670 | 3300025934 | Bacteria | 7341 |
| 473 | Ga0207686_10181941 | 3300025934 | Bacteria | 1491 |
| 474 | Ga0207709_10000027 | 3300025935 | Bacteria | 339731 |
| 475 | Ga0207709_10018212 | 3300025935 | Bacteria | 3929 |
| 476 | Ga0207709_10119984 | 3300025935 | Bacteria | 1774 |
| 477 | Ga0207709_10328417 | 3300025935 | Unclassified | 1147 |
| 478 | Ga0207670_10003565 | 3300025936 | Bacteria | 8263 |
| 479 | Ga0207670_10134648 | 3300025936 | Bacteria | 1815 |
| 480 | Ga0207670_10348260 | 3300025936 | Bacteria | 1172 |
| 481 | Ga0207704_10149504 | 3300025938 | Bacteria | 1646 |
| 482 | Ga0207704_10414695 | 3300025938 | Bacteria | 1066 |
| 483 | Ga0207665_10000004 | 3300025939 | Bacteria | 218220 |
| 484 | Ga0207691_10004525 | 3300025940 | Bacteria | 13448 |
| 485 | Ga0207691_10058065 | 3300025940 | Unclassified | 3520 |
| 486 | Ga0207711_10006798 | 3300025941 | Bacteria | 9612 |
| 487 | Ga0207711_10013320 | 3300025941 | Bacteria | 6833 |
| 488 | Ga0207711_10051973 | 3300025941 | Bacteria | 3510 |
| 489 | Ga0207711_10104501 | 3300025941 | Bacteria | 2510 |
| 490 | Ga0207711_10165419 | 3300025941 | Bacteria | 2005 |
| 491 | Ga0207711_10223436 | 3300025941 | Bacteria | 1723 |
| 492 | Ga0207689_10002058 | 3300025942 | Bacteria | 18982 |
| 493 | Ga0207689_10007593 | 3300025942 | Bacteria | 9500 |
| 494 | Ga0207689_10007728 | 3300025942 | Bacteria | 9409 |
| 495 | Ga0207689_10007772 | 3300025942 | Bacteria | 9382 |
| 496 | Ga0207689_10043877 | 3300025942 | Bacteria | 3697 |
| 497 | Ga0207689_10092042 | 3300025942 | Bacteria | 2491 |
| 498 | Ga0207679_10013840 | 3300025945 | Bacteria | 5291 |
| 499 | Ga0207679_10027488 | 3300025945 | Bacteria | 3935 |
| 500 | Ga0207679_10046674 | 3300025945 | Bacteria | 3141 |
| 501 | Ga0207651_10054061 | 3300025960 | Bacteria | 2749 |
| 502 | Ga0207651_10066809 | 3300025960 | Bacteria | 2528 |
| 503 | Ga0207712_10000085 | 3300025961 | Bacteria | 107704 |
| 504 | Ga0207712_10003498 | 3300025961 | Bacteria | 9908 |
| 505 | Ga0207712_10008758 | 3300025961 | Bacteria | 6401 |
| 506 | Ga0207712_10023976 | 3300025961 | Bacteria | 4033 |
| 507 | Ga0207712_10040329 | 3300025961 | Bacteria | 3204 |
| 508 | Ga0207712_10049886 | 3300025961 | Bacteria | 2919 |
| 509 | Ga0207712_10270163 | 3300025961 | Unclassified | 1383 |
| 510 | Ga0207668_10003668 | 3300025972 | Bacteria | 9023 |
| 511 | Ga0207640_10113978 | 3300025981 | Bacteria | 1923 |
| 512 | Ga0207658_10028514 | 3300025986 | Bacteria | 3932 |
| 513 | Ga0207677_10142419 | 3300026023 | Bacteria | 1838 |
| 514 | Ga0207703_10000336 | 3300026035 | Bacteria | 51189 |
| 515 | Ga0207703_10013166 | 3300026035 | Bacteria | 6444 |
| 516 | Ga0207703_10052913 | 3300026035 | Bacteria | 3299 |
| 517 | Ga0207703_10141359 | 3300026035 | Bacteria | 2089 |
| 518 | Ga0207703_10473764 | 3300026035 | Bacteria | 1172 |
| 519 | Ga0207639_10015581 | 3300026041 | Bacteria | 5364 |
| 520 | Ga0207639_10040920 | 3300026041 | Bacteria | 3463 |
| 521 | Ga0207639_10200776 | 3300026041 | Unclassified | 1710 |
| 522 | Ga0207639_10202016 | 3300026041 | Bacteria | 1705 |
| 523 | Ga0207708_10000407 | 3300026075 | Bacteria | 33931 |
| 524 | Ga0207708_10010363 | 3300026075 | Bacteria | 6920 |
| 525 | Ga0207708_10012137 | 3300026075 | Bacteria | 6424 |
| 526 | Ga0207708_10021808 | 3300026075 | Bacteria | 4832 |
| 527 | Ga0207708_10025275 | 3300026075 | Bacteria | 4492 |
| 528 | Ga0207708_10067583 | 3300026075 | Bacteria | 2734 |
| 529 | Ga0207708_10083376 | 3300026075 | Unclassified | 2457 |
| 530 | Ga0207708_10114196 | 3300026075 | Bacteria | 2099 |
| 531 | Ga0207641_10010800 | 3300026088 | Bacteria | 7486 |
| 532 | Ga0207641_10011483 | 3300026088 | Bacteria | 7271 |
| 533 | Ga0207641_10051036 | 3300026088 | Unclassified | 3502 |
| 534 | Ga0207641_10309260 | 3300026088 | Bacteria | 1495 |
| 535 | Ga0207641_10333702 | 3300026088 | Bacteria | 1441 |
| 536 | Ga0207648_10005802 | 3300026089 | Bacteria | 12368 |
| 537 | Ga0207648_10095943 | 3300026089 | Bacteria | 2595 |
| 538 | Ga0207676_10002568 | 3300026095 | Bacteria | 12957 |
| 539 | Ga0207676_10004535 | 3300026095 | Bacteria | 9827 |
| 540 | Ga0207676_10009479 | 3300026095 | Bacteria | 6931 |
| 541 | Ga0207676_10069502 | 3300026095 | Bacteria | 2820 |
| 542 | Ga0207676_10085531 | 3300026095 | Bacteria | 2574 |
| 543 | Ga0207676_10122650 | 3300026095 | Unclassified | 2194 |
| 544 | Ga0207674_10000037 | 3300026116 | Bacteria | 134125 |
| 545 | Ga0207674_10012317 | 3300026116 | Bacteria | 9562 |
| 546 | Ga0207674_10041671 | 3300026116 | Bacteria | 4746 |
| 547 | Ga0207674_10061516 | 3300026116 | Bacteria | 3794 |
| 548 | Ga0207674_10068741 | 3300026116 | Bacteria | 3564 |
| 549 | Ga0207674_10120625 | 3300026116 | Bacteria | 2590 |
| 550 | Ga0207674_10190838 | 3300026116 | Bacteria | 1999 |
| 551 | Ga0207674_10313731 | 3300026116 | Bacteria | 1517 |
| 552 | Ga0207674_10611602 | 3300026116 | Bacteria | 1053 |
| 553 | Ga0207675_100002042 | 3300026118 | Bacteria | 20142 |
| 554 | Ga0207675_100002503 | 3300026118 | Bacteria | 18174 |
| 555 | Ga0207675_100039293 | 3300026118 | Bacteria | 4417 |
| 556 | Ga0207675_100051034 | 3300026118 | Bacteria | 3860 |
| 557 | Ga0207675_100075844 | 3300026118 | Bacteria | 3148 |
| 558 | Ga0207675_100159831 | 3300026118 | Bacteria | 2149 |
| 559 | Ga0207675_100281427 | 3300026118 | Bacteria | 1616 |
| 560 | Ga0207675_100445826 | 3300026118 | Bacteria | 1282 |
| 561 | Ga0207675_100577069 | 3300026118 | Bacteria | 1126 |
| 562 | Ga0207698_10068472 | 3300026142 | Bacteria | 2803 |
| 563 | Ga0207698_10213061 | 3300026142 | Unclassified | 1739 |
| 564 | Ga0207428_10030369 | 3300027907 | Bacteria | 4468 |
| 565 | Ga0207428_10041040 | 3300027907 | Bacteria | 3748 |
| 566 | Ga0207428_10199752 | 3300027907 | Unclassified | 1505 |
| 567 | Ga0207428_10223282 | 3300027907 | Bacteria | 1411 |
| 568 | Ga0268266_10065961 | 3300028379 | Bacteria | 3130 |
| 569 | Ga0268265_10007156 | 3300028380 | Bacteria | 7538 |
| 570 | Ga0268265_10416207 | 3300028380 | Bacteria | 1246 |
| 571 | Ga0268264_10012332 | 3300028381 | Bacteria | 7035 |
| 572 | Ga0268264_10055069 | 3300028381 | Bacteria | 3323 |
| 573 | Ga0268264_10061047 | 3300028381 | Unclassified | 3161 |
| 574 | Ga0268264_10084447 | 3300028381 | Bacteria | 2722 |
| 575 | Ga0268264_10090291 | 3300028381 | Unclassified | 2640 |
| 576 | Ga0268264_10181311 | 3300028381 | Bacteria | 1913 |
| 577 | Ga0268264_10404931 | 3300028381 | Bacteria | 1312 |
| 578 | Ga0307513_10352076 | 3300031456 | Bacteria | 1220 |
| 579 | Ga0307408_100037038 | 3300031548 | Bacteria | 3433 |
| 580 | Ga0307408_100292577 | 3300031548 | Bacteria | 1361 |
| 581 | Ga0307405_10096769 | 3300031731 | Bacteria | 1969 |
| 582 | Ga0307413_10043237 | 3300031824 | Bacteria | 2654 |
| 583 | Ga0307406_10005217 | 3300031901 | Bacteria | 7098 |
| 584 | Ga0307409_100171547 | 3300031995 | Bacteria | 1910 |
| 585 | Ga0307409_100313145 | 3300031995 | Bacteria | 1466 |
| 586 | Ga0307416_100030004 | 3300032002 | Bacteria | 4074 |
| 587 | Ga0307416_100193296 | 3300032002 | Bacteria | 1922 |
| 588 | Ga0307414_10043925 | 3300032004 | Bacteria | 3047 |
| 589 | Ga0307411_10067010 | 3300032005 | Bacteria | 2414 |
| 590 | Ga0307415_100394739 | 3300032126 | Bacteria | 1179 |
| 591 | Ga0373940_0022120 | 3300035088 | Bacteria | 1632 |
| 592 | Ga0373951_0013750 | 3300035091 | Bacteria | 1818 |
| 593 | Ga0373941_0036489 | 3300035115 | Bacteria | 1495 |
| 594 | Ga0373943_0039383 | 3300035170 | Bacteria | 2277 |
| 595 | Ga0395899_0187503 | 3300037312 | Bacteria | 1449 |
| 596 | Ga0395899_0349302 | 3300037312 | Bacteria | 990 |
| 597 | Ga0395900_0395689 | 3300037418 | Bacteria | 1347 |
| 598 | Ga0395901_0098180 | 3300038443 | Bacteria | 3071 |
| 599 | Ga0395901_0166555 | 3300038443 | Bacteria | 2314 |
| 600 | Ga0395901_0200318 | 3300038443 | Bacteria | 2093 |
| 601 | Ga0395901_0213496 | 3300038443 | Bacteria | 2019 |
| 602 | Ga0242420_000152 | 3300038996 | Bacteria | 7149 |
| 603 | Ga0242420_008207 | 3300038996 | Bacteria | 1689 |
| 604 | Ga0439439_0006736 | 3300041406 | Bacteria | 2664 |
| 605 | Ga0439455_0015858 | 3300042012 | Bacteria | 1736 |
| 606 | Ga0439458_0004779 | 3300042157 | Unclassified | 3080 |
| 607 | Ga0439434_0009299 | 3300042435 | Bacteria | 2887 |
| 608 | Ga0453683_0089348 | 3300044673 | Bacteria | 1931 |
| 609 | Ga0451576_0110442 | 3300045051 | Bacteria | 2861 |
| 610 | Ga0451576_0766432 | 3300045051 | Bacteria | 1013 |
| 611 | Ga0495639_0135664 | 3300046475 | Bacteria | 1181 |
| 612 | Ga0495662_0130692 | 3300046476 | Bacteria | 1234 |
| 613 | Ga0495610_0118227 | 3300046512 | Bacteria | 1165 |
| 614 | Ga0495628_0371473 | 3300046516 | Bacteria | 1049 |
| 615 | Ga0495630_0181321 | 3300046517 | Bacteria | 1606 |
| 616 | Ga0495663_0000285 | 3300046525 | Bacteria | 19329 |
| 617 | Ga0495598_0000057 | 3300046537 | Bacteria | 17715 |
| 618 | Ga0495621_0000189 | 3300046539 | Bacteria | 14117 |
| 619 | Ga0495668_0063944 | 3300046616 | Bacteria | 2026 |
| 620 | Ga0495659_0028799 | 3300046664 | Unclassified | 1924 |
| 621 | Ga0495669_0166001 | 3300046684 | Bacteria | 1049 |
| 622 | Ga0495672_0052790 | 3300047320 | Bacteria | 2386 |
| 623 | Ga0496106_0001329 | 3300048909 | Bacteria | 18535 |
| 624 | Ga0496106_0276416 | 3300048909 | Unclassified | 1345 |
| 625 | Ga0496108_0131514 | 3300048911 | Bacteria | 2151 |
| 626 | Ga0496112_0540299 | 3300048915 | Bacteria | 1100 |
| 627 | Ga0496114_0557465 | 3300048917 | Bacteria | 1012 |
| 628 | Ga0501291_000942 | 3300049514 | Bacteria | 3336 |
| 629 | Ga0501038_0070356 | 3300049574 | Bacteria | 2971 |
| 630 | Ga0501198_003004 | 3300049649 | Bacteria | 2297 |
| 631 | Ga0501217_004334 | 3300049661 | Bacteria | 2912 |
| 632 | Ga0501223_003083 | 3300049663 | Bacteria | 3639 |
| 633 | Ga0501233_004661 | 3300049668 | Bacteria | 2525 |
| 634 | Ga0501233_011994 | 3300049668 | Bacteria | 1732 |
| 635 | Ga0501257_046456 | 3300049686 | Bacteria | 1076 |
| 636 | Ga0501225_0003210 | 3300049705 | Bacteria | 4995 |
| 637 | Ga0501234_002615 | 3300049707 | Unclassified | 2836 |
| 638 | Ga0501234_003422 | 3300049707 | Bacteria | 2493 |
| 639 | Ga0501268_010912 | 3300049765 | Bacteria | 1424 |
| 640 | Ga0501226_002652 | 3300049853 | Bacteria | 2169 |
| 641 | nmdc:mga05p37_125154_c1 | 3300050507 | Unclassified | 3157 |
| 642 | nmdc:mga05p37_168938_c1 | 3300050507 | Bacteria | 2668 |
| 643 | nmdc:mga05p37_349666_c1 | 3300050507 | Bacteria | 1741 |
| 644 | nmdc:mga05p37_576290_c1 | 3300050507 | Bacteria | 1275 |
| 645 | nmdc:mga05p37_66358_c1 | 3300050507 | Bacteria | 4439 |
| 646 | nmdc:mga09592_211972_c1 | 3300050508 | Bacteria | 1678 |
| 647 | nmdc:mga09592_58999_c1 | 3300050508 | Unclassified | 3244 |
| 648 | nmdc:mga0qj67_117513_c1 | 3300050509 | Bacteria | 2150 |
| 649 | nmdc:mga06r32_101691_c1 | 3300050510 | Bacteria | 2821 |
| 650 | nmdc:mga06r32_376222_c1 | 3300050510 | Bacteria | 1403 |
| 651 | nmdc:mga06r32_38757_c1 | 3300050510 | Bacteria | 4518 |
| 652 | nmdc:mga08y16_104215_c1 | 3300050511 | Unclassified | 2953 |
| 653 | nmdc:mga08y16_10496_c1 | 3300050511 | Bacteria | 9716 |
| 654 | nmdc:mga08y16_1574_c1 | 3300050511 | Bacteria | 23031 |
| 655 | nmdc:mga08y16_263690_c1 | 3300050511 | Bacteria | 1779 |
| 656 | nmdc:mga08y16_58233_c1 | 3300050511 | Bacteria | 4037 |
| 657 | nmdc:mga08y16_83420_c1 | 3300050511 | Bacteria | 3331 |
| 658 | nmdc:mga0n895_141069_c1 | 3300050512 | Bacteria | 2438 |
| 659 | nmdc:mga0n895_485263_c1 | 3300050512 | Bacteria | 1246 |
| 660 | nmdc:mga0n895_61474_c1 | 3300050512 | Bacteria | 3708 |
| 661 | nmdc:mga0rr50_146312_c1 | 3300050513 | Unclassified | 1905 |
| 662 | nmdc:mga0rr50_223971_c1 | 3300050513 | Bacteria | 1554 |
| 663 | nmdc:mga0rr50_250988_c1 | 3300050513 | Bacteria | 1469 |
| 664 | nmdc:mga0rr50_27553_c1 | 3300050513 | Bacteria | 3981 |
| 665 | nmdc:mga0a205_17733_c1 | 3300050515 | Bacteria | 6681 |
| 666 | nmdc:mga0a205_56437_c1 | 3300050515 | Bacteria | 3792 |
| 667 | nmdc:mga0a205_57787_c1 | 3300050515 | Bacteria | 3746 |
| 668 | nmdc:mga0a205_89118_c1 | 3300050515 | Unclassified | 2982 |
| 669 | Ga0500616_0002137 | 3300053153 | Bacteria | 17103 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048909 | Ga0496106_0001329 | Ga0496106_0001329_15722_16636 | 287 |
| 2 | 3300005539 | Ga0068853_100009668 | Ga0068853_1000096683 | 291 |
| 3 | 3300009093 | Ga0105240_10123214 | Ga0105240_101232141 | 291 |
| 4 | 3300046525 | Ga0495663_0000285 | Ga0495663_0000285_9903_10862 | 293 |
| 5 | 3300046537 | Ga0495598_0000057 | Ga0495598_0000057_13873_14832 | 293 |
| 6 | 3300046539 | Ga0495621_0000189 | Ga0495621_0000189_3144_4103 | 293 |
| 7 | 3300026088 | Ga0207641_10011483 | Ga0207641_100114832 | 296 |
| 8 | 3300005329 | Ga0070683_100199655 | Ga0070683_1001996552 | 298 |
| 9 | 3300005336 | Ga0070680_100020003 | Ga0070680_1000200032 | 298 |
| 10 | 3300005344 | Ga0070661_100030511 | Ga0070661_1000305111 | 298 |
| 11 | 3300005366 | Ga0070659_100003483 | Ga0070659_1000034836 | 298 |
| 12 | 3300005458 | Ga0070681_10000410 | Ga0070681_1000041020 | 298 |
| 13 | 3300005530 | Ga0070679_100048827 | Ga0070679_1000488271 | 298 |
| 14 | 3300005539 | Ga0068853_100002384 | Ga0068853_1000023849 | 298 |
| 15 | 3300005564 | Ga0070664_100002140 | Ga0070664_1000021403 | 298 |
| 16 | 3300005577 | Ga0068857_100000660 | Ga0068857_1000006606 | 298 |
| 17 | 3300005618 | Ga0068864_100051816 | Ga0068864_1000518163 | 298 |
| 18 | 3300013100 | Ga0157373_10004127 | Ga0157373_100041276 | 298 |
| 19 | 3300014325 | Ga0163163_10001194 | Ga0163163_1000119419 | 298 |
| 20 | 3300025917 | Ga0207660_10071855 | Ga0207660_100718552 | 298 |
| 21 | 3300025920 | Ga0207649_10021925 | Ga0207649_100219252 | 298 |
| 22 | 3300025921 | Ga0207652_10071803 | Ga0207652_100718032 | 298 |
| 23 | 3300025932 | Ga0207690_10024903 | Ga0207690_100249032 | 298 |
| 24 | 3300025945 | Ga0207679_10013840 | Ga0207679_100138405 | 298 |
| 25 | 3300026041 | Ga0207639_10015581 | Ga0207639_100155812 | 298 |
| 26 | 3300026095 | Ga0207676_10069502 | Ga0207676_100695022 | 298 |
| 27 | 3300026116 | Ga0207674_10000037 | Ga0207674_1000003737 | 298 |
| 28 | 3300009094 | Ga0111539_10192261 | Ga0111539_101922611 | 300 |
| 29 | 3300025911 | Ga0207654_10182604 | Ga0207654_101826042 | 300 |
| 30 | 3300005330 | Ga0070690_100033794 | Ga0070690_1000337941 | 302 |
| 31 | 3300005340 | Ga0070689_100014111 | Ga0070689_1000141113 | 302 |
| 32 | 3300005343 | Ga0070687_100128618 | Ga0070687_1001286182 | 302 |
| 33 | 3300005364 | Ga0070673_100102947 | Ga0070673_1001029471 | 302 |
| 34 | 3300005406 | Ga0070703_10000059 | Ga0070703_1000005925 | 302 |
| 35 | 3300005439 | Ga0070711_100389994 | Ga0070711_1003899941 | 302 |
| 36 | 3300005441 | Ga0070700_100016838 | Ga0070700_1000168383 | 302 |
| 37 | 3300005441 | Ga0070700_100221376 | Ga0070700_1002213762 | 302 |
| 38 | 3300005445 | Ga0070708_100091327 | Ga0070708_1000913272 | 302 |
| 39 | 3300005544 | Ga0070686_100024137 | Ga0070686_1000241373 | 302 |
| 40 | 3300005549 | Ga0070704_100141764 | Ga0070704_1001417642 | 302 |
| 41 | 3300005617 | Ga0068859_100039240 | Ga0068859_1000392404 | 302 |
| 42 | 3300005618 | Ga0068864_100190381 | Ga0068864_1001903812 | 302 |
| 43 | 3300005841 | Ga0068863_100282824 | Ga0068863_1002828242 | 302 |
| 44 | 3300006844 | Ga0075428_100047810 | Ga0075428_1000478104 | 302 |
| 45 | 3300006880 | Ga0075429_100059092 | Ga0075429_1000590923 | 302 |
| 46 | 3300006931 | Ga0097620_100039238 | Ga0097620_1000392384 | 302 |
| 47 | 3300009094 | Ga0111539_10058758 | Ga0111539_100587582 | 302 |
| 48 | 3300009148 | Ga0105243_10000019 | Ga0105243_1000001952 | 302 |
| 49 | 3300009176 | Ga0105242_10000007 | Ga0105242_1000000773 | 302 |
| 50 | 3300009177 | Ga0105248_10057358 | Ga0105248_100573584 | 302 |
| 51 | 3300009177 | Ga0105248_10360592 | Ga0105248_103605921 | 302 |
| 52 | 3300009553 | Ga0105249_10381677 | Ga0105249_103816772 | 302 |
| 53 | 3300013297 | Ga0157378_10149393 | Ga0157378_101493932 | 302 |
| 54 | 3300013306 | Ga0163162_10511509 | Ga0163162_105115091 | 302 |
| 55 | 3300017792 | Ga0163161_10114864 | Ga0163161_101148642 | 302 |
| 56 | 3300025885 | Ga0207653_10000095 | Ga0207653_1000009516 | 302 |
| 57 | 3300025918 | Ga0207662_10161093 | Ga0207662_101610932 | 302 |
| 58 | 3300025934 | Ga0207686_10000002 | Ga0207686_10000002130 | 302 |
| 59 | 3300025935 | Ga0207709_10000027 | Ga0207709_10000027223 | 302 |
| 60 | 3300025938 | Ga0207704_10149504 | Ga0207704_101495042 | 302 |
| 61 | 3300025961 | Ga0207712_10270163 | Ga0207712_102701632 | 302 |
| 62 | 3300026075 | Ga0207708_10067583 | Ga0207708_100675833 | 302 |
| 63 | 3300026088 | Ga0207641_10309260 | Ga0207641_103092602 | 302 |
| 64 | 3300026118 | Ga0207675_100159831 | Ga0207675_1001598312 | 302 |
| 65 | 3300027907 | Ga0207428_10030369 | Ga0207428_100303694 | 302 |
| 66 | 3300042435 | Ga0439434_0009299 | Ga0439434_0009299_899_1840 | 302 |
| 67 | 3300046517 | Ga0495630_0181321 | Ga0495630_0181321_606_1529 | 302 |
| 68 | 3300046664 | Ga0495659_0028799 | Ga0495659_0028799_496_1407 | 302 |
| 69 | 3300050508 | nmdc:mga09592_58999_c1 | nmdc:mga09592_58999_c1_161_1075 | 302 |
| 70 | 3300050511 | nmdc:mga08y16_83420_c1 | nmdc:mga08y16_83420_c1_2017_2931 | 302 |
| 71 | 3300002074 | JGI24748J21848_1000008 | JGI24748J21848_100000840 | 303 |
| 72 | 3300002239 | JGI24034J26672_10000002 | JGI24034J26672_10000002432 | 303 |
| 73 | 3300005334 | Ga0068869_100029552 | Ga0068869_1000295522 | 303 |
| 74 | 3300005336 | Ga0070680_100017225 | Ga0070680_1000172256 | 303 |
| 75 | 3300005338 | Ga0068868_100032331 | Ga0068868_1000323313 | 303 |
| 76 | 3300005343 | Ga0070687_100121365 | Ga0070687_1001213652 | 303 |
| 77 | 3300005406 | Ga0070703_10040190 | Ga0070703_100401902 | 303 |
| 78 | 3300005438 | Ga0070701_10016248 | Ga0070701_100162484 | 303 |
| 79 | 3300005440 | Ga0070705_100207484 | Ga0070705_1002074841 | 303 |
| 80 | 3300005441 | Ga0070700_100094023 | Ga0070700_1000940232 | 303 |
| 81 | 3300005444 | Ga0070694_100337627 | Ga0070694_1003376271 | 303 |
| 82 | 3300005467 | Ga0070706_100030144 | Ga0070706_1000301442 | 303 |
| 83 | 3300005467 | Ga0070706_100053561 | Ga0070706_1000535613 | 303 |
| 84 | 3300005467 | Ga0070706_100443147 | Ga0070706_1004431471 | 303 |
| 85 | 3300005468 | Ga0070707_100037232 | Ga0070707_1000372323 | 303 |
| 86 | 3300005468 | Ga0070707_100055949 | Ga0070707_1000559495 | 303 |
| 87 | 3300005471 | Ga0070698_100056932 | Ga0070698_1000569324 | 303 |
| 88 | 3300005471 | Ga0070698_100287023 | Ga0070698_1002870232 | 303 |
| 89 | 3300005536 | Ga0070697_100096038 | Ga0070697_1000960382 | 303 |
| 90 | 3300005545 | Ga0070695_100063763 | Ga0070695_1000637632 | 303 |
| 91 | 3300005545 | Ga0070695_100277027 | Ga0070695_1002770271 | 303 |
| 92 | 3300005546 | Ga0070696_100040888 | Ga0070696_1000408883 | 303 |
| 93 | 3300005549 | Ga0070704_100081117 | Ga0070704_1000811173 | 303 |
| 94 | 3300005549 | Ga0070704_100094658 | Ga0070704_1000946583 | 303 |
| 95 | 3300005549 | Ga0070704_100140583 | Ga0070704_1001405832 | 303 |
| 96 | 3300005549 | Ga0070704_100220831 | Ga0070704_1002208312 | 303 |
| 97 | 3300005617 | Ga0068859_100086168 | Ga0068859_1000861685 | 303 |
| 98 | 3300005718 | Ga0068866_10101492 | Ga0068866_101014921 | 303 |
| 99 | 3300005842 | Ga0068858_100000055 | Ga0068858_10000005587 | 303 |
| 100 | 3300005842 | Ga0068858_100554874 | Ga0068858_1005548742 | 303 |
| 101 | 3300005842 | Ga0068858_100583093 | Ga0068858_1005830931 | 303 |
| 102 | 3300005844 | Ga0068862_100058963 | Ga0068862_1000589633 | 303 |
| 103 | 3300005985 | Ga0081539_10092694 | Ga0081539_100926942 | 303 |
| 104 | 3300006163 | Ga0070715_10000060 | Ga0070715_1000006035 | 303 |
| 105 | 3300006173 | Ga0070716_100000002 | Ga0070716_100000002340 | 303 |
| 106 | 3300006852 | Ga0075433_10012104 | Ga0075433_100121044 | 303 |
| 107 | 3300006931 | Ga0097620_100086169 | Ga0097620_1000861695 | 303 |
| 108 | 3300009098 | Ga0105245_10390981 | Ga0105245_103909812 | 303 |
| 109 | 3300009101 | Ga0105247_10000001 | Ga0105247_10000001216 | 303 |
| 110 | 3300009147 | Ga0114129_10354098 | Ga0114129_103540982 | 303 |
| 111 | 3300009148 | Ga0105243_10002025 | Ga0105243_1000202513 | 303 |
| 112 | 3300009176 | Ga0105242_10004220 | Ga0105242_1000422010 | 303 |
| 113 | 3300009176 | Ga0105242_10004974 | Ga0105242_100049744 | 303 |
| 114 | 3300009176 | Ga0105242_10238998 | Ga0105242_102389982 | 303 |
| 115 | 3300009177 | Ga0105248_10127924 | Ga0105248_101279242 | 303 |
| 116 | 3300009553 | Ga0105249_10000107 | Ga0105249_1000010735 | 303 |
| 117 | 3300010375 | Ga0105239_10123744 | Ga0105239_101237443 | 303 |
| 118 | 3300013100 | Ga0157373_10123041 | Ga0157373_101230412 | 303 |
| 119 | 3300013102 | Ga0157371_10105104 | Ga0157371_101051042 | 303 |
| 120 | 3300013297 | Ga0157378_10000176 | Ga0157378_1000017614 | 303 |
| 121 | 3300013297 | Ga0157378_10055088 | Ga0157378_100550881 | 303 |
| 122 | 3300013297 | Ga0157378_10425425 | Ga0157378_104254251 | 303 |
| 123 | 3300013297 | Ga0157378_10531564 | Ga0157378_105315641 | 303 |
| 124 | 3300013306 | Ga0163162_10000006 | Ga0163162_10000006233 | 303 |
| 125 | 3300013306 | Ga0163162_10047954 | Ga0163162_100479543 | 303 |
| 126 | 3300013306 | Ga0163162_10098520 | Ga0163162_100985203 | 303 |
| 127 | 3300013306 | Ga0163162_10233631 | Ga0163162_102336312 | 303 |
| 128 | 3300013308 | Ga0157375_10001758 | Ga0157375_1000175811 | 303 |
| 129 | 3300014968 | Ga0157379_10021400 | Ga0157379_100214004 | 303 |
| 130 | 3300017792 | Ga0163161_10008832 | Ga0163161_100088326 | 303 |
| 131 | 3300017792 | Ga0163161_10188862 | Ga0163161_101888622 | 303 |
| 132 | 3300025223 | Ga0207672_1000452 | Ga0207672_10004522 | 303 |
| 133 | 3300025900 | Ga0207710_10000003 | Ga0207710_10000003421 | 303 |
| 134 | 3300025905 | Ga0207685_10000047 | Ga0207685_1000004735 | 303 |
| 135 | 3300025910 | Ga0207684_10001610 | Ga0207684_100016106 | 303 |
| 136 | 3300025917 | Ga0207660_10121811 | Ga0207660_101218112 | 303 |
| 137 | 3300025922 | Ga0207646_10000681 | Ga0207646_1000068125 | 303 |
| 138 | 3300025922 | Ga0207646_10022174 | Ga0207646_100221744 | 303 |
| 139 | 3300025922 | Ga0207646_10144689 | Ga0207646_101446892 | 303 |
| 140 | 3300025931 | Ga0207644_10000257 | Ga0207644_1000025719 | 303 |
| 141 | 3300025934 | Ga0207686_10000030 | Ga0207686_10000030129 | 303 |
| 142 | 3300025934 | Ga0207686_10004670 | Ga0207686_100046708 | 303 |
| 143 | 3300025935 | Ga0207709_10018212 | Ga0207709_100182124 | 303 |
| 144 | 3300025939 | Ga0207665_10000004 | Ga0207665_10000004150 | 303 |
| 145 | 3300025941 | Ga0207711_10051973 | Ga0207711_100519733 | 303 |
| 146 | 3300025942 | Ga0207689_10007772 | Ga0207689_100077728 | 303 |
| 147 | 3300025942 | Ga0207689_10043877 | Ga0207689_100438773 | 303 |
| 148 | 3300025961 | Ga0207712_10000085 | Ga0207712_1000008567 | 303 |
| 149 | 3300025972 | Ga0207668_10003668 | Ga0207668_100036686 | 303 |
| 150 | 3300026023 | Ga0207677_10142419 | Ga0207677_101424192 | 303 |
| 151 | 3300026035 | Ga0207703_10000336 | Ga0207703_100003362 | 303 |
| 152 | 3300026035 | Ga0207703_10013166 | Ga0207703_100131662 | 303 |
| 153 | 3300026035 | Ga0207703_10473764 | Ga0207703_104737642 | 303 |
| 154 | 3300026075 | Ga0207708_10114196 | Ga0207708_101141962 | 303 |
| 155 | 3300026118 | Ga0207675_100002503 | Ga0207675_10000250315 | 303 |
| 156 | 3300028381 | Ga0268264_10012332 | Ga0268264_100123322 | 303 |
| 157 | 3300028381 | Ga0268264_10055069 | Ga0268264_100550693 | 303 |
| 158 | 3300032126 | Ga0307415_100394739 | Ga0307415_1003947391 | 303 |
| 159 | 3300038996 | Ga0242420_008207 | Ga0242420_008207_497_1411 | 303 |
| 160 | 3300041406 | Ga0439439_0006736 | Ga0439439_0006736_459_1400 | 303 |
| 161 | 3300044673 | Ga0453683_0089348 | Ga0453683_0089348_987_1901 | 303 |
| 162 | 3300045051 | Ga0451576_0110442 | Ga0451576_0110442_41_955 | 303 |
| 163 | 3300046475 | Ga0495639_0135664 | Ga0495639_0135664_24_965 | 303 |
| 164 | 3300046476 | Ga0495662_0130692 | Ga0495662_0130692_267_1196 | 303 |
| 165 | 3300046516 | Ga0495628_0371473 | Ga0495628_0371473_30_959 | 303 |
| 166 | 3300048917 | Ga0496114_0557465 | Ga0496114_0557465_16_930 | 303 |
| 167 | 3300050507 | nmdc:mga05p37_576290_c1 | nmdc:mga05p37_576290_c1_273_1187 | 303 |
| 168 | 3300050512 | nmdc:mga0n895_141069_c1 | nmdc:mga0n895_141069_c1_20_934 | 303 |
| 169 | 3300050513 | nmdc:mga0rr50_250988_c1 | nmdc:mga0rr50_250988_c1_424_1338 | 303 |
| 170 | 3300050515 | nmdc:mga0a205_56437_c1 | nmdc:mga0a205_56437_c1_1227_2141 | 303 |
| 171 | 3300005290 | Ga0065712_10008051 | Ga0065712_100080511 | 304 |
| 172 | 3300005293 | Ga0065715_10004857 | Ga0065715_100048573 | 304 |
| 173 | 3300005330 | Ga0070690_100006141 | Ga0070690_1000061411 | 304 |
| 174 | 3300005330 | Ga0070690_100037139 | Ga0070690_1000371392 | 304 |
| 175 | 3300005331 | Ga0070670_100575419 | Ga0070670_1005754191 | 304 |
| 176 | 3300005333 | Ga0070677_10059292 | Ga0070677_100592922 | 304 |
| 177 | 3300005334 | Ga0068869_100013796 | Ga0068869_1000137962 | 304 |
| 178 | 3300005336 | Ga0070680_100002480 | Ga0070680_1000024806 | 304 |
| 179 | 3300005337 | Ga0070682_100056989 | Ga0070682_1000569892 | 304 |
| 180 | 3300005338 | Ga0068868_100035851 | Ga0068868_1000358512 | 304 |
| 181 | 3300005340 | Ga0070689_100001207 | Ga0070689_10000120710 | 304 |
| 182 | 3300005340 | Ga0070689_100046434 | Ga0070689_1000464344 | 304 |
| 183 | 3300005343 | Ga0070687_100008800 | Ga0070687_1000088003 | 304 |
| 184 | 3300005343 | Ga0070687_100063555 | Ga0070687_1000635552 | 304 |
| 185 | 3300005345 | Ga0070692_10092666 | Ga0070692_100926662 | 304 |
| 186 | 3300005345 | Ga0070692_10246732 | Ga0070692_102467321 | 304 |
| 187 | 3300005353 | Ga0070669_100066425 | Ga0070669_1000664252 | 304 |
| 188 | 3300005354 | Ga0070675_100037759 | Ga0070675_1000377595 | 304 |
| 189 | 3300005355 | Ga0070671_100012372 | Ga0070671_1000123725 | 304 |
| 190 | 3300005365 | Ga0070688_100002981 | Ga0070688_1000029815 | 304 |
| 191 | 3300005438 | Ga0070701_10075930 | Ga0070701_100759302 | 304 |
| 192 | 3300005440 | Ga0070705_100015078 | Ga0070705_1000150782 | 304 |
| 193 | 3300005441 | Ga0070700_100029174 | Ga0070700_1000291742 | 304 |
| 194 | 3300005444 | Ga0070694_100101908 | Ga0070694_1001019083 | 304 |
| 195 | 3300005444 | Ga0070694_100122832 | Ga0070694_1001228322 | 304 |
| 196 | 3300005457 | Ga0070662_100029005 | Ga0070662_1000290053 | 304 |
| 197 | 3300005458 | Ga0070681_10000956 | Ga0070681_1000095615 | 304 |
| 198 | 3300005458 | Ga0070681_10121305 | Ga0070681_101213053 | 304 |
| 199 | 3300005459 | Ga0068867_100081841 | Ga0068867_1000818412 | 304 |
| 200 | 3300005466 | Ga0070685_10021815 | Ga0070685_100218152 | 304 |
| 201 | 3300005467 | Ga0070706_100000358 | Ga0070706_10000035813 | 304 |
| 202 | 3300005471 | Ga0070698_100005931 | Ga0070698_1000059318 | 304 |
| 203 | 3300005530 | Ga0070679_100002026 | Ga0070679_1000020268 | 304 |
| 204 | 3300005536 | Ga0070697_100361956 | Ga0070697_1003619562 | 304 |
| 205 | 3300005544 | Ga0070686_100002441 | Ga0070686_1000024414 | 304 |
| 206 | 3300005545 | Ga0070695_100196935 | Ga0070695_1001969352 | 304 |
| 207 | 3300005546 | Ga0070696_100065546 | Ga0070696_1000655462 | 304 |
| 208 | 3300005546 | Ga0070696_100110607 | Ga0070696_1001106072 | 304 |
| 209 | 3300005547 | Ga0070693_100009683 | Ga0070693_1000096834 | 304 |
| 210 | 3300005547 | Ga0070693_100075068 | Ga0070693_1000750682 | 304 |
| 211 | 3300005549 | Ga0070704_100386983 | Ga0070704_1003869831 | 304 |
| 212 | 3300005577 | Ga0068857_100304425 | Ga0068857_1003044252 | 304 |
| 213 | 3300005578 | Ga0068854_100309077 | Ga0068854_1003090772 | 304 |
| 214 | 3300005615 | Ga0070702_100032831 | Ga0070702_1000328313 | 304 |
| 215 | 3300005617 | Ga0068859_100019388 | Ga0068859_1000193888 | 304 |
| 216 | 3300005617 | Ga0068859_100020821 | Ga0068859_1000208216 | 304 |
| 217 | 3300005617 | Ga0068859_100098202 | Ga0068859_1000982022 | 304 |
| 218 | 3300005617 | Ga0068859_100165631 | Ga0068859_1001656312 | 304 |
| 219 | 3300005618 | Ga0068864_100410073 | Ga0068864_1004100731 | 304 |
| 220 | 3300005718 | Ga0068866_10045751 | Ga0068866_100457512 | 304 |
| 221 | 3300005719 | Ga0068861_100018116 | Ga0068861_1000181165 | 304 |
| 222 | 3300005834 | Ga0068851_10001687 | Ga0068851_100016879 | 304 |
| 223 | 3300005841 | Ga0068863_100014751 | Ga0068863_1000147515 | 304 |
| 224 | 3300005841 | Ga0068863_100355474 | Ga0068863_1003554742 | 304 |
| 225 | 3300005842 | Ga0068858_100078020 | Ga0068858_1000780202 | 304 |
| 226 | 3300005843 | Ga0068860_100111768 | Ga0068860_1001117682 | 304 |
| 227 | 3300005844 | Ga0068862_100022869 | Ga0068862_1000228695 | 304 |
| 228 | 3300006844 | Ga0075428_100167962 | Ga0075428_1001679622 | 304 |
| 229 | 3300006846 | Ga0075430_100045196 | Ga0075430_1000451963 | 304 |
| 230 | 3300006847 | Ga0075431_100032160 | Ga0075431_1000321606 | 304 |
| 231 | 3300006852 | Ga0075433_10021661 | Ga0075433_100216614 | 304 |
| 232 | 3300006852 | Ga0075433_10059528 | Ga0075433_100595283 | 304 |
| 233 | 3300006852 | Ga0075433_10175036 | Ga0075433_101750362 | 304 |
| 234 | 3300006871 | Ga0075434_100129327 | Ga0075434_1001293272 | 304 |
| 235 | 3300006880 | Ga0075429_100032578 | Ga0075429_1000325785 | 304 |
| 236 | 3300006881 | Ga0068865_100014218 | Ga0068865_1000142185 | 304 |
| 237 | 3300006931 | Ga0097620_100019388 | Ga0097620_1000193888 | 304 |
| 238 | 3300006931 | Ga0097620_100020822 | Ga0097620_1000208224 | 304 |
| 239 | 3300006931 | Ga0097620_100098201 | Ga0097620_1000982012 | 304 |
| 240 | 3300006931 | Ga0097620_100165628 | Ga0097620_1001656282 | 304 |
| 241 | 3300007076 | Ga0075435_100159906 | Ga0075435_1001599062 | 304 |
| 242 | 3300009093 | Ga0105240_10042809 | Ga0105240_100428093 | 304 |
| 243 | 3300009094 | Ga0111539_10009389 | Ga0111539_100093892 | 304 |
| 244 | 3300009094 | Ga0111539_10044639 | Ga0111539_100446394 | 304 |
| 245 | 3300009098 | Ga0105245_10010782 | Ga0105245_100107823 | 304 |
| 246 | 3300009147 | Ga0114129_10154258 | Ga0114129_101542581 | 304 |
| 247 | 3300009147 | Ga0114129_10181484 | Ga0114129_101814843 | 304 |
| 248 | 3300009148 | Ga0105243_10168090 | Ga0105243_101680902 | 304 |
| 249 | 3300009174 | Ga0105241_10183964 | Ga0105241_101839642 | 304 |
| 250 | 3300009177 | Ga0105248_10026181 | Ga0105248_100261815 | 304 |
| 251 | 3300009545 | Ga0105237_10006392 | Ga0105237_100063923 | 304 |
| 252 | 3300009553 | Ga0105249_10280051 | Ga0105249_102800512 | 304 |
| 253 | 3300010375 | Ga0105239_10098522 | Ga0105239_100985223 | 304 |
| 254 | 3300010375 | Ga0105239_10314500 | Ga0105239_103145001 | 304 |
| 255 | 3300011119 | Ga0105246_10052408 | Ga0105246_100524083 | 304 |
| 256 | 3300013100 | Ga0157373_10001131 | Ga0157373_100011313 | 304 |
| 257 | 3300013297 | Ga0157378_10001399 | Ga0157378_1000139915 | 304 |
| 258 | 3300013297 | Ga0157378_10001720 | Ga0157378_100017208 | 304 |
| 259 | 3300013306 | Ga0163162_10027965 | Ga0163162_100279652 | 304 |
| 260 | 3300013306 | Ga0163162_10590986 | Ga0163162_105909862 | 304 |
| 261 | 3300013307 | Ga0157372_10008816 | Ga0157372_100088167 | 304 |
| 262 | 3300013307 | Ga0157372_10012433 | Ga0157372_100124336 | 304 |
| 263 | 3300014325 | Ga0163163_10019449 | Ga0163163_100194495 | 304 |
| 264 | 3300014326 | Ga0157380_10015572 | Ga0157380_100155724 | 304 |
| 265 | 3300014745 | Ga0157377_10005619 | Ga0157377_100056194 | 304 |
| 266 | 3300014969 | Ga0157376_10057395 | Ga0157376_100573953 | 304 |
| 267 | 3300017792 | Ga0163161_10009081 | Ga0163161_100090815 | 304 |
| 268 | 3300025315 | Ga0207697_10012562 | Ga0207697_100125622 | 304 |
| 269 | 3300025321 | Ga0207656_10005191 | Ga0207656_100051913 | 304 |
| 270 | 3300025885 | Ga0207653_10006563 | Ga0207653_100065633 | 304 |
| 271 | 3300025901 | Ga0207688_10083884 | Ga0207688_100838842 | 304 |
| 272 | 3300025910 | Ga0207684_10000168 | Ga0207684_1000016865 | 304 |
| 273 | 3300025912 | Ga0207707_10000037 | Ga0207707_1000003781 | 304 |
| 274 | 3300025913 | Ga0207695_10040145 | Ga0207695_100401454 | 304 |
| 275 | 3300025914 | Ga0207671_10002825 | Ga0207671_1000282512 | 304 |
| 276 | 3300025917 | Ga0207660_10005412 | Ga0207660_100054129 | 304 |
| 277 | 3300025918 | Ga0207662_10002070 | Ga0207662_100020707 | 304 |
| 278 | 3300025921 | Ga0207652_10000200 | Ga0207652_1000020043 | 304 |
| 279 | 3300025926 | Ga0207659_10101139 | Ga0207659_101011392 | 304 |
| 280 | 3300025927 | Ga0207687_10332644 | Ga0207687_103326441 | 304 |
| 281 | 3300025933 | Ga0207706_10047044 | Ga0207706_100470444 | 304 |
| 282 | 3300025934 | Ga0207686_10004309 | Ga0207686_100043097 | 304 |
| 283 | 3300025935 | Ga0207709_10328417 | Ga0207709_103284171 | 304 |
| 284 | 3300025936 | Ga0207670_10003565 | Ga0207670_100035656 | 304 |
| 285 | 3300025938 | Ga0207704_10414695 | Ga0207704_104146951 | 304 |
| 286 | 3300025940 | Ga0207691_10004525 | Ga0207691_100045257 | 304 |
| 287 | 3300025941 | Ga0207711_10223436 | Ga0207711_102234361 | 304 |
| 288 | 3300025942 | Ga0207689_10007593 | Ga0207689_100075937 | 304 |
| 289 | 3300025961 | Ga0207712_10008758 | Ga0207712_100087581 | 304 |
| 290 | 3300025961 | Ga0207712_10040329 | Ga0207712_100403292 | 304 |
| 291 | 3300026035 | Ga0207703_10052913 | Ga0207703_100529134 | 304 |
| 292 | 3300026075 | Ga0207708_10025275 | Ga0207708_100252752 | 304 |
| 293 | 3300026088 | Ga0207641_10010800 | Ga0207641_100108007 | 304 |
| 294 | 3300026088 | Ga0207641_10333702 | Ga0207641_103337022 | 304 |
| 295 | 3300026089 | Ga0207648_10005802 | Ga0207648_1000580213 | 304 |
| 296 | 3300026116 | Ga0207674_10313731 | Ga0207674_103137312 | 304 |
| 297 | 3300026118 | Ga0207675_100002042 | Ga0207675_1000020425 | 304 |
| 298 | 3300026118 | Ga0207675_100075844 | Ga0207675_1000758441 | 304 |
| 299 | 3300026118 | Ga0207675_100281427 | Ga0207675_1002814272 | 304 |
| 300 | 3300027907 | Ga0207428_10041040 | Ga0207428_100410404 | 304 |
| 301 | 3300028380 | Ga0268265_10416207 | Ga0268265_104162072 | 304 |
| 302 | 3300037312 | Ga0395899_0187503 | Ga0395899_0187503_394_1308 | 304 |
| 303 | 3300037418 | Ga0395900_0395689 | Ga0395900_0395689_222_1136 | 304 |
| 304 | 3300038443 | Ga0395901_0098180 | Ga0395901_0098180_401_1315 | 304 |
| 305 | 3300048909 | Ga0496106_0276416 | Ga0496106_0276416_45_968 | 304 |
| 306 | 3300050507 | nmdc:mga05p37_349666_c1 | nmdc:mga05p37_349666_c1_761_1699 | 304 |
| 307 | 3300050507 | nmdc:mga05p37_66358_c1 | nmdc:mga05p37_66358_c1_1611_2525 | 304 |
| 308 | 3300050509 | nmdc:mga0qj67_117513_c1 | nmdc:mga0qj67_117513_c1_1199_2113 | 304 |
| 309 | 3300050510 | nmdc:mga06r32_101691_c1 | nmdc:mga06r32_101691_c1_684_1598 | 304 |
| 310 | 3300050510 | nmdc:mga06r32_38757_c1 | nmdc:mga06r32_38757_c1_2174_3112 | 304 |
| 311 | 3300050511 | nmdc:mga08y16_10496_c1 | nmdc:mga08y16_10496_c1_8020_8934 | 304 |
| 312 | 3300050511 | nmdc:mga08y16_58233_c1 | nmdc:mga08y16_58233_c1_713_1645 | 304 |
| 313 | 3300050512 | nmdc:mga0n895_485263_c1 | nmdc:mga0n895_485263_c1_109_1032 | 304 |
| 314 | 3300050513 | nmdc:mga0rr50_146312_c1 | nmdc:mga0rr50_146312_c1_919_1842 | 304 |
| 315 | 3300050513 | nmdc:mga0rr50_223971_c1 | nmdc:mga0rr50_223971_c1_393_1316 | 304 |
| 316 | 3300050515 | nmdc:mga0a205_17733_c1 | nmdc:mga0a205_17733_c1_102_1025 | 304 |
| 317 | 3300050515 | nmdc:mga0a205_57787_c1 | nmdc:mga0a205_57787_c1_2359_3273 | 304 |
| 318 | 3300053153 | Ga0500616_0002137 | Ga0500616_0002137_7683_8627 | 304 |
| 319 | 3300000532 | CNAas_1000585 | CNAas_10005854 | 305 |
| 320 | 3300002459 | JGI24751J29686_10000008 | JGI24751J29686_1000000866 | 305 |
| 321 | 3300002459 | JGI24751J29686_10000029 | JGI24751J29686_1000002922 | 305 |
| 322 | 3300003203 | JGI25406J46586_10016165 | JGI25406J46586_100161654 | 305 |
| 323 | 3300005288 | Ga0065714_10002184 | Ga0065714_10002184211 | 305 |
| 324 | 3300005289 | Ga0065704_10019236 | Ga0065704_100192362 | 305 |
| 325 | 3300005290 | Ga0065712_10000112 | Ga0065712_10000112165 | 305 |
| 326 | 3300005290 | Ga0065712_10068391 | Ga0065712_100683917 | 305 |
| 327 | 3300005293 | Ga0065715_10001931 | Ga0065715_100019316 | 305 |
| 328 | 3300005293 | Ga0065715_10089752 | Ga0065715_100897522 | 305 |
| 329 | 3300005293 | Ga0065715_10089793 | Ga0065715_100897936 | 305 |
| 330 | 3300005293 | Ga0065715_10093681 | Ga0065715_100936812 | 305 |
| 331 | 3300005293 | Ga0065715_10093762 | Ga0065715_100937625 | 305 |
| 332 | 3300005293 | Ga0065715_10113745 | Ga0065715_101137452 | 305 |
| 333 | 3300005293 | Ga0065715_10180225 | Ga0065715_101802252 | 305 |
| 334 | 3300005293 | Ga0065715_10185231 | Ga0065715_101852312 | 305 |
| 335 | 3300005293 | Ga0065715_10315577 | Ga0065715_103155771 | 305 |
| 336 | 3300005330 | Ga0070690_100244678 | Ga0070690_1002446782 | 305 |
| 337 | 3300005331 | Ga0070670_100000136 | Ga0070670_10000013665 | 305 |
| 338 | 3300005331 | Ga0070670_100000441 | Ga0070670_10000044116 | 305 |
| 339 | 3300005331 | Ga0070670_100390381 | Ga0070670_1003903811 | 305 |
| 340 | 3300005334 | Ga0068869_100015469 | Ga0068869_1000154696 | 305 |
| 341 | 3300005334 | Ga0068869_100020343 | Ga0068869_1000203431 | 305 |
| 342 | 3300005334 | Ga0068869_100115062 | Ga0068869_1001150623 | 305 |
| 343 | 3300005334 | Ga0068869_100270294 | Ga0068869_1002702941 | 305 |
| 344 | 3300005335 | Ga0070666_10016258 | Ga0070666_100162585 | 305 |
| 345 | 3300005336 | Ga0070680_100089143 | Ga0070680_1000891433 | 305 |
| 346 | 3300005336 | Ga0070680_100126791 | Ga0070680_1001267911 | 305 |
| 347 | 3300005337 | Ga0070682_100000524 | Ga0070682_1000005245 | 305 |
| 348 | 3300005340 | Ga0070689_100078063 | Ga0070689_1000780633 | 305 |
| 349 | 3300005344 | Ga0070661_100267260 | Ga0070661_1002672602 | 305 |
| 350 | 3300005345 | Ga0070692_10114106 | Ga0070692_101141062 | 305 |
| 351 | 3300005345 | Ga0070692_10221910 | Ga0070692_102219102 | 305 |
| 352 | 3300005353 | Ga0070669_100018464 | Ga0070669_1000184646 | 305 |
| 353 | 3300005353 | Ga0070669_100022032 | Ga0070669_1000220322 | 305 |
| 354 | 3300005354 | Ga0070675_100205132 | Ga0070675_1002051323 | 305 |
| 355 | 3300005355 | Ga0070671_100004945 | Ga0070671_1000049457 | 305 |
| 356 | 3300005355 | Ga0070671_100031819 | Ga0070671_1000318193 | 305 |
| 357 | 3300005355 | Ga0070671_100178039 | Ga0070671_1001780392 | 305 |
| 358 | 3300005356 | Ga0070674_100112801 | Ga0070674_1001128012 | 305 |
| 359 | 3300005364 | Ga0070673_100052782 | Ga0070673_1000527822 | 305 |
| 360 | 3300005364 | Ga0070673_100083508 | Ga0070673_1000835082 | 305 |
| 361 | 3300005367 | Ga0070667_100015290 | Ga0070667_1000152905 | 305 |
| 362 | 3300005440 | Ga0070705_100277560 | Ga0070705_1002775601 | 305 |
| 363 | 3300005441 | Ga0070700_100005818 | Ga0070700_1000058184 | 305 |
| 364 | 3300005441 | Ga0070700_100011361 | Ga0070700_1000113614 | 305 |
| 365 | 3300005441 | Ga0070700_100230486 | Ga0070700_1002304862 | 305 |
| 366 | 3300005444 | Ga0070694_100023245 | Ga0070694_1000232454 | 305 |
| 367 | 3300005444 | Ga0070694_100135931 | Ga0070694_1001359312 | 305 |
| 368 | 3300005445 | Ga0070708_100000455 | Ga0070708_10000045523 | 305 |
| 369 | 3300005445 | Ga0070708_100036694 | Ga0070708_1000366944 | 305 |
| 370 | 3300005457 | Ga0070662_100127195 | Ga0070662_1001271952 | 305 |
| 371 | 3300005458 | Ga0070681_10040975 | Ga0070681_100409753 | 305 |
| 372 | 3300005458 | Ga0070681_10092442 | Ga0070681_100924423 | 305 |
| 373 | 3300005459 | Ga0068867_100032828 | Ga0068867_1000328284 | 305 |
| 374 | 3300005459 | Ga0068867_100154345 | Ga0068867_1001543451 | 305 |
| 375 | 3300005459 | Ga0068867_100205392 | Ga0068867_1002053922 | 305 |
| 376 | 3300005467 | Ga0070706_100113050 | Ga0070706_1001130502 | 305 |
| 377 | 3300005468 | Ga0070707_100089645 | Ga0070707_1000896452 | 305 |
| 378 | 3300005471 | Ga0070698_100000720 | Ga0070698_1000007208 | 305 |
| 379 | 3300005471 | Ga0070698_100011587 | Ga0070698_1000115878 | 305 |
| 380 | 3300005471 | Ga0070698_100016323 | Ga0070698_1000163232 | 305 |
| 381 | 3300005471 | Ga0070698_100101515 | Ga0070698_1001015152 | 305 |
| 382 | 3300005518 | Ga0070699_100000488 | Ga0070699_10000048831 | 305 |
| 383 | 3300005518 | Ga0070699_100002881 | Ga0070699_1000028815 | 305 |
| 384 | 3300005518 | Ga0070699_100012643 | Ga0070699_1000126434 | 305 |
| 385 | 3300005518 | Ga0070699_100023012 | Ga0070699_1000230123 | 305 |
| 386 | 3300005535 | Ga0070684_100176076 | Ga0070684_1001760762 | 305 |
| 387 | 3300005536 | Ga0070697_100000109 | Ga0070697_10000010924 | 305 |
| 388 | 3300005536 | Ga0070697_100001352 | Ga0070697_1000013528 | 305 |
| 389 | 3300005536 | Ga0070697_100070341 | Ga0070697_1000703412 | 305 |
| 390 | 3300005536 | Ga0070697_100182072 | Ga0070697_1001820722 | 305 |
| 391 | 3300005536 | Ga0070697_100203505 | Ga0070697_1002035051 | 305 |
| 392 | 3300005536 | Ga0070697_100459993 | Ga0070697_1004599931 | 305 |
| 393 | 3300005539 | Ga0068853_100010391 | Ga0068853_1000103911 | 305 |
| 394 | 3300005539 | Ga0068853_100019109 | Ga0068853_1000191093 | 305 |
| 395 | 3300005539 | Ga0068853_100252337 | Ga0068853_1002523372 | 305 |
| 396 | 3300005544 | Ga0070686_100029278 | Ga0070686_1000292784 | 305 |
| 397 | 3300005545 | Ga0070695_100023861 | Ga0070695_1000238613 | 305 |
| 398 | 3300005546 | Ga0070696_100036894 | Ga0070696_1000368943 | 305 |
| 399 | 3300005546 | Ga0070696_100059260 | Ga0070696_1000592603 | 305 |
| 400 | 3300005546 | Ga0070696_100248563 | Ga0070696_1002485631 | 305 |
| 401 | 3300005547 | Ga0070693_100004270 | Ga0070693_1000042705 | 305 |
| 402 | 3300005547 | Ga0070693_100019333 | Ga0070693_1000193332 | 305 |
| 403 | 3300005547 | Ga0070693_100028367 | Ga0070693_1000283672 | 305 |
| 404 | 3300005548 | Ga0070665_100093974 | Ga0070665_1000939742 | 305 |
| 405 | 3300005549 | Ga0070704_100052511 | Ga0070704_1000525113 | 305 |
| 406 | 3300005549 | Ga0070704_100092917 | Ga0070704_1000929173 | 305 |
| 407 | 3300005549 | Ga0070704_100134084 | Ga0070704_1001340842 | 305 |
| 408 | 3300005549 | Ga0070704_100441549 | Ga0070704_1004415491 | 305 |
| 409 | 3300005563 | Ga0068855_100047483 | Ga0068855_1000474834 | 305 |
| 410 | 3300005564 | Ga0070664_100014093 | Ga0070664_1000140933 | 305 |
| 411 | 3300005564 | Ga0070664_100023076 | Ga0070664_1000230764 | 305 |
| 412 | 3300005564 | Ga0070664_100158886 | Ga0070664_1001588862 | 305 |
| 413 | 3300005577 | Ga0068857_100070475 | Ga0068857_1000704752 | 305 |
| 414 | 3300005577 | Ga0068857_100143019 | Ga0068857_1001430191 | 305 |
| 415 | 3300005578 | Ga0068854_100132244 | Ga0068854_1001322442 | 305 |
| 416 | 3300005615 | Ga0070702_100079975 | Ga0070702_1000799751 | 305 |
| 417 | 3300005615 | Ga0070702_100107582 | Ga0070702_1001075821 | 305 |
| 418 | 3300005616 | Ga0068852_100121870 | Ga0068852_1001218703 | 305 |
| 419 | 3300005616 | Ga0068852_100414802 | Ga0068852_1004148021 | 305 |
| 420 | 3300005617 | Ga0068859_100006153 | Ga0068859_1000061535 | 305 |
| 421 | 3300005617 | Ga0068859_100067200 | Ga0068859_1000672002 | 305 |
| 422 | 3300005617 | Ga0068859_100076653 | Ga0068859_1000766532 | 305 |
| 423 | 3300005617 | Ga0068859_100223522 | Ga0068859_1002235221 | 305 |
| 424 | 3300005617 | Ga0068859_100302110 | Ga0068859_1003021102 | 305 |
| 425 | 3300005617 | Ga0068859_100435480 | Ga0068859_1004354801 | 305 |
| 426 | 3300005617 | Ga0068859_100621561 | Ga0068859_1006215611 | 305 |
| 427 | 3300005618 | Ga0068864_100000679 | Ga0068864_10000067923 | 305 |
| 428 | 3300005618 | Ga0068864_100004285 | Ga0068864_1000042855 | 305 |
| 429 | 3300005618 | Ga0068864_100077115 | Ga0068864_1000771153 | 305 |
| 430 | 3300005618 | Ga0068864_100165773 | Ga0068864_1001657732 | 305 |
| 431 | 3300005618 | Ga0068864_100339290 | Ga0068864_1003392903 | 305 |
| 432 | 3300005618 | Ga0068864_100400909 | Ga0068864_1004009092 | 305 |
| 433 | 3300005718 | Ga0068866_10011197 | Ga0068866_100111973 | 305 |
| 434 | 3300005719 | Ga0068861_100037071 | Ga0068861_1000370716 | 305 |
| 435 | 3300005719 | Ga0068861_100062314 | Ga0068861_1000623142 | 305 |
| 436 | 3300005719 | Ga0068861_100299333 | Ga0068861_1002993331 | 305 |
| 437 | 3300005834 | Ga0068851_10191516 | Ga0068851_101915162 | 305 |
| 438 | 3300005841 | Ga0068863_100052139 | Ga0068863_1000521391 | 305 |
| 439 | 3300005841 | Ga0068863_100140903 | Ga0068863_1001409031 | 305 |
| 440 | 3300005841 | Ga0068863_100193495 | Ga0068863_1001934951 | 305 |
| 441 | 3300005842 | Ga0068858_100036159 | Ga0068858_1000361595 | 305 |
| 442 | 3300005842 | Ga0068858_100075620 | Ga0068858_1000756202 | 305 |
| 443 | 3300005843 | Ga0068860_100057419 | Ga0068860_1000574195 | 305 |
| 444 | 3300005843 | Ga0068860_100063230 | Ga0068860_1000632303 | 305 |
| 445 | 3300005843 | Ga0068860_100100867 | Ga0068860_1001008673 | 305 |
| 446 | 3300005844 | Ga0068862_100024435 | Ga0068862_1000244354 | 305 |
| 447 | 3300005983 | Ga0081540_1039264 | Ga0081540_10392642 | 305 |
| 448 | 3300005985 | Ga0081539_10000697 | Ga0081539_1000069713 | 305 |
| 449 | 3300006237 | Ga0097621_100001606 | Ga0097621_1000016068 | 305 |
| 450 | 3300006237 | Ga0097621_100004434 | Ga0097621_1000044343 | 305 |
| 451 | 3300006358 | Ga0068871_100006452 | Ga0068871_1000064526 | 305 |
| 452 | 3300006358 | Ga0068871_100026456 | Ga0068871_1000264564 | 305 |
| 453 | 3300006847 | Ga0075431_100074007 | Ga0075431_1000740074 | 305 |
| 454 | 3300006852 | Ga0075433_10009221 | Ga0075433_100092212 | 305 |
| 455 | 3300006871 | Ga0075434_100009348 | Ga0075434_1000093482 | 305 |
| 456 | 3300006871 | Ga0075434_100252334 | Ga0075434_1002523342 | 305 |
| 457 | 3300006880 | Ga0075429_100226734 | Ga0075429_1002267342 | 305 |
| 458 | 3300006931 | Ga0097620_100006152 | Ga0097620_10000615211 | 305 |
| 459 | 3300006931 | Ga0097620_100067198 | Ga0097620_1000671982 | 305 |
| 460 | 3300006931 | Ga0097620_100076660 | Ga0097620_1000766603 | 305 |
| 461 | 3300006931 | Ga0097620_100223541 | Ga0097620_1002235411 | 305 |
| 462 | 3300006931 | Ga0097620_100302115 | Ga0097620_1003021152 | 305 |
| 463 | 3300006931 | Ga0097620_100435479 | Ga0097620_1004354791 | 305 |
| 464 | 3300006931 | Ga0097620_100621548 | Ga0097620_1006215481 | 305 |
| 465 | 3300007076 | Ga0075435_100023341 | Ga0075435_1000233411 | 305 |
| 466 | 3300009011 | Ga0105251_10074341 | Ga0105251_100743412 | 305 |
| 467 | 3300009093 | Ga0105240_10279215 | Ga0105240_102792152 | 305 |
| 468 | 3300009094 | Ga0111539_10095139 | Ga0111539_100951392 | 305 |
| 469 | 3300009094 | Ga0111539_10158626 | Ga0111539_101586262 | 305 |
| 470 | 3300009094 | Ga0111539_10196967 | Ga0111539_101969673 | 305 |
| 471 | 3300009101 | Ga0105247_10004251 | Ga0105247_100042513 | 305 |
| 472 | 3300009101 | Ga0105247_10062449 | Ga0105247_100624492 | 305 |
| 473 | 3300009147 | Ga0114129_10003197 | Ga0114129_1000319718 | 305 |
| 474 | 3300009147 | Ga0114129_10028380 | Ga0114129_100283803 | 305 |
| 475 | 3300009147 | Ga0114129_10114835 | Ga0114129_101148353 | 305 |
| 476 | 3300009147 | Ga0114129_10431576 | Ga0114129_104315762 | 305 |
| 477 | 3300009147 | Ga0114129_10581003 | Ga0114129_105810032 | 305 |
| 478 | 3300009148 | Ga0105243_10006485 | Ga0105243_1000648510 | 305 |
| 479 | 3300009148 | Ga0105243_10132854 | Ga0105243_101328541 | 305 |
| 480 | 3300009174 | Ga0105241_10042086 | Ga0105241_100420865 | 305 |
| 481 | 3300009174 | Ga0105241_10057362 | Ga0105241_100573622 | 305 |
| 482 | 3300009174 | Ga0105241_10392324 | Ga0105241_103923242 | 305 |
| 483 | 3300009174 | Ga0105241_10447275 | Ga0105241_104472751 | 305 |
| 484 | 3300009176 | Ga0105242_10041696 | Ga0105242_100416963 | 305 |
| 485 | 3300009176 | Ga0105242_10374475 | Ga0105242_103744752 | 305 |
| 486 | 3300009177 | Ga0105248_10009745 | Ga0105248_100097457 | 305 |
| 487 | 3300009177 | Ga0105248_10029526 | Ga0105248_100295262 | 305 |
| 488 | 3300009177 | Ga0105248_10032794 | Ga0105248_100327945 | 305 |
| 489 | 3300009177 | Ga0105248_10054605 | Ga0105248_100546056 | 305 |
| 490 | 3300009177 | Ga0105248_10383283 | Ga0105248_103832832 | 305 |
| 491 | 3300009545 | Ga0105237_10031278 | Ga0105237_100312782 | 305 |
| 492 | 3300009545 | Ga0105237_10134931 | Ga0105237_101349313 | 305 |
| 493 | 3300009545 | Ga0105237_10722213 | Ga0105237_107222131 | 305 |
| 494 | 3300009551 | Ga0105238_10017007 | Ga0105238_100170076 | 305 |
| 495 | 3300009551 | Ga0105238_10021171 | Ga0105238_100211717 | 305 |
| 496 | 3300009553 | Ga0105249_10048917 | Ga0105249_100489172 | 305 |
| 497 | 3300009553 | Ga0105249_10094571 | Ga0105249_100945713 | 305 |
| 498 | 3300009553 | Ga0105249_10202012 | Ga0105249_102020122 | 305 |
| 499 | 3300009553 | Ga0105249_10205214 | Ga0105249_102052142 | 305 |
| 500 | 3300010375 | Ga0105239_10495885 | Ga0105239_104958851 | 305 |
| 501 | 3300011119 | Ga0105246_10036695 | Ga0105246_100366953 | 305 |
| 502 | 3300013100 | Ga0157373_10022534 | Ga0157373_100225343 | 305 |
| 503 | 3300013100 | Ga0157373_10099466 | Ga0157373_100994662 | 305 |
| 504 | 3300013100 | Ga0157373_10172593 | Ga0157373_101725931 | 305 |
| 505 | 3300013105 | Ga0157369_10195986 | Ga0157369_101959862 | 305 |
| 506 | 3300013105 | Ga0157369_10250896 | Ga0157369_102508962 | 305 |
| 507 | 3300013296 | Ga0157374_10005684 | Ga0157374_100056847 | 305 |
| 508 | 3300013296 | Ga0157374_10417297 | Ga0157374_104172972 | 305 |
| 509 | 3300013297 | Ga0157378_10000681 | Ga0157378_1000068123 | 305 |
| 510 | 3300013297 | Ga0157378_10012967 | Ga0157378_100129677 | 305 |
| 511 | 3300013297 | Ga0157378_10041373 | Ga0157378_100413734 | 305 |
| 512 | 3300013297 | Ga0157378_10045113 | Ga0157378_100451134 | 305 |
| 513 | 3300013297 | Ga0157378_10049614 | Ga0157378_100496143 | 305 |
| 514 | 3300013306 | Ga0163162_10000966 | Ga0163162_100009669 | 305 |
| 515 | 3300013306 | Ga0163162_10016251 | Ga0163162_100162512 | 305 |
| 516 | 3300013306 | Ga0163162_10066061 | Ga0163162_100660613 | 305 |
| 517 | 3300013306 | Ga0163162_10362899 | Ga0163162_103628991 | 305 |
| 518 | 3300013308 | Ga0157375_10005745 | Ga0157375_1000574511 | 305 |
| 519 | 3300013308 | Ga0157375_10005943 | Ga0157375_1000594311 | 305 |
| 520 | 3300013308 | Ga0157375_10085500 | Ga0157375_100855002 | 305 |
| 521 | 3300013308 | Ga0157375_10125224 | Ga0157375_101252242 | 305 |
| 522 | 3300013308 | Ga0157375_10593436 | Ga0157375_105934362 | 305 |
| 523 | 3300014325 | Ga0163163_10002791 | Ga0163163_1000279112 | 305 |
| 524 | 3300014325 | Ga0163163_10003423 | Ga0163163_100034236 | 305 |
| 525 | 3300014325 | Ga0163163_10006276 | Ga0163163_100062762 | 305 |
| 526 | 3300014325 | Ga0163163_10006974 | Ga0163163_100069749 | 305 |
| 527 | 3300014325 | Ga0163163_10007025 | Ga0163163_100070256 | 305 |
| 528 | 3300014325 | Ga0163163_10057894 | Ga0163163_100578943 | 305 |
| 529 | 3300014326 | Ga0157380_10001155 | Ga0157380_1000115512 | 305 |
| 530 | 3300014326 | Ga0157380_10001325 | Ga0157380_100013259 | 305 |
| 531 | 3300014745 | Ga0157377_10061326 | Ga0157377_100613263 | 305 |
| 532 | 3300014969 | Ga0157376_10091970 | Ga0157376_100919702 | 305 |
| 533 | 3300015261 | Ga0182006_1082602 | Ga0182006_10826022 | 305 |
| 534 | 3300025900 | Ga0207710_10000370 | Ga0207710_100003702 | 305 |
| 535 | 3300025903 | Ga0207680_10009612 | Ga0207680_100096125 | 305 |
| 536 | 3300025904 | Ga0207647_10018148 | Ga0207647_100181481 | 305 |
| 537 | 3300025908 | Ga0207643_10004644 | Ga0207643_100046441 | 305 |
| 538 | 3300025910 | Ga0207684_10052985 | Ga0207684_100529852 | 305 |
| 539 | 3300025910 | Ga0207684_10059965 | Ga0207684_100599652 | 305 |
| 540 | 3300025910 | Ga0207684_10209815 | Ga0207684_102098152 | 305 |
| 541 | 3300025911 | Ga0207654_10046572 | Ga0207654_100465722 | 305 |
| 542 | 3300025912 | Ga0207707_10016470 | Ga0207707_100164705 | 305 |
| 543 | 3300025912 | Ga0207707_10265252 | Ga0207707_102652522 | 305 |
| 544 | 3300025913 | Ga0207695_10245840 | Ga0207695_102458402 | 305 |
| 545 | 3300025917 | Ga0207660_10103717 | Ga0207660_101037173 | 305 |
| 546 | 3300025918 | Ga0207662_10030622 | Ga0207662_100306223 | 305 |
| 547 | 3300025923 | Ga0207681_10000872 | Ga0207681_100008727 | 305 |
| 548 | 3300025923 | Ga0207681_10033469 | Ga0207681_100334692 | 305 |
| 549 | 3300025923 | Ga0207681_10109339 | Ga0207681_101093392 | 305 |
| 550 | 3300025924 | Ga0207694_10007325 | Ga0207694_100073257 | 305 |
| 551 | 3300025924 | Ga0207694_10025798 | Ga0207694_100257984 | 305 |
| 552 | 3300025925 | Ga0207650_10000087 | Ga0207650_1000008723 | 305 |
| 553 | 3300025925 | Ga0207650_10188201 | Ga0207650_101882011 | 305 |
| 554 | 3300025925 | Ga0207650_10199803 | Ga0207650_101998032 | 305 |
| 555 | 3300025931 | Ga0207644_10010626 | Ga0207644_100106265 | 305 |
| 556 | 3300025931 | Ga0207644_10052688 | Ga0207644_100526882 | 305 |
| 557 | 3300025933 | Ga0207706_10044507 | Ga0207706_100445073 | 305 |
| 558 | 3300025934 | Ga0207686_10181941 | Ga0207686_101819412 | 305 |
| 559 | 3300025935 | Ga0207709_10119984 | Ga0207709_101199842 | 305 |
| 560 | 3300025936 | Ga0207670_10134648 | Ga0207670_101346481 | 305 |
| 561 | 3300025936 | Ga0207670_10348260 | Ga0207670_103482601 | 305 |
| 562 | 3300025940 | Ga0207691_10058065 | Ga0207691_100580652 | 305 |
| 563 | 3300025941 | Ga0207711_10006798 | Ga0207711_100067987 | 305 |
| 564 | 3300025941 | Ga0207711_10013320 | Ga0207711_100133203 | 305 |
| 565 | 3300025941 | Ga0207711_10104501 | Ga0207711_101045014 | 305 |
| 566 | 3300025941 | Ga0207711_10165419 | Ga0207711_101654192 | 305 |
| 567 | 3300025942 | Ga0207689_10002058 | Ga0207689_100020587 | 305 |
| 568 | 3300025942 | Ga0207689_10007728 | Ga0207689_100077287 | 305 |
| 569 | 3300025942 | Ga0207689_10092042 | Ga0207689_100920422 | 305 |
| 570 | 3300025945 | Ga0207679_10027488 | Ga0207679_100274884 | 305 |
| 571 | 3300025945 | Ga0207679_10046674 | Ga0207679_100466742 | 305 |
| 572 | 3300025960 | Ga0207651_10054061 | Ga0207651_100540613 | 305 |
| 573 | 3300025960 | Ga0207651_10066809 | Ga0207651_100668092 | 305 |
| 574 | 3300025961 | Ga0207712_10003498 | Ga0207712_100034987 | 305 |
| 575 | 3300025961 | Ga0207712_10023976 | Ga0207712_100239762 | 305 |
| 576 | 3300025961 | Ga0207712_10049886 | Ga0207712_100498863 | 305 |
| 577 | 3300025981 | Ga0207640_10113978 | Ga0207640_101139782 | 305 |
| 578 | 3300025986 | Ga0207658_10028514 | Ga0207658_100285143 | 305 |
| 579 | 3300026035 | Ga0207703_10141359 | Ga0207703_101413591 | 305 |
| 580 | 3300026041 | Ga0207639_10040920 | Ga0207639_100409203 | 305 |
| 581 | 3300026041 | Ga0207639_10200776 | Ga0207639_102007762 | 305 |
| 582 | 3300026041 | Ga0207639_10202016 | Ga0207639_102020162 | 305 |
| 583 | 3300026075 | Ga0207708_10000407 | Ga0207708_1000040723 | 305 |
| 584 | 3300026075 | Ga0207708_10010363 | Ga0207708_100103633 | 305 |
| 585 | 3300026075 | Ga0207708_10012137 | Ga0207708_100121374 | 305 |
| 586 | 3300026075 | Ga0207708_10021808 | Ga0207708_100218085 | 305 |
| 587 | 3300026075 | Ga0207708_10083376 | Ga0207708_100833762 | 305 |
| 588 | 3300026088 | Ga0207641_10051036 | Ga0207641_100510361 | 305 |
| 589 | 3300026089 | Ga0207648_10095943 | Ga0207648_100959433 | 305 |
| 590 | 3300026095 | Ga0207676_10002568 | Ga0207676_100025685 | 305 |
| 591 | 3300026095 | Ga0207676_10004535 | Ga0207676_100045358 | 305 |
| 592 | 3300026095 | Ga0207676_10009479 | Ga0207676_100094797 | 305 |
| 593 | 3300026095 | Ga0207676_10085531 | Ga0207676_100855313 | 305 |
| 594 | 3300026095 | Ga0207676_10122650 | Ga0207676_101226502 | 305 |
| 595 | 3300026116 | Ga0207674_10012317 | Ga0207674_100123175 | 305 |
| 596 | 3300026116 | Ga0207674_10041671 | Ga0207674_100416713 | 305 |
| 597 | 3300026116 | Ga0207674_10061516 | Ga0207674_100615162 | 305 |
| 598 | 3300026116 | Ga0207674_10068741 | Ga0207674_100687414 | 305 |
| 599 | 3300026116 | Ga0207674_10120625 | Ga0207674_101206253 | 305 |
| 600 | 3300026116 | Ga0207674_10190838 | Ga0207674_101908381 | 305 |
| 601 | 3300026116 | Ga0207674_10611602 | Ga0207674_106116021 | 305 |
| 602 | 3300026118 | Ga0207675_100039293 | Ga0207675_1000392932 | 305 |
| 603 | 3300026118 | Ga0207675_100051034 | Ga0207675_1000510343 | 305 |
| 604 | 3300026118 | Ga0207675_100445826 | Ga0207675_1004458262 | 305 |
| 605 | 3300026118 | Ga0207675_100577069 | Ga0207675_1005770691 | 305 |
| 606 | 3300026142 | Ga0207698_10068472 | Ga0207698_100684723 | 305 |
| 607 | 3300026142 | Ga0207698_10213061 | Ga0207698_102130612 | 305 |
| 608 | 3300027907 | Ga0207428_10199752 | Ga0207428_101997522 | 305 |
| 609 | 3300027907 | Ga0207428_10223282 | Ga0207428_102232822 | 305 |
| 610 | 3300028379 | Ga0268266_10065961 | Ga0268266_100659613 | 305 |
| 611 | 3300028380 | Ga0268265_10007156 | Ga0268265_100071565 | 305 |
| 612 | 3300028381 | Ga0268264_10061047 | Ga0268264_100610471 | 305 |
| 613 | 3300028381 | Ga0268264_10084447 | Ga0268264_100844472 | 305 |
| 614 | 3300028381 | Ga0268264_10090291 | Ga0268264_100902911 | 305 |
| 615 | 3300028381 | Ga0268264_10181311 | Ga0268264_101813112 | 305 |
| 616 | 3300028381 | Ga0268264_10404931 | Ga0268264_104049312 | 305 |
| 617 | 3300031456 | Ga0307513_10352076 | Ga0307513_103520762 | 305 |
| 618 | 3300031548 | Ga0307408_100037038 | Ga0307408_1000370382 | 305 |
| 619 | 3300031548 | Ga0307408_100292577 | Ga0307408_1002925772 | 305 |
| 620 | 3300031731 | Ga0307405_10096769 | Ga0307405_100967693 | 305 |
| 621 | 3300031824 | Ga0307413_10043237 | Ga0307413_100432372 | 305 |
| 622 | 3300031901 | Ga0307406_10005217 | Ga0307406_100052173 | 305 |
| 623 | 3300031995 | Ga0307409_100171547 | Ga0307409_1001715472 | 305 |
| 624 | 3300031995 | Ga0307409_100313145 | Ga0307409_1003131452 | 305 |
| 625 | 3300032002 | Ga0307416_100030004 | Ga0307416_1000300045 | 305 |
| 626 | 3300032002 | Ga0307416_100193296 | Ga0307416_1001932962 | 305 |
| 627 | 3300032004 | Ga0307414_10043925 | Ga0307414_100439252 | 305 |
| 628 | 3300032005 | Ga0307411_10067010 | Ga0307411_100670101 | 305 |
| 629 | 3300035088 | Ga0373940_0022120 | Ga0373940_0022120_173_1090 | 305 |
| 630 | 3300035091 | Ga0373951_0013750 | Ga0373951_0013750_620_1537 | 305 |
| 631 | 3300035115 | Ga0373941_0036489 | Ga0373941_0036489_353_1270 | 305 |
| 632 | 3300035170 | Ga0373943_0039383 | Ga0373943_0039383_1060_1995 | 305 |
| 633 | 3300037312 | Ga0395899_0349302 | Ga0395899_0349302_58_975 | 305 |
| 634 | 3300038443 | Ga0395901_0166555 | Ga0395901_0166555_276_1193 | 305 |
| 635 | 3300038443 | Ga0395901_0200318 | Ga0395901_0200318_1028_1984 | 305 |
| 636 | 3300038443 | Ga0395901_0213496 | Ga0395901_0213496_636_1553 | 305 |
| 637 | 3300038996 | Ga0242420_000152 | Ga0242420_000152_1984_2901 | 305 |
| 638 | 3300042012 | Ga0439455_0015858 | Ga0439455_0015858_81_998 | 305 |
| 639 | 3300042157 | Ga0439458_0004779 | Ga0439458_0004779_1080_1997 | 305 |
| 640 | 3300045051 | Ga0451576_0766432 | Ga0451576_0766432_78_995 | 305 |
| 641 | 3300046512 | Ga0495610_0118227 | Ga0495610_0118227_70_1029 | 305 |
| 642 | 3300046616 | Ga0495668_0063944 | Ga0495668_0063944_839_1798 | 305 |
| 643 | 3300046684 | Ga0495669_0166001 | Ga0495669_0166001_78_1025 | 305 |
| 644 | 3300047320 | Ga0495672_0052790 | Ga0495672_0052790_449_1399 | 305 |
| 645 | 3300048911 | Ga0496108_0131514 | Ga0496108_0131514_755_1672 | 305 |
| 646 | 3300048915 | Ga0496112_0540299 | Ga0496112_0540299_11_928 | 305 |
| 647 | 3300049514 | Ga0501291_000942 | Ga0501291_000942_2093_3013 | 305 |
| 648 | 3300049574 | Ga0501038_0070356 | Ga0501038_0070356_1806_2723 | 305 |
| 649 | 3300049649 | Ga0501198_003004 | Ga0501198_003004_10_927 | 305 |
| 650 | 3300049661 | Ga0501217_004334 | Ga0501217_004334_1783_2700 | 305 |
| 651 | 3300049663 | Ga0501223_003083 | Ga0501223_003083_27_944 | 305 |
| 652 | 3300049668 | Ga0501233_004661 | Ga0501233_004661_973_1893 | 305 |
| 653 | 3300049668 | Ga0501233_011994 | Ga0501233_011994_532_1449 | 305 |
| 654 | 3300049686 | Ga0501257_046456 | Ga0501257_046456_129_1049 | 305 |
| 655 | 3300049705 | Ga0501225_0003210 | Ga0501225_0003210_3841_4758 | 305 |
| 656 | 3300049707 | Ga0501234_002615 | Ga0501234_002615_1907_2824 | 305 |
| 657 | 3300049707 | Ga0501234_003422 | Ga0501234_003422_1151_2068 | 305 |
| 658 | 3300049765 | Ga0501268_010912 | Ga0501268_010912_75_995 | 305 |
| 659 | 3300049853 | Ga0501226_002652 | Ga0501226_002652_780_1697 | 305 |
| 660 | 3300050507 | nmdc:mga05p37_125154_c1 | nmdc:mga05p37_125154_c1_751_1680 | 305 |
| 661 | 3300050507 | nmdc:mga05p37_168938_c1 | nmdc:mga05p37_168938_c1_115_1041 | 305 |
| 662 | 3300050508 | nmdc:mga09592_211972_c1 | nmdc:mga09592_211972_c1_239_1156 | 305 |
| 663 | 3300050510 | nmdc:mga06r32_376222_c1 | nmdc:mga06r32_376222_c1_343_1260 | 305 |
| 664 | 3300050511 | nmdc:mga08y16_104215_c1 | nmdc:mga08y16_104215_c1_1944_2882 | 305 |
| 665 | 3300050511 | nmdc:mga08y16_1574_c1 | nmdc:mga08y16_1574_c1_10817_11734 | 305 |
| 666 | 3300050511 | nmdc:mga08y16_263690_c1 | nmdc:mga08y16_263690_c1_657_1604 | 305 |
| 667 | 3300050512 | nmdc:mga0n895_61474_c1 | nmdc:mga0n895_61474_c1_1354_2271 | 305 |
| 668 | 3300050513 | nmdc:mga0rr50_27553_c1 | nmdc:mga0rr50_27553_c1_48_965 | 305 |
| 669 | 3300050515 | nmdc:mga0a205_89118_c1 | nmdc:mga0a205_89118_c1_771_1697 | 305 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8eop-assembly1.cif.gz_A | cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state | 0.9256 | 2 | 227 |
| 1l2t-assembly1.cif.gz_B | dimeric structure of mj0796, a bacterial abc transporter cassette | 0.9149 | 4 | 224 |
| 3tif-assembly1.cif.gz_B | dimeric structure of a post-hydrolysis state of the atp-binding cassette mj0796 bound to adp and pi | 0.9088 | 4 | 224 |
| 7dd0-assembly1.cif.gz_C | crystal structure of the n-terminal domain of tagh from bacillus subtilis | 0.9081 | 2 | 227 |
| 7ahd-assembly1.cif.gz_D | opua (e190q) occluded | 0.9062 | 4 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9XW49_1237_1482_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9456 | 2 | 230 | 3.40.50.300 |
| af_A0A0R0KIK5_1390_1640_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9408 | 2 | 228 | 3.40.50.300 |
| af_A4HV32_726_961_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9406 | 2 | 231 | 3.40.50.300 |
| af_P78363_1926_2175_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9399 | 2 | 228 | 3.40.50.300 |
| af_Q555Z5_479_734_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9383 | 1 | 228 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1D2R6P7-F1-model_v4 | ABC transporter domain-containing protein | 0.9461 | 4 | 228 |
GO:0005524
GO:0016887 |
| AF-A0A7C6CAI4-F1-model_v4 | ABC transporter ATP-binding protein | 0.9449 | 1 | 227 |
GO:0005524
GO:0016887 |
| AF-A0A2E7MAK6-F1-model_v4 | 3-dehydroquinate dehydratase | 0.9385 | 4 | 228 |
GO:0005524
GO:0016887 |
| AF-I0HK58-F1-model_v4 | Sodium ABC transporter ATP-binding protein NatA | 0.9382 | 4 | 228 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A7W7BQI4-F1-model_v4 | ABC-2 type transport system ATP-binding protein | 0.9364 | 1 | 228 |
GO:0005524
GO:0016887 GO:0046677 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar