F474032

General Info

Members Datasets Scaffolds Average Seq Length
669 231 669 308

Family's Representative Sequence

Representative Sequence 3300046525|Ga0495663_0000285|Ga0495663_0000285_9903_10862
Length 307
Sequence MTSPNLSTNGNTSVIEIDKLTKDYDVGFWRKRKVRALDGLSLSVQQGEIFGFLGANGAGKTTTLKLLMRLIFPTDGSARILGHDIMDVSMHNRIGYLPENPYFYDYLTAREFLNFCGQIFGLSNATRDSRSRALLRRVGLDESKWNTQLRKFALVNDPEIVFLDEPMSGLDPIGRREVRDLIAGLREEGKTVFMCSHILSDIEVLCDRVAILKGGRLAQVGYLDELRQQVSGKNLVEVMVSGVDETTLAKHLPGETGFQITSTPAGLRIEVSDEKDVDRVLTALRQTTGKLVSVQPLRQSLEELFLN

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
190 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
191 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
192 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
202 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
215 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
216 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
217 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
218 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
221 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
222 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 0.75
Rhizosphere 98.95
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000585 3300000532 Bacteria 3528
2 JGI24748J21848_1000008 3300002074 Bacteria 191483
3 JGI24034J26672_10000002 3300002239 Bacteria 925353
4 JGI24751J29686_10000008 3300002459 Bacteria 128004
5 JGI24751J29686_10000029 3300002459 Bacteria 93445
6 JGI25406J46586_10016165 3300003203 Bacteria 3119
7 Ga0065714_10002184 3300005288 Bacteria 284511
8 Ga0065704_10019236 3300005289 Bacteria 2224
9 Ga0065712_10000112 3300005290 Bacteria 340011
10 Ga0065712_10008051 3300005290 Bacteria 5170
11 Ga0065712_10068391 3300005290 Bacteria 10973
12 Ga0065715_10001931 3300005293 Bacteria 5387
13 Ga0065715_10004857 3300005293 Bacteria 5107
14 Ga0065715_10089752 3300005293 Bacteria 8609
15 Ga0065715_10089793 3300005293 Bacteria 8470
16 Ga0065715_10093681 3300005293 Bacteria 4599
17 Ga0065715_10093762 3300005293 Bacteria 4568
18 Ga0065715_10113745 3300005293 Unclassified 2476
19 Ga0065715_10180225 3300005293 Unclassified 1471
20 Ga0065715_10185231 3300005293 Bacteria 1435
21 Ga0065715_10315577 3300005293 Bacteria 1012
22 Ga0070683_100199655 3300005329 Unclassified 1899
23 Ga0070690_100006141 3300005330 Bacteria 6801
24 Ga0070690_100033794 3300005330 Bacteria 3203
25 Ga0070690_100037139 3300005330 Bacteria 3068
26 Ga0070690_100244678 3300005330 Bacteria 1266
27 Ga0070670_100000136 3300005331 Bacteria 68887
28 Ga0070670_100000441 3300005331 Bacteria 33901
29 Ga0070670_100390381 3300005331 Bacteria 1227
30 Ga0070670_100575419 3300005331 Bacteria 1006
31 Ga0070677_10059292 3300005333 Bacteria 1574
32 Ga0068869_100013796 3300005334 Bacteria 5384
33 Ga0068869_100015469 3300005334 Bacteria 5119
34 Ga0068869_100020343 3300005334 Bacteria 4550
35 Ga0068869_100029552 3300005334 Bacteria 3841
36 Ga0068869_100115062 3300005334 Bacteria 2051
37 Ga0068869_100270294 3300005334 Bacteria 1364
38 Ga0070666_10016258 3300005335 Bacteria 4758
39 Ga0070680_100002480 3300005336 Bacteria 13672
40 Ga0070680_100017225 3300005336 Bacteria 5694
41 Ga0070680_100020003 3300005336 Bacteria 5307
42 Ga0070680_100089143 3300005336 Bacteria 2552
43 Ga0070680_100126791 3300005336 Unclassified 2133
44 Ga0070682_100000524 3300005337 Bacteria 23980
45 Ga0070682_100056989 3300005337 Bacteria 2460
46 Ga0068868_100032331 3300005338 Bacteria 4024
47 Ga0068868_100035851 3300005338 Bacteria 3836
48 Ga0070689_100001207 3300005340 Bacteria 16357
49 Ga0070689_100014111 3300005340 Bacteria 5796
50 Ga0070689_100046434 3300005340 Bacteria 3347
51 Ga0070689_100078063 3300005340 Unclassified 2596
52 Ga0070687_100008800 3300005343 Bacteria 4290
53 Ga0070687_100063555 3300005343 Bacteria 1958
54 Ga0070687_100121365 3300005343 Bacteria 1495
55 Ga0070687_100128618 3300005343 Bacteria 1459
56 Ga0070661_100030511 3300005344 Unclassified 3895
57 Ga0070661_100267260 3300005344 Bacteria 1323
58 Ga0070692_10092666 3300005345 Bacteria 1644
59 Ga0070692_10114106 3300005345 Unclassified 1498
60 Ga0070692_10221910 3300005345 Bacteria 1118
61 Ga0070692_10246732 3300005345 Bacteria 1067
62 Ga0070669_100018464 3300005353 Bacteria 4983
63 Ga0070669_100022032 3300005353 Bacteria 4557
64 Ga0070669_100066425 3300005353 Bacteria 2658
65 Ga0070675_100037759 3300005354 Bacteria 3936
66 Ga0070675_100205132 3300005354 Bacteria 1712
67 Ga0070671_100004945 3300005355 Bacteria 10604
68 Ga0070671_100012372 3300005355 Bacteria 6873
69 Ga0070671_100031819 3300005355 Bacteria 4361
70 Ga0070671_100178039 3300005355 Unclassified 1800
71 Ga0070674_100112801 3300005356 Bacteria 1999
72 Ga0070673_100052782 3300005364 Bacteria 3191
73 Ga0070673_100083508 3300005364 Bacteria 2595
74 Ga0070673_100102947 3300005364 Unclassified 2355
75 Ga0070688_100002981 3300005365 Bacteria 8629
76 Ga0070659_100003483 3300005366 Bacteria 11202
77 Ga0070667_100015290 3300005367 Bacteria 6343
78 Ga0070703_10000059 3300005406 Bacteria 54442
79 Ga0070703_10040190 3300005406 Bacteria 1453
80 Ga0070701_10016248 3300005438 Bacteria 3456
81 Ga0070701_10075930 3300005438 Bacteria 1808
82 Ga0070711_100389994 3300005439 Bacteria 1128
83 Ga0070705_100015078 3300005440 Bacteria 3988
84 Ga0070705_100207484 3300005440 Bacteria 1348
85 Ga0070705_100277560 3300005440 Unclassified 1190
86 Ga0070700_100005818 3300005441 Bacteria 6546
87 Ga0070700_100011361 3300005441 Bacteria 4931
88 Ga0070700_100016838 3300005441 Bacteria 4169
89 Ga0070700_100029174 3300005441 Bacteria 3288
90 Ga0070700_100094023 3300005441 Bacteria 1962
91 Ga0070700_100221376 3300005441 Bacteria 1341
92 Ga0070700_100230486 3300005441 Unclassified 1318
93 Ga0070694_100023245 3300005444 Bacteria 3984
94 Ga0070694_100101908 3300005444 Unclassified 2032
95 Ga0070694_100122832 3300005444 Bacteria 1865
96 Ga0070694_100135931 3300005444 Unclassified 1781
97 Ga0070694_100337627 3300005444 Bacteria 1164
98 Ga0070708_100000455 3300005445 Bacteria 30656
99 Ga0070708_100036694 3300005445 Bacteria 4275
100 Ga0070708_100091327 3300005445 Bacteria 2773
101 Ga0070662_100029005 3300005457 Bacteria 3858
102 Ga0070662_100127195 3300005457 Bacteria 1960
103 Ga0070681_10000410 3300005458 Bacteria 34833
104 Ga0070681_10000956 3300005458 Bacteria 24322
105 Ga0070681_10040975 3300005458 Bacteria 4640
106 Ga0070681_10092442 3300005458 Bacteria 2974
107 Ga0070681_10121305 3300005458 Unclassified 2549
108 Ga0068867_100032828 3300005459 Bacteria 3756
109 Ga0068867_100081841 3300005459 Bacteria 2435
110 Ga0068867_100154345 3300005459 Bacteria 1806
111 Ga0068867_100205392 3300005459 Bacteria 1579
112 Ga0070685_10021815 3300005466 Bacteria 3484
113 Ga0070706_100000358 3300005467 Bacteria 55073
114 Ga0070706_100030144 3300005467 Bacteria 4997
115 Ga0070706_100053561 3300005467 Bacteria 3724
116 Ga0070706_100113050 3300005467 Bacteria 2528
117 Ga0070706_100443147 3300005467 Bacteria 1209
118 Ga0070707_100037232 3300005468 Bacteria 4643
119 Ga0070707_100055949 3300005468 Bacteria 3782
120 Ga0070707_100089645 3300005468 Bacteria 2976
121 Ga0070698_100000720 3300005471 Bacteria 35533
122 Ga0070698_100005931 3300005471 Bacteria 13326
123 Ga0070698_100011587 3300005471 Bacteria 9358
124 Ga0070698_100016323 3300005471 Bacteria 7840
125 Ga0070698_100056932 3300005471 Bacteria 3957
126 Ga0070698_100101515 3300005471 Unclassified 2848
127 Ga0070698_100287023 3300005471 Bacteria 1577
128 Ga0070699_100000488 3300005518 Bacteria 37711
129 Ga0070699_100002881 3300005518 Bacteria 15333
130 Ga0070699_100012643 3300005518 Bacteria 7281
131 Ga0070699_100023012 3300005518 Bacteria 5369
132 Ga0070679_100002026 3300005530 Bacteria 18180
133 Ga0070679_100048827 3300005530 Bacteria 4216
134 Ga0070684_100176076 3300005535 Bacteria 1944
135 Ga0070697_100000109 3300005536 Bacteria 63972
136 Ga0070697_100001352 3300005536 Bacteria 18559
137 Ga0070697_100070341 3300005536 Bacteria 2868
138 Ga0070697_100096038 3300005536 Bacteria 2459
139 Ga0070697_100182072 3300005536 Unclassified 1781
140 Ga0070697_100203505 3300005536 Archaea 1683
141 Ga0070697_100361956 3300005536 Bacteria 1254
142 Ga0070697_100459993 3300005536 Bacteria 1109
143 Ga0068853_100002384 3300005539 Bacteria 14043
144 Ga0068853_100009668 3300005539 Bacteria 7772
145 Ga0068853_100010391 3300005539 Bacteria 7531
146 Ga0068853_100019109 3300005539 Bacteria 5677
147 Ga0068853_100252337 3300005539 Bacteria 1619
148 Ga0070686_100002441 3300005544 Bacteria 10246
149 Ga0070686_100024137 3300005544 Unclassified 3642
150 Ga0070686_100029278 3300005544 Bacteria 3348
151 Ga0070695_100023861 3300005545 Bacteria 3765
152 Ga0070695_100063763 3300005545 Bacteria 2396
153 Ga0070695_100196935 3300005545 Bacteria 1437
154 Ga0070695_100277027 3300005545 Bacteria 1231
155 Ga0070696_100036894 3300005546 Bacteria 3372
156 Ga0070696_100040888 3300005546 Bacteria 3202
157 Ga0070696_100059260 3300005546 Bacteria 2675
158 Ga0070696_100065546 3300005546 Bacteria 2546
159 Ga0070696_100110607 3300005546 Unclassified 1978
160 Ga0070696_100248563 3300005546 Bacteria 1344
161 Ga0070693_100004270 3300005547 Bacteria 6743
162 Ga0070693_100009683 3300005547 Bacteria 4798
163 Ga0070693_100019333 3300005547 Bacteria 3568
164 Ga0070693_100028367 3300005547 Bacteria 3043
165 Ga0070693_100075068 3300005547 Bacteria 2001
166 Ga0070665_100093974 3300005548 Bacteria 3004
167 Ga0070704_100052511 3300005549 Bacteria 2876
168 Ga0070704_100081117 3300005549 Bacteria 2388
169 Ga0070704_100092917 3300005549 Bacteria 2253
170 Ga0070704_100094658 3300005549 Bacteria 2235
171 Ga0070704_100134084 3300005549 Unclassified 1924
172 Ga0070704_100140583 3300005549 Bacteria 1884
173 Ga0070704_100141764 3300005549 Bacteria 1878
174 Ga0070704_100220831 3300005549 Bacteria 1541
175 Ga0070704_100386983 3300005549 Bacteria 1190
176 Ga0070704_100441549 3300005549 Unclassified 1118
177 Ga0068855_100047483 3300005563 Bacteria 5072
178 Ga0070664_100002140 3300005564 Bacteria 15821
179 Ga0070664_100014093 3300005564 Bacteria 6520
180 Ga0070664_100023076 3300005564 Bacteria 5135
181 Ga0070664_100158886 3300005564 Bacteria 1999
182 Ga0068857_100000660 3300005577 Bacteria 25499
183 Ga0068857_100070475 3300005577 Bacteria 3114
184 Ga0068857_100143019 3300005577 Bacteria 2163
185 Ga0068857_100304425 3300005577 Bacteria 1470
186 Ga0068854_100132244 3300005578 Bacteria 1906
187 Ga0068854_100309077 3300005578 Bacteria 1281
188 Ga0070702_100032831 3300005615 Bacteria 2851
189 Ga0070702_100079975 3300005615 Bacteria 1955
190 Ga0070702_100107582 3300005615 Bacteria 1722
191 Ga0068852_100121870 3300005616 Bacteria 2389
192 Ga0068852_100414802 3300005616 Bacteria 1327
193 Ga0068859_100006153 3300005617 Bacteria 12203
194 Ga0068859_100019388 3300005617 Bacteria 6833
195 Ga0068859_100020821 3300005617 Bacteria 6582
196 Ga0068859_100039240 3300005617 Unclassified 4750
197 Ga0068859_100067200 3300005617 Bacteria 3619
198 Ga0068859_100076653 3300005617 Bacteria 3384
199 Ga0068859_100086168 3300005617 Bacteria 3187
200 Ga0068859_100098202 3300005617 Unclassified 2982
201 Ga0068859_100165631 3300005617 Bacteria 2290
202 Ga0068859_100223522 3300005617 Bacteria 1971
203 Ga0068859_100302110 3300005617 Unclassified 1694
204 Ga0068859_100435480 3300005617 Bacteria 1407
205 Ga0068859_100621561 3300005617 Bacteria 1173
206 Ga0068864_100000679 3300005618 Bacteria 28500
207 Ga0068864_100004285 3300005618 Bacteria 11727
208 Ga0068864_100051816 3300005618 Bacteria 3536
209 Ga0068864_100077115 3300005618 Bacteria 2914
210 Ga0068864_100165773 3300005618 Bacteria 2011
211 Ga0068864_100190381 3300005618 Bacteria 1880
212 Ga0068864_100339290 3300005618 Bacteria 1416
213 Ga0068864_100400909 3300005618 Bacteria 1303
214 Ga0068864_100410073 3300005618 Bacteria 1289
215 Ga0068866_10011197 3300005718 Bacteria 3872
216 Ga0068866_10045751 3300005718 Bacteria 2197
217 Ga0068866_10101492 3300005718 Bacteria 1588
218 Ga0068861_100018116 3300005719 Bacteria 5009
219 Ga0068861_100037071 3300005719 Bacteria 3624
220 Ga0068861_100062314 3300005719 Unclassified 2864
221 Ga0068861_100299333 3300005719 Bacteria 1393
222 Ga0068851_10001687 3300005834 Bacteria 9663
223 Ga0068851_10191516 3300005834 Bacteria 1137
224 Ga0068863_100014751 3300005841 Bacteria 7516
225 Ga0068863_100052139 3300005841 Unclassified 3878
226 Ga0068863_100140903 3300005841 Bacteria 2304
227 Ga0068863_100193495 3300005841 Bacteria 1955
228 Ga0068863_100282824 3300005841 Bacteria 1607
229 Ga0068863_100355474 3300005841 Bacteria 1427
230 Ga0068858_100000055 3300005842 Bacteria 118619
231 Ga0068858_100036159 3300005842 Bacteria 4579
232 Ga0068858_100075620 3300005842 Bacteria 3128
233 Ga0068858_100078020 3300005842 Bacteria 3077
234 Ga0068858_100554874 3300005842 Bacteria 1112
235 Ga0068858_100583093 3300005842 Bacteria 1084
236 Ga0068860_100057419 3300005843 Bacteria 3700
237 Ga0068860_100063230 3300005843 Bacteria 3516
238 Ga0068860_100100867 3300005843 Bacteria 2754
239 Ga0068860_100111768 3300005843 Bacteria 2612
240 Ga0068862_100022869 3300005844 Bacteria 5233
241 Ga0068862_100024435 3300005844 Bacteria 5071
242 Ga0068862_100058963 3300005844 Unclassified 3294
243 Ga0081540_1039264 3300005983 Unclassified 2482
244 Ga0081539_10000697 3300005985 Bacteria 67380
245 Ga0081539_10092694 3300005985 Bacteria 1557
246 Ga0070715_10000060 3300006163 Bacteria 39036
247 Ga0070716_100000002 3300006173 Bacteria 396037
248 Ga0097621_100001606 3300006237 Bacteria 15484
249 Ga0097621_100004434 3300006237 Bacteria 9770
250 Ga0068871_100006452 3300006358 Bacteria 8303
251 Ga0068871_100026456 3300006358 Bacteria 4526
252 Ga0075428_100047810 3300006844 Unclassified 4697
253 Ga0075428_100167962 3300006844 Bacteria 2379
254 Ga0075430_100045196 3300006846 Bacteria 3721
255 Ga0075431_100032160 3300006847 Bacteria 5407
256 Ga0075431_100074007 3300006847 Bacteria 3515
257 Ga0075433_10009221 3300006852 Bacteria 7887
258 Ga0075433_10012104 3300006852 Bacteria 6958
259 Ga0075433_10021661 3300006852 Bacteria 5391
260 Ga0075433_10059528 3300006852 Bacteria 3341
261 Ga0075433_10175036 3300006852 Unclassified 1910
262 Ga0075434_100009348 3300006871 Bacteria 9138
263 Ga0075434_100129327 3300006871 Unclassified 2543
264 Ga0075434_100252334 3300006871 Bacteria 1783
265 Ga0075429_100032578 3300006880 Bacteria 4530
266 Ga0075429_100059092 3300006880 Unclassified 3340
267 Ga0075429_100226734 3300006880 Bacteria 1637
268 Ga0068865_100014218 3300006881 Bacteria 5052
269 Ga0097620_100006152 3300006931 Bacteria 12203
270 Ga0097620_100019388 3300006931 Bacteria 6833
271 Ga0097620_100020822 3300006931 Bacteria 6582
272 Ga0097620_100039238 3300006931 Unclassified 4750
273 Ga0097620_100067198 3300006931 Bacteria 3619
274 Ga0097620_100076660 3300006931 Bacteria 3384
275 Ga0097620_100086169 3300006931 Bacteria 3187
276 Ga0097620_100098201 3300006931 Unclassified 2982
277 Ga0097620_100165628 3300006931 Bacteria 2290
278 Ga0097620_100223541 3300006931 Bacteria 1971
279 Ga0097620_100302115 3300006931 Unclassified 1694
280 Ga0097620_100435479 3300006931 Bacteria 1407
281 Ga0097620_100621548 3300006931 Bacteria 1173
282 Ga0075435_100023341 3300007076 Bacteria 4782
283 Ga0075435_100159906 3300007076 Unclassified 1897
284 Ga0105251_10074341 3300009011 Bacteria 1578
285 Ga0105240_10042809 3300009093 Bacteria 5768
286 Ga0105240_10123214 3300009093 Bacteria 3119
287 Ga0105240_10279215 3300009093 Bacteria 1920
288 Ga0111539_10009389 3300009094 Bacteria 12347
289 Ga0111539_10044639 3300009094 Bacteria 5309
290 Ga0111539_10058758 3300009094 Bacteria 4561
291 Ga0111539_10095139 3300009094 Bacteria 3500
292 Ga0111539_10158626 3300009094 Bacteria 2647
293 Ga0111539_10192261 3300009094 Bacteria 2381
294 Ga0111539_10196967 3300009094 Bacteria 2349
295 Ga0105245_10010782 3300009098 Bacteria 7953
296 Ga0105245_10390981 3300009098 Unclassified 1387
297 Ga0105247_10000001 3300009101 Bacteria 739726
298 Ga0105247_10004251 3300009101 Bacteria 9177
299 Ga0105247_10062449 3300009101 Unclassified 2311
300 Ga0114129_10003197 3300009147 Bacteria 22986
301 Ga0114129_10028380 3300009147 Bacteria 7930
302 Ga0114129_10114835 3300009147 Bacteria 3712
303 Ga0114129_10154258 3300009147 Bacteria 3142
304 Ga0114129_10181484 3300009147 Bacteria 2863
305 Ga0114129_10354098 3300009147 Bacteria 1944
306 Ga0114129_10431576 3300009147 Bacteria 1731
307 Ga0114129_10581003 3300009147 Bacteria 1454
308 Ga0105243_10000019 3300009148 Bacteria 217107
309 Ga0105243_10002025 3300009148 Bacteria 17213
310 Ga0105243_10006485 3300009148 Bacteria 9048
311 Ga0105243_10132854 3300009148 Unclassified 2114
312 Ga0105243_10168090 3300009148 Bacteria 1897
313 Ga0105241_10042086 3300009174 Bacteria 3454
314 Ga0105241_10057362 3300009174 Bacteria 2987
315 Ga0105241_10183964 3300009174 Bacteria 1735
316 Ga0105241_10392324 3300009174 Bacteria 1216
317 Ga0105241_10447275 3300009174 Bacteria 1142
318 Ga0105242_10000007 3300009176 Bacteria 177073
319 Ga0105242_10004220 3300009176 Bacteria 11202
320 Ga0105242_10004974 3300009176 Bacteria 10277
321 Ga0105242_10041696 3300009176 Bacteria 3703
322 Ga0105242_10238998 3300009176 Bacteria 1632
323 Ga0105242_10374475 3300009176 Bacteria 1322
324 Ga0105248_10009745 3300009177 Bacteria 10583
325 Ga0105248_10026181 3300009177 Bacteria 6489
326 Ga0105248_10029526 3300009177 Bacteria 6116
327 Ga0105248_10032794 3300009177 Bacteria 5803
328 Ga0105248_10054605 3300009177 Bacteria 4480
329 Ga0105248_10057358 3300009177 Bacteria 4371
330 Ga0105248_10127924 3300009177 Bacteria 2866
331 Ga0105248_10360592 3300009177 Bacteria 1636
332 Ga0105248_10383283 3300009177 Bacteria 1583
333 Ga0105237_10006392 3300009545 Bacteria 13077
334 Ga0105237_10031278 3300009545 Bacteria 5398
335 Ga0105237_10134931 3300009545 Unclassified 2463
336 Ga0105237_10722213 3300009545 Bacteria 1003
337 Ga0105238_10017007 3300009551 Bacteria 7383
338 Ga0105238_10021171 3300009551 Bacteria 6627
339 Ga0105249_10000107 3300009553 Bacteria 114573
340 Ga0105249_10048917 3300009553 Bacteria 3855
341 Ga0105249_10094571 3300009553 Bacteria 2801
342 Ga0105249_10202012 3300009553 Unclassified 1945
343 Ga0105249_10205214 3300009553 Bacteria 1931
344 Ga0105249_10280051 3300009553 Bacteria 1665
345 Ga0105249_10381677 3300009553 Unclassified 1435
346 Ga0105239_10098522 3300010375 Bacteria 3232
347 Ga0105239_10123744 3300010375 Bacteria 2874
348 Ga0105239_10314500 3300010375 Unclassified 1765
349 Ga0105239_10495885 3300010375 Bacteria 1388
350 Ga0105246_10036695 3300011119 Unclassified 3285
351 Ga0105246_10052408 3300011119 Bacteria 2805
352 Ga0157373_10001131 3300013100 Bacteria 20507
353 Ga0157373_10004127 3300013100 Bacteria 10952
354 Ga0157373_10022534 3300013100 Bacteria 4569
355 Ga0157373_10099466 3300013100 Unclassified 2047
356 Ga0157373_10123041 3300013100 Bacteria 1824
357 Ga0157373_10172593 3300013100 Bacteria 1521
358 Ga0157371_10105104 3300013102 Bacteria 2003
359 Ga0157369_10195986 3300013105 Bacteria 2121
360 Ga0157369_10250896 3300013105 Bacteria 1847
361 Ga0157374_10005684 3300013296 Bacteria 10514
362 Ga0157374_10417297 3300013296 Unclassified 1340
363 Ga0157378_10000176 3300013297 Bacteria 60614
364 Ga0157378_10000681 3300013297 Bacteria 31934
365 Ga0157378_10001399 3300013297 Bacteria 21715
366 Ga0157378_10001720 3300013297 Bacteria 19659
367 Ga0157378_10012967 3300013297 Bacteria 7292
368 Ga0157378_10041373 3300013297 Bacteria 4087
369 Ga0157378_10045113 3300013297 Bacteria 3916
370 Ga0157378_10049614 3300013297 Bacteria 3734
371 Ga0157378_10055088 3300013297 Unclassified 3541
372 Ga0157378_10149393 3300013297 Bacteria 2176
373 Ga0157378_10425425 3300013297 Bacteria 1313
374 Ga0157378_10531564 3300013297 Bacteria 1179
375 Ga0163162_10000006 3300013306 Bacteria 410012
376 Ga0163162_10000966 3300013306 Bacteria 26676
377 Ga0163162_10016251 3300013306 Bacteria 7279
378 Ga0163162_10027965 3300013306 Bacteria 5578
379 Ga0163162_10047954 3300013306 Bacteria 4280
380 Ga0163162_10066061 3300013306 Bacteria 3666
381 Ga0163162_10098520 3300013306 Bacteria 3013
382 Ga0163162_10233631 3300013306 Bacteria 1969
383 Ga0163162_10362899 3300013306 Bacteria 1581
384 Ga0163162_10511509 3300013306 Unclassified 1331
385 Ga0163162_10590986 3300013306 Bacteria 1237
386 Ga0157372_10008816 3300013307 Bacteria 10713
387 Ga0157372_10012433 3300013307 Bacteria 9074
388 Ga0157375_10001758 3300013308 Bacteria 18593
389 Ga0157375_10005745 3300013308 Bacteria 10792
390 Ga0157375_10005943 3300013308 Bacteria 10637
391 Ga0157375_10085500 3300013308 Unclassified 3204
392 Ga0157375_10125224 3300013308 Bacteria 2684
393 Ga0157375_10593436 3300013308 Bacteria 1267
394 Ga0163163_10001194 3300014325 Bacteria 22003
395 Ga0163163_10002791 3300014325 Bacteria 14753
396 Ga0163163_10003423 3300014325 Bacteria 13484
397 Ga0163163_10006276 3300014325 Bacteria 10375
398 Ga0163163_10006974 3300014325 Bacteria 9925
399 Ga0163163_10007025 3300014325 Bacteria 9892
400 Ga0163163_10019449 3300014325 Bacteria 6379
401 Ga0163163_10057894 3300014325 Bacteria 3832
402 Ga0157380_10001155 3300014326 Bacteria 17080
403 Ga0157380_10001325 3300014326 Bacteria 16086
404 Ga0157380_10015572 3300014326 Bacteria 5591
405 Ga0157377_10005619 3300014745 Bacteria 5909
406 Ga0157377_10061326 3300014745 Bacteria 2149
407 Ga0157379_10021400 3300014968 Bacteria 5724
408 Ga0157376_10057395 3300014969 Bacteria 3256
409 Ga0157376_10091970 3300014969 Bacteria 2629
410 Ga0182006_1082602 3300015261 Bacteria 1170
411 Ga0163161_10008832 3300017792 Bacteria 6967
412 Ga0163161_10009081 3300017792 Bacteria 6875
413 Ga0163161_10114864 3300017792 Bacteria 2017
414 Ga0163161_10188862 3300017792 Bacteria 1583
415 Ga0207672_1000452 3300025223 Bacteria 5241
416 Ga0207697_10012562 3300025315 Bacteria 3548
417 Ga0207656_10005191 3300025321 Bacteria 4581
418 Ga0207653_10000095 3300025885 Bacteria 64003
419 Ga0207653_10006563 3300025885 Bacteria 3632
420 Ga0207710_10000003 3300025900 Bacteria 1071597
421 Ga0207710_10000370 3300025900 Bacteria 31536
422 Ga0207688_10083884 3300025901 Bacteria 1823
423 Ga0207680_10009612 3300025903 Bacteria 4804
424 Ga0207647_10018148 3300025904 Unclassified 4766
425 Ga0207685_10000047 3300025905 Bacteria 45930
426 Ga0207643_10004644 3300025908 Bacteria 7378
427 Ga0207684_10000168 3300025910 Bacteria 110284
428 Ga0207684_10001610 3300025910 Bacteria 23961
429 Ga0207684_10052985 3300025910 Bacteria 3444
430 Ga0207684_10059965 3300025910 Bacteria 3231
431 Ga0207684_10209815 3300025910 Bacteria 1680
432 Ga0207654_10046572 3300025911 Bacteria 2473
433 Ga0207654_10182604 3300025911 Bacteria 1369
434 Ga0207707_10000037 3300025912 Bacteria 144937
435 Ga0207707_10016470 3300025912 Bacteria 6446
436 Ga0207707_10265252 3300025912 Bacteria 1489
437 Ga0207695_10040145 3300025913 Bacteria 5022
438 Ga0207695_10245840 3300025913 Bacteria 1689
439 Ga0207671_10002825 3300025914 Bacteria 18059
440 Ga0207660_10005412 3300025917 Bacteria 8286
441 Ga0207660_10071855 3300025917 Unclassified 2519
442 Ga0207660_10103717 3300025917 Unclassified 2128
443 Ga0207660_10121811 3300025917 Bacteria 1976
444 Ga0207662_10002070 3300025918 Bacteria 9943
445 Ga0207662_10030622 3300025918 Bacteria 3124
446 Ga0207662_10161093 3300025918 Bacteria 1433
447 Ga0207649_10021925 3300025920 Bacteria 3686
448 Ga0207652_10000200 3300025921 Bacteria 63144
449 Ga0207652_10071803 3300025921 Unclassified 3008
450 Ga0207646_10000681 3300025922 Bacteria 44059
451 Ga0207646_10022174 3300025922 Bacteria 5855
452 Ga0207646_10144689 3300025922 Bacteria 2142
453 Ga0207681_10000872 3300025923 Bacteria 19820
454 Ga0207681_10033469 3300025923 Unclassified 3370
455 Ga0207681_10109339 3300025923 Bacteria 2008
456 Ga0207694_10007325 3300025924 Bacteria 8373
457 Ga0207694_10025798 3300025924 Bacteria 4468
458 Ga0207650_10000087 3300025925 Bacteria 123505
459 Ga0207650_10188201 3300025925 Bacteria 1648
460 Ga0207650_10199803 3300025925 Bacteria 1601
461 Ga0207659_10101139 3300025926 Bacteria 2173
462 Ga0207687_10332644 3300025927 Bacteria 1233
463 Ga0207644_10000257 3300025931 Bacteria 35725
464 Ga0207644_10010626 3300025931 Bacteria 6070
465 Ga0207644_10052688 3300025931 Bacteria 2925
466 Ga0207690_10024903 3300025932 Bacteria 3752
467 Ga0207706_10044507 3300025933 Bacteria 3934
468 Ga0207706_10047044 3300025933 Bacteria 3818
469 Ga0207686_10000002 3300025934 Bacteria 453961
470 Ga0207686_10000030 3300025934 Bacteria 159065
471 Ga0207686_10004309 3300025934 Bacteria 7632
472 Ga0207686_10004670 3300025934 Bacteria 7341
473 Ga0207686_10181941 3300025934 Bacteria 1491
474 Ga0207709_10000027 3300025935 Bacteria 339731
475 Ga0207709_10018212 3300025935 Bacteria 3929
476 Ga0207709_10119984 3300025935 Bacteria 1774
477 Ga0207709_10328417 3300025935 Unclassified 1147
478 Ga0207670_10003565 3300025936 Bacteria 8263
479 Ga0207670_10134648 3300025936 Bacteria 1815
480 Ga0207670_10348260 3300025936 Bacteria 1172
481 Ga0207704_10149504 3300025938 Bacteria 1646
482 Ga0207704_10414695 3300025938 Bacteria 1066
483 Ga0207665_10000004 3300025939 Bacteria 218220
484 Ga0207691_10004525 3300025940 Bacteria 13448
485 Ga0207691_10058065 3300025940 Unclassified 3520
486 Ga0207711_10006798 3300025941 Bacteria 9612
487 Ga0207711_10013320 3300025941 Bacteria 6833
488 Ga0207711_10051973 3300025941 Bacteria 3510
489 Ga0207711_10104501 3300025941 Bacteria 2510
490 Ga0207711_10165419 3300025941 Bacteria 2005
491 Ga0207711_10223436 3300025941 Bacteria 1723
492 Ga0207689_10002058 3300025942 Bacteria 18982
493 Ga0207689_10007593 3300025942 Bacteria 9500
494 Ga0207689_10007728 3300025942 Bacteria 9409
495 Ga0207689_10007772 3300025942 Bacteria 9382
496 Ga0207689_10043877 3300025942 Bacteria 3697
497 Ga0207689_10092042 3300025942 Bacteria 2491
498 Ga0207679_10013840 3300025945 Bacteria 5291
499 Ga0207679_10027488 3300025945 Bacteria 3935
500 Ga0207679_10046674 3300025945 Bacteria 3141
501 Ga0207651_10054061 3300025960 Bacteria 2749
502 Ga0207651_10066809 3300025960 Bacteria 2528
503 Ga0207712_10000085 3300025961 Bacteria 107704
504 Ga0207712_10003498 3300025961 Bacteria 9908
505 Ga0207712_10008758 3300025961 Bacteria 6401
506 Ga0207712_10023976 3300025961 Bacteria 4033
507 Ga0207712_10040329 3300025961 Bacteria 3204
508 Ga0207712_10049886 3300025961 Bacteria 2919
509 Ga0207712_10270163 3300025961 Unclassified 1383
510 Ga0207668_10003668 3300025972 Bacteria 9023
511 Ga0207640_10113978 3300025981 Bacteria 1923
512 Ga0207658_10028514 3300025986 Bacteria 3932
513 Ga0207677_10142419 3300026023 Bacteria 1838
514 Ga0207703_10000336 3300026035 Bacteria 51189
515 Ga0207703_10013166 3300026035 Bacteria 6444
516 Ga0207703_10052913 3300026035 Bacteria 3299
517 Ga0207703_10141359 3300026035 Bacteria 2089
518 Ga0207703_10473764 3300026035 Bacteria 1172
519 Ga0207639_10015581 3300026041 Bacteria 5364
520 Ga0207639_10040920 3300026041 Bacteria 3463
521 Ga0207639_10200776 3300026041 Unclassified 1710
522 Ga0207639_10202016 3300026041 Bacteria 1705
523 Ga0207708_10000407 3300026075 Bacteria 33931
524 Ga0207708_10010363 3300026075 Bacteria 6920
525 Ga0207708_10012137 3300026075 Bacteria 6424
526 Ga0207708_10021808 3300026075 Bacteria 4832
527 Ga0207708_10025275 3300026075 Bacteria 4492
528 Ga0207708_10067583 3300026075 Bacteria 2734
529 Ga0207708_10083376 3300026075 Unclassified 2457
530 Ga0207708_10114196 3300026075 Bacteria 2099
531 Ga0207641_10010800 3300026088 Bacteria 7486
532 Ga0207641_10011483 3300026088 Bacteria 7271
533 Ga0207641_10051036 3300026088 Unclassified 3502
534 Ga0207641_10309260 3300026088 Bacteria 1495
535 Ga0207641_10333702 3300026088 Bacteria 1441
536 Ga0207648_10005802 3300026089 Bacteria 12368
537 Ga0207648_10095943 3300026089 Bacteria 2595
538 Ga0207676_10002568 3300026095 Bacteria 12957
539 Ga0207676_10004535 3300026095 Bacteria 9827
540 Ga0207676_10009479 3300026095 Bacteria 6931
541 Ga0207676_10069502 3300026095 Bacteria 2820
542 Ga0207676_10085531 3300026095 Bacteria 2574
543 Ga0207676_10122650 3300026095 Unclassified 2194
544 Ga0207674_10000037 3300026116 Bacteria 134125
545 Ga0207674_10012317 3300026116 Bacteria 9562
546 Ga0207674_10041671 3300026116 Bacteria 4746
547 Ga0207674_10061516 3300026116 Bacteria 3794
548 Ga0207674_10068741 3300026116 Bacteria 3564
549 Ga0207674_10120625 3300026116 Bacteria 2590
550 Ga0207674_10190838 3300026116 Bacteria 1999
551 Ga0207674_10313731 3300026116 Bacteria 1517
552 Ga0207674_10611602 3300026116 Bacteria 1053
553 Ga0207675_100002042 3300026118 Bacteria 20142
554 Ga0207675_100002503 3300026118 Bacteria 18174
555 Ga0207675_100039293 3300026118 Bacteria 4417
556 Ga0207675_100051034 3300026118 Bacteria 3860
557 Ga0207675_100075844 3300026118 Bacteria 3148
558 Ga0207675_100159831 3300026118 Bacteria 2149
559 Ga0207675_100281427 3300026118 Bacteria 1616
560 Ga0207675_100445826 3300026118 Bacteria 1282
561 Ga0207675_100577069 3300026118 Bacteria 1126
562 Ga0207698_10068472 3300026142 Bacteria 2803
563 Ga0207698_10213061 3300026142 Unclassified 1739
564 Ga0207428_10030369 3300027907 Bacteria 4468
565 Ga0207428_10041040 3300027907 Bacteria 3748
566 Ga0207428_10199752 3300027907 Unclassified 1505
567 Ga0207428_10223282 3300027907 Bacteria 1411
568 Ga0268266_10065961 3300028379 Bacteria 3130
569 Ga0268265_10007156 3300028380 Bacteria 7538
570 Ga0268265_10416207 3300028380 Bacteria 1246
571 Ga0268264_10012332 3300028381 Bacteria 7035
572 Ga0268264_10055069 3300028381 Bacteria 3323
573 Ga0268264_10061047 3300028381 Unclassified 3161
574 Ga0268264_10084447 3300028381 Bacteria 2722
575 Ga0268264_10090291 3300028381 Unclassified 2640
576 Ga0268264_10181311 3300028381 Bacteria 1913
577 Ga0268264_10404931 3300028381 Bacteria 1312
578 Ga0307513_10352076 3300031456 Bacteria 1220
579 Ga0307408_100037038 3300031548 Bacteria 3433
580 Ga0307408_100292577 3300031548 Bacteria 1361
581 Ga0307405_10096769 3300031731 Bacteria 1969
582 Ga0307413_10043237 3300031824 Bacteria 2654
583 Ga0307406_10005217 3300031901 Bacteria 7098
584 Ga0307409_100171547 3300031995 Bacteria 1910
585 Ga0307409_100313145 3300031995 Bacteria 1466
586 Ga0307416_100030004 3300032002 Bacteria 4074
587 Ga0307416_100193296 3300032002 Bacteria 1922
588 Ga0307414_10043925 3300032004 Bacteria 3047
589 Ga0307411_10067010 3300032005 Bacteria 2414
590 Ga0307415_100394739 3300032126 Bacteria 1179
591 Ga0373940_0022120 3300035088 Bacteria 1632
592 Ga0373951_0013750 3300035091 Bacteria 1818
593 Ga0373941_0036489 3300035115 Bacteria 1495
594 Ga0373943_0039383 3300035170 Bacteria 2277
595 Ga0395899_0187503 3300037312 Bacteria 1449
596 Ga0395899_0349302 3300037312 Bacteria 990
597 Ga0395900_0395689 3300037418 Bacteria 1347
598 Ga0395901_0098180 3300038443 Bacteria 3071
599 Ga0395901_0166555 3300038443 Bacteria 2314
600 Ga0395901_0200318 3300038443 Bacteria 2093
601 Ga0395901_0213496 3300038443 Bacteria 2019
602 Ga0242420_000152 3300038996 Bacteria 7149
603 Ga0242420_008207 3300038996 Bacteria 1689
604 Ga0439439_0006736 3300041406 Bacteria 2664
605 Ga0439455_0015858 3300042012 Bacteria 1736
606 Ga0439458_0004779 3300042157 Unclassified 3080
607 Ga0439434_0009299 3300042435 Bacteria 2887
608 Ga0453683_0089348 3300044673 Bacteria 1931
609 Ga0451576_0110442 3300045051 Bacteria 2861
610 Ga0451576_0766432 3300045051 Bacteria 1013
611 Ga0495639_0135664 3300046475 Bacteria 1181
612 Ga0495662_0130692 3300046476 Bacteria 1234
613 Ga0495610_0118227 3300046512 Bacteria 1165
614 Ga0495628_0371473 3300046516 Bacteria 1049
615 Ga0495630_0181321 3300046517 Bacteria 1606
616 Ga0495663_0000285 3300046525 Bacteria 19329
617 Ga0495598_0000057 3300046537 Bacteria 17715
618 Ga0495621_0000189 3300046539 Bacteria 14117
619 Ga0495668_0063944 3300046616 Bacteria 2026
620 Ga0495659_0028799 3300046664 Unclassified 1924
621 Ga0495669_0166001 3300046684 Bacteria 1049
622 Ga0495672_0052790 3300047320 Bacteria 2386
623 Ga0496106_0001329 3300048909 Bacteria 18535
624 Ga0496106_0276416 3300048909 Unclassified 1345
625 Ga0496108_0131514 3300048911 Bacteria 2151
626 Ga0496112_0540299 3300048915 Bacteria 1100
627 Ga0496114_0557465 3300048917 Bacteria 1012
628 Ga0501291_000942 3300049514 Bacteria 3336
629 Ga0501038_0070356 3300049574 Bacteria 2971
630 Ga0501198_003004 3300049649 Bacteria 2297
631 Ga0501217_004334 3300049661 Bacteria 2912
632 Ga0501223_003083 3300049663 Bacteria 3639
633 Ga0501233_004661 3300049668 Bacteria 2525
634 Ga0501233_011994 3300049668 Bacteria 1732
635 Ga0501257_046456 3300049686 Bacteria 1076
636 Ga0501225_0003210 3300049705 Bacteria 4995
637 Ga0501234_002615 3300049707 Unclassified 2836
638 Ga0501234_003422 3300049707 Bacteria 2493
639 Ga0501268_010912 3300049765 Bacteria 1424
640 Ga0501226_002652 3300049853 Bacteria 2169
641 nmdc:mga05p37_125154_c1 3300050507 Unclassified 3157
642 nmdc:mga05p37_168938_c1 3300050507 Bacteria 2668
643 nmdc:mga05p37_349666_c1 3300050507 Bacteria 1741
644 nmdc:mga05p37_576290_c1 3300050507 Bacteria 1275
645 nmdc:mga05p37_66358_c1 3300050507 Bacteria 4439
646 nmdc:mga09592_211972_c1 3300050508 Bacteria 1678
647 nmdc:mga09592_58999_c1 3300050508 Unclassified 3244
648 nmdc:mga0qj67_117513_c1 3300050509 Bacteria 2150
649 nmdc:mga06r32_101691_c1 3300050510 Bacteria 2821
650 nmdc:mga06r32_376222_c1 3300050510 Bacteria 1403
651 nmdc:mga06r32_38757_c1 3300050510 Bacteria 4518
652 nmdc:mga08y16_104215_c1 3300050511 Unclassified 2953
653 nmdc:mga08y16_10496_c1 3300050511 Bacteria 9716
654 nmdc:mga08y16_1574_c1 3300050511 Bacteria 23031
655 nmdc:mga08y16_263690_c1 3300050511 Bacteria 1779
656 nmdc:mga08y16_58233_c1 3300050511 Bacteria 4037
657 nmdc:mga08y16_83420_c1 3300050511 Bacteria 3331
658 nmdc:mga0n895_141069_c1 3300050512 Bacteria 2438
659 nmdc:mga0n895_485263_c1 3300050512 Bacteria 1246
660 nmdc:mga0n895_61474_c1 3300050512 Bacteria 3708
661 nmdc:mga0rr50_146312_c1 3300050513 Unclassified 1905
662 nmdc:mga0rr50_223971_c1 3300050513 Bacteria 1554
663 nmdc:mga0rr50_250988_c1 3300050513 Bacteria 1469
664 nmdc:mga0rr50_27553_c1 3300050513 Bacteria 3981
665 nmdc:mga0a205_17733_c1 3300050515 Bacteria 6681
666 nmdc:mga0a205_56437_c1 3300050515 Bacteria 3792
667 nmdc:mga0a205_57787_c1 3300050515 Bacteria 3746
668 nmdc:mga0a205_89118_c1 3300050515 Unclassified 2982
669 Ga0500616_0002137 3300053153 Bacteria 17103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048909 Ga0496106_0001329 Ga0496106_0001329_15722_16636 287
2 3300005539 Ga0068853_100009668 Ga0068853_1000096683 291
3 3300009093 Ga0105240_10123214 Ga0105240_101232141 291
4 3300046525 Ga0495663_0000285 Ga0495663_0000285_9903_10862 293
5 3300046537 Ga0495598_0000057 Ga0495598_0000057_13873_14832 293
6 3300046539 Ga0495621_0000189 Ga0495621_0000189_3144_4103 293
7 3300026088 Ga0207641_10011483 Ga0207641_100114832 296
8 3300005329 Ga0070683_100199655 Ga0070683_1001996552 298
9 3300005336 Ga0070680_100020003 Ga0070680_1000200032 298
10 3300005344 Ga0070661_100030511 Ga0070661_1000305111 298
11 3300005366 Ga0070659_100003483 Ga0070659_1000034836 298
12 3300005458 Ga0070681_10000410 Ga0070681_1000041020 298
13 3300005530 Ga0070679_100048827 Ga0070679_1000488271 298
14 3300005539 Ga0068853_100002384 Ga0068853_1000023849 298
15 3300005564 Ga0070664_100002140 Ga0070664_1000021403 298
16 3300005577 Ga0068857_100000660 Ga0068857_1000006606 298
17 3300005618 Ga0068864_100051816 Ga0068864_1000518163 298
18 3300013100 Ga0157373_10004127 Ga0157373_100041276 298
19 3300014325 Ga0163163_10001194 Ga0163163_1000119419 298
20 3300025917 Ga0207660_10071855 Ga0207660_100718552 298
21 3300025920 Ga0207649_10021925 Ga0207649_100219252 298
22 3300025921 Ga0207652_10071803 Ga0207652_100718032 298
23 3300025932 Ga0207690_10024903 Ga0207690_100249032 298
24 3300025945 Ga0207679_10013840 Ga0207679_100138405 298
25 3300026041 Ga0207639_10015581 Ga0207639_100155812 298
26 3300026095 Ga0207676_10069502 Ga0207676_100695022 298
27 3300026116 Ga0207674_10000037 Ga0207674_1000003737 298
28 3300009094 Ga0111539_10192261 Ga0111539_101922611 300
29 3300025911 Ga0207654_10182604 Ga0207654_101826042 300
30 3300005330 Ga0070690_100033794 Ga0070690_1000337941 302
31 3300005340 Ga0070689_100014111 Ga0070689_1000141113 302
32 3300005343 Ga0070687_100128618 Ga0070687_1001286182 302
33 3300005364 Ga0070673_100102947 Ga0070673_1001029471 302
34 3300005406 Ga0070703_10000059 Ga0070703_1000005925 302
35 3300005439 Ga0070711_100389994 Ga0070711_1003899941 302
36 3300005441 Ga0070700_100016838 Ga0070700_1000168383 302
37 3300005441 Ga0070700_100221376 Ga0070700_1002213762 302
38 3300005445 Ga0070708_100091327 Ga0070708_1000913272 302
39 3300005544 Ga0070686_100024137 Ga0070686_1000241373 302
40 3300005549 Ga0070704_100141764 Ga0070704_1001417642 302
41 3300005617 Ga0068859_100039240 Ga0068859_1000392404 302
42 3300005618 Ga0068864_100190381 Ga0068864_1001903812 302
43 3300005841 Ga0068863_100282824 Ga0068863_1002828242 302
44 3300006844 Ga0075428_100047810 Ga0075428_1000478104 302
45 3300006880 Ga0075429_100059092 Ga0075429_1000590923 302
46 3300006931 Ga0097620_100039238 Ga0097620_1000392384 302
47 3300009094 Ga0111539_10058758 Ga0111539_100587582 302
48 3300009148 Ga0105243_10000019 Ga0105243_1000001952 302
49 3300009176 Ga0105242_10000007 Ga0105242_1000000773 302
50 3300009177 Ga0105248_10057358 Ga0105248_100573584 302
51 3300009177 Ga0105248_10360592 Ga0105248_103605921 302
52 3300009553 Ga0105249_10381677 Ga0105249_103816772 302
53 3300013297 Ga0157378_10149393 Ga0157378_101493932 302
54 3300013306 Ga0163162_10511509 Ga0163162_105115091 302
55 3300017792 Ga0163161_10114864 Ga0163161_101148642 302
56 3300025885 Ga0207653_10000095 Ga0207653_1000009516 302
57 3300025918 Ga0207662_10161093 Ga0207662_101610932 302
58 3300025934 Ga0207686_10000002 Ga0207686_10000002130 302
59 3300025935 Ga0207709_10000027 Ga0207709_10000027223 302
60 3300025938 Ga0207704_10149504 Ga0207704_101495042 302
61 3300025961 Ga0207712_10270163 Ga0207712_102701632 302
62 3300026075 Ga0207708_10067583 Ga0207708_100675833 302
63 3300026088 Ga0207641_10309260 Ga0207641_103092602 302
64 3300026118 Ga0207675_100159831 Ga0207675_1001598312 302
65 3300027907 Ga0207428_10030369 Ga0207428_100303694 302
66 3300042435 Ga0439434_0009299 Ga0439434_0009299_899_1840 302
67 3300046517 Ga0495630_0181321 Ga0495630_0181321_606_1529 302
68 3300046664 Ga0495659_0028799 Ga0495659_0028799_496_1407 302
69 3300050508 nmdc:mga09592_58999_c1 nmdc:mga09592_58999_c1_161_1075 302
70 3300050511 nmdc:mga08y16_83420_c1 nmdc:mga08y16_83420_c1_2017_2931 302
71 3300002074 JGI24748J21848_1000008 JGI24748J21848_100000840 303
72 3300002239 JGI24034J26672_10000002 JGI24034J26672_10000002432 303
73 3300005334 Ga0068869_100029552 Ga0068869_1000295522 303
74 3300005336 Ga0070680_100017225 Ga0070680_1000172256 303
75 3300005338 Ga0068868_100032331 Ga0068868_1000323313 303
76 3300005343 Ga0070687_100121365 Ga0070687_1001213652 303
77 3300005406 Ga0070703_10040190 Ga0070703_100401902 303
78 3300005438 Ga0070701_10016248 Ga0070701_100162484 303
79 3300005440 Ga0070705_100207484 Ga0070705_1002074841 303
80 3300005441 Ga0070700_100094023 Ga0070700_1000940232 303
81 3300005444 Ga0070694_100337627 Ga0070694_1003376271 303
82 3300005467 Ga0070706_100030144 Ga0070706_1000301442 303
83 3300005467 Ga0070706_100053561 Ga0070706_1000535613 303
84 3300005467 Ga0070706_100443147 Ga0070706_1004431471 303
85 3300005468 Ga0070707_100037232 Ga0070707_1000372323 303
86 3300005468 Ga0070707_100055949 Ga0070707_1000559495 303
87 3300005471 Ga0070698_100056932 Ga0070698_1000569324 303
88 3300005471 Ga0070698_100287023 Ga0070698_1002870232 303
89 3300005536 Ga0070697_100096038 Ga0070697_1000960382 303
90 3300005545 Ga0070695_100063763 Ga0070695_1000637632 303
91 3300005545 Ga0070695_100277027 Ga0070695_1002770271 303
92 3300005546 Ga0070696_100040888 Ga0070696_1000408883 303
93 3300005549 Ga0070704_100081117 Ga0070704_1000811173 303
94 3300005549 Ga0070704_100094658 Ga0070704_1000946583 303
95 3300005549 Ga0070704_100140583 Ga0070704_1001405832 303
96 3300005549 Ga0070704_100220831 Ga0070704_1002208312 303
97 3300005617 Ga0068859_100086168 Ga0068859_1000861685 303
98 3300005718 Ga0068866_10101492 Ga0068866_101014921 303
99 3300005842 Ga0068858_100000055 Ga0068858_10000005587 303
100 3300005842 Ga0068858_100554874 Ga0068858_1005548742 303
101 3300005842 Ga0068858_100583093 Ga0068858_1005830931 303
102 3300005844 Ga0068862_100058963 Ga0068862_1000589633 303
103 3300005985 Ga0081539_10092694 Ga0081539_100926942 303
104 3300006163 Ga0070715_10000060 Ga0070715_1000006035 303
105 3300006173 Ga0070716_100000002 Ga0070716_100000002340 303
106 3300006852 Ga0075433_10012104 Ga0075433_100121044 303
107 3300006931 Ga0097620_100086169 Ga0097620_1000861695 303
108 3300009098 Ga0105245_10390981 Ga0105245_103909812 303
109 3300009101 Ga0105247_10000001 Ga0105247_10000001216 303
110 3300009147 Ga0114129_10354098 Ga0114129_103540982 303
111 3300009148 Ga0105243_10002025 Ga0105243_1000202513 303
112 3300009176 Ga0105242_10004220 Ga0105242_1000422010 303
113 3300009176 Ga0105242_10004974 Ga0105242_100049744 303
114 3300009176 Ga0105242_10238998 Ga0105242_102389982 303
115 3300009177 Ga0105248_10127924 Ga0105248_101279242 303
116 3300009553 Ga0105249_10000107 Ga0105249_1000010735 303
117 3300010375 Ga0105239_10123744 Ga0105239_101237443 303
118 3300013100 Ga0157373_10123041 Ga0157373_101230412 303
119 3300013102 Ga0157371_10105104 Ga0157371_101051042 303
120 3300013297 Ga0157378_10000176 Ga0157378_1000017614 303
121 3300013297 Ga0157378_10055088 Ga0157378_100550881 303
122 3300013297 Ga0157378_10425425 Ga0157378_104254251 303
123 3300013297 Ga0157378_10531564 Ga0157378_105315641 303
124 3300013306 Ga0163162_10000006 Ga0163162_10000006233 303
125 3300013306 Ga0163162_10047954 Ga0163162_100479543 303
126 3300013306 Ga0163162_10098520 Ga0163162_100985203 303
127 3300013306 Ga0163162_10233631 Ga0163162_102336312 303
128 3300013308 Ga0157375_10001758 Ga0157375_1000175811 303
129 3300014968 Ga0157379_10021400 Ga0157379_100214004 303
130 3300017792 Ga0163161_10008832 Ga0163161_100088326 303
131 3300017792 Ga0163161_10188862 Ga0163161_101888622 303
132 3300025223 Ga0207672_1000452 Ga0207672_10004522 303
133 3300025900 Ga0207710_10000003 Ga0207710_10000003421 303
134 3300025905 Ga0207685_10000047 Ga0207685_1000004735 303
135 3300025910 Ga0207684_10001610 Ga0207684_100016106 303
136 3300025917 Ga0207660_10121811 Ga0207660_101218112 303
137 3300025922 Ga0207646_10000681 Ga0207646_1000068125 303
138 3300025922 Ga0207646_10022174 Ga0207646_100221744 303
139 3300025922 Ga0207646_10144689 Ga0207646_101446892 303
140 3300025931 Ga0207644_10000257 Ga0207644_1000025719 303
141 3300025934 Ga0207686_10000030 Ga0207686_10000030129 303
142 3300025934 Ga0207686_10004670 Ga0207686_100046708 303
143 3300025935 Ga0207709_10018212 Ga0207709_100182124 303
144 3300025939 Ga0207665_10000004 Ga0207665_10000004150 303
145 3300025941 Ga0207711_10051973 Ga0207711_100519733 303
146 3300025942 Ga0207689_10007772 Ga0207689_100077728 303
147 3300025942 Ga0207689_10043877 Ga0207689_100438773 303
148 3300025961 Ga0207712_10000085 Ga0207712_1000008567 303
149 3300025972 Ga0207668_10003668 Ga0207668_100036686 303
150 3300026023 Ga0207677_10142419 Ga0207677_101424192 303
151 3300026035 Ga0207703_10000336 Ga0207703_100003362 303
152 3300026035 Ga0207703_10013166 Ga0207703_100131662 303
153 3300026035 Ga0207703_10473764 Ga0207703_104737642 303
154 3300026075 Ga0207708_10114196 Ga0207708_101141962 303
155 3300026118 Ga0207675_100002503 Ga0207675_10000250315 303
156 3300028381 Ga0268264_10012332 Ga0268264_100123322 303
157 3300028381 Ga0268264_10055069 Ga0268264_100550693 303
158 3300032126 Ga0307415_100394739 Ga0307415_1003947391 303
159 3300038996 Ga0242420_008207 Ga0242420_008207_497_1411 303
160 3300041406 Ga0439439_0006736 Ga0439439_0006736_459_1400 303
161 3300044673 Ga0453683_0089348 Ga0453683_0089348_987_1901 303
162 3300045051 Ga0451576_0110442 Ga0451576_0110442_41_955 303
163 3300046475 Ga0495639_0135664 Ga0495639_0135664_24_965 303
164 3300046476 Ga0495662_0130692 Ga0495662_0130692_267_1196 303
165 3300046516 Ga0495628_0371473 Ga0495628_0371473_30_959 303
166 3300048917 Ga0496114_0557465 Ga0496114_0557465_16_930 303
167 3300050507 nmdc:mga05p37_576290_c1 nmdc:mga05p37_576290_c1_273_1187 303
168 3300050512 nmdc:mga0n895_141069_c1 nmdc:mga0n895_141069_c1_20_934 303
169 3300050513 nmdc:mga0rr50_250988_c1 nmdc:mga0rr50_250988_c1_424_1338 303
170 3300050515 nmdc:mga0a205_56437_c1 nmdc:mga0a205_56437_c1_1227_2141 303
171 3300005290 Ga0065712_10008051 Ga0065712_100080511 304
172 3300005293 Ga0065715_10004857 Ga0065715_100048573 304
173 3300005330 Ga0070690_100006141 Ga0070690_1000061411 304
174 3300005330 Ga0070690_100037139 Ga0070690_1000371392 304
175 3300005331 Ga0070670_100575419 Ga0070670_1005754191 304
176 3300005333 Ga0070677_10059292 Ga0070677_100592922 304
177 3300005334 Ga0068869_100013796 Ga0068869_1000137962 304
178 3300005336 Ga0070680_100002480 Ga0070680_1000024806 304
179 3300005337 Ga0070682_100056989 Ga0070682_1000569892 304
180 3300005338 Ga0068868_100035851 Ga0068868_1000358512 304
181 3300005340 Ga0070689_100001207 Ga0070689_10000120710 304
182 3300005340 Ga0070689_100046434 Ga0070689_1000464344 304
183 3300005343 Ga0070687_100008800 Ga0070687_1000088003 304
184 3300005343 Ga0070687_100063555 Ga0070687_1000635552 304
185 3300005345 Ga0070692_10092666 Ga0070692_100926662 304
186 3300005345 Ga0070692_10246732 Ga0070692_102467321 304
187 3300005353 Ga0070669_100066425 Ga0070669_1000664252 304
188 3300005354 Ga0070675_100037759 Ga0070675_1000377595 304
189 3300005355 Ga0070671_100012372 Ga0070671_1000123725 304
190 3300005365 Ga0070688_100002981 Ga0070688_1000029815 304
191 3300005438 Ga0070701_10075930 Ga0070701_100759302 304
192 3300005440 Ga0070705_100015078 Ga0070705_1000150782 304
193 3300005441 Ga0070700_100029174 Ga0070700_1000291742 304
194 3300005444 Ga0070694_100101908 Ga0070694_1001019083 304
195 3300005444 Ga0070694_100122832 Ga0070694_1001228322 304
196 3300005457 Ga0070662_100029005 Ga0070662_1000290053 304
197 3300005458 Ga0070681_10000956 Ga0070681_1000095615 304
198 3300005458 Ga0070681_10121305 Ga0070681_101213053 304
199 3300005459 Ga0068867_100081841 Ga0068867_1000818412 304
200 3300005466 Ga0070685_10021815 Ga0070685_100218152 304
201 3300005467 Ga0070706_100000358 Ga0070706_10000035813 304
202 3300005471 Ga0070698_100005931 Ga0070698_1000059318 304
203 3300005530 Ga0070679_100002026 Ga0070679_1000020268 304
204 3300005536 Ga0070697_100361956 Ga0070697_1003619562 304
205 3300005544 Ga0070686_100002441 Ga0070686_1000024414 304
206 3300005545 Ga0070695_100196935 Ga0070695_1001969352 304
207 3300005546 Ga0070696_100065546 Ga0070696_1000655462 304
208 3300005546 Ga0070696_100110607 Ga0070696_1001106072 304
209 3300005547 Ga0070693_100009683 Ga0070693_1000096834 304
210 3300005547 Ga0070693_100075068 Ga0070693_1000750682 304
211 3300005549 Ga0070704_100386983 Ga0070704_1003869831 304
212 3300005577 Ga0068857_100304425 Ga0068857_1003044252 304
213 3300005578 Ga0068854_100309077 Ga0068854_1003090772 304
214 3300005615 Ga0070702_100032831 Ga0070702_1000328313 304
215 3300005617 Ga0068859_100019388 Ga0068859_1000193888 304
216 3300005617 Ga0068859_100020821 Ga0068859_1000208216 304
217 3300005617 Ga0068859_100098202 Ga0068859_1000982022 304
218 3300005617 Ga0068859_100165631 Ga0068859_1001656312 304
219 3300005618 Ga0068864_100410073 Ga0068864_1004100731 304
220 3300005718 Ga0068866_10045751 Ga0068866_100457512 304
221 3300005719 Ga0068861_100018116 Ga0068861_1000181165 304
222 3300005834 Ga0068851_10001687 Ga0068851_100016879 304
223 3300005841 Ga0068863_100014751 Ga0068863_1000147515 304
224 3300005841 Ga0068863_100355474 Ga0068863_1003554742 304
225 3300005842 Ga0068858_100078020 Ga0068858_1000780202 304
226 3300005843 Ga0068860_100111768 Ga0068860_1001117682 304
227 3300005844 Ga0068862_100022869 Ga0068862_1000228695 304
228 3300006844 Ga0075428_100167962 Ga0075428_1001679622 304
229 3300006846 Ga0075430_100045196 Ga0075430_1000451963 304
230 3300006847 Ga0075431_100032160 Ga0075431_1000321606 304
231 3300006852 Ga0075433_10021661 Ga0075433_100216614 304
232 3300006852 Ga0075433_10059528 Ga0075433_100595283 304
233 3300006852 Ga0075433_10175036 Ga0075433_101750362 304
234 3300006871 Ga0075434_100129327 Ga0075434_1001293272 304
235 3300006880 Ga0075429_100032578 Ga0075429_1000325785 304
236 3300006881 Ga0068865_100014218 Ga0068865_1000142185 304
237 3300006931 Ga0097620_100019388 Ga0097620_1000193888 304
238 3300006931 Ga0097620_100020822 Ga0097620_1000208224 304
239 3300006931 Ga0097620_100098201 Ga0097620_1000982012 304
240 3300006931 Ga0097620_100165628 Ga0097620_1001656282 304
241 3300007076 Ga0075435_100159906 Ga0075435_1001599062 304
242 3300009093 Ga0105240_10042809 Ga0105240_100428093 304
243 3300009094 Ga0111539_10009389 Ga0111539_100093892 304
244 3300009094 Ga0111539_10044639 Ga0111539_100446394 304
245 3300009098 Ga0105245_10010782 Ga0105245_100107823 304
246 3300009147 Ga0114129_10154258 Ga0114129_101542581 304
247 3300009147 Ga0114129_10181484 Ga0114129_101814843 304
248 3300009148 Ga0105243_10168090 Ga0105243_101680902 304
249 3300009174 Ga0105241_10183964 Ga0105241_101839642 304
250 3300009177 Ga0105248_10026181 Ga0105248_100261815 304
251 3300009545 Ga0105237_10006392 Ga0105237_100063923 304
252 3300009553 Ga0105249_10280051 Ga0105249_102800512 304
253 3300010375 Ga0105239_10098522 Ga0105239_100985223 304
254 3300010375 Ga0105239_10314500 Ga0105239_103145001 304
255 3300011119 Ga0105246_10052408 Ga0105246_100524083 304
256 3300013100 Ga0157373_10001131 Ga0157373_100011313 304
257 3300013297 Ga0157378_10001399 Ga0157378_1000139915 304
258 3300013297 Ga0157378_10001720 Ga0157378_100017208 304
259 3300013306 Ga0163162_10027965 Ga0163162_100279652 304
260 3300013306 Ga0163162_10590986 Ga0163162_105909862 304
261 3300013307 Ga0157372_10008816 Ga0157372_100088167 304
262 3300013307 Ga0157372_10012433 Ga0157372_100124336 304
263 3300014325 Ga0163163_10019449 Ga0163163_100194495 304
264 3300014326 Ga0157380_10015572 Ga0157380_100155724 304
265 3300014745 Ga0157377_10005619 Ga0157377_100056194 304
266 3300014969 Ga0157376_10057395 Ga0157376_100573953 304
267 3300017792 Ga0163161_10009081 Ga0163161_100090815 304
268 3300025315 Ga0207697_10012562 Ga0207697_100125622 304
269 3300025321 Ga0207656_10005191 Ga0207656_100051913 304
270 3300025885 Ga0207653_10006563 Ga0207653_100065633 304
271 3300025901 Ga0207688_10083884 Ga0207688_100838842 304
272 3300025910 Ga0207684_10000168 Ga0207684_1000016865 304
273 3300025912 Ga0207707_10000037 Ga0207707_1000003781 304
274 3300025913 Ga0207695_10040145 Ga0207695_100401454 304
275 3300025914 Ga0207671_10002825 Ga0207671_1000282512 304
276 3300025917 Ga0207660_10005412 Ga0207660_100054129 304
277 3300025918 Ga0207662_10002070 Ga0207662_100020707 304
278 3300025921 Ga0207652_10000200 Ga0207652_1000020043 304
279 3300025926 Ga0207659_10101139 Ga0207659_101011392 304
280 3300025927 Ga0207687_10332644 Ga0207687_103326441 304
281 3300025933 Ga0207706_10047044 Ga0207706_100470444 304
282 3300025934 Ga0207686_10004309 Ga0207686_100043097 304
283 3300025935 Ga0207709_10328417 Ga0207709_103284171 304
284 3300025936 Ga0207670_10003565 Ga0207670_100035656 304
285 3300025938 Ga0207704_10414695 Ga0207704_104146951 304
286 3300025940 Ga0207691_10004525 Ga0207691_100045257 304
287 3300025941 Ga0207711_10223436 Ga0207711_102234361 304
288 3300025942 Ga0207689_10007593 Ga0207689_100075937 304
289 3300025961 Ga0207712_10008758 Ga0207712_100087581 304
290 3300025961 Ga0207712_10040329 Ga0207712_100403292 304
291 3300026035 Ga0207703_10052913 Ga0207703_100529134 304
292 3300026075 Ga0207708_10025275 Ga0207708_100252752 304
293 3300026088 Ga0207641_10010800 Ga0207641_100108007 304
294 3300026088 Ga0207641_10333702 Ga0207641_103337022 304
295 3300026089 Ga0207648_10005802 Ga0207648_1000580213 304
296 3300026116 Ga0207674_10313731 Ga0207674_103137312 304
297 3300026118 Ga0207675_100002042 Ga0207675_1000020425 304
298 3300026118 Ga0207675_100075844 Ga0207675_1000758441 304
299 3300026118 Ga0207675_100281427 Ga0207675_1002814272 304
300 3300027907 Ga0207428_10041040 Ga0207428_100410404 304
301 3300028380 Ga0268265_10416207 Ga0268265_104162072 304
302 3300037312 Ga0395899_0187503 Ga0395899_0187503_394_1308 304
303 3300037418 Ga0395900_0395689 Ga0395900_0395689_222_1136 304
304 3300038443 Ga0395901_0098180 Ga0395901_0098180_401_1315 304
305 3300048909 Ga0496106_0276416 Ga0496106_0276416_45_968 304
306 3300050507 nmdc:mga05p37_349666_c1 nmdc:mga05p37_349666_c1_761_1699 304
307 3300050507 nmdc:mga05p37_66358_c1 nmdc:mga05p37_66358_c1_1611_2525 304
308 3300050509 nmdc:mga0qj67_117513_c1 nmdc:mga0qj67_117513_c1_1199_2113 304
309 3300050510 nmdc:mga06r32_101691_c1 nmdc:mga06r32_101691_c1_684_1598 304
310 3300050510 nmdc:mga06r32_38757_c1 nmdc:mga06r32_38757_c1_2174_3112 304
311 3300050511 nmdc:mga08y16_10496_c1 nmdc:mga08y16_10496_c1_8020_8934 304
312 3300050511 nmdc:mga08y16_58233_c1 nmdc:mga08y16_58233_c1_713_1645 304
313 3300050512 nmdc:mga0n895_485263_c1 nmdc:mga0n895_485263_c1_109_1032 304
314 3300050513 nmdc:mga0rr50_146312_c1 nmdc:mga0rr50_146312_c1_919_1842 304
315 3300050513 nmdc:mga0rr50_223971_c1 nmdc:mga0rr50_223971_c1_393_1316 304
316 3300050515 nmdc:mga0a205_17733_c1 nmdc:mga0a205_17733_c1_102_1025 304
317 3300050515 nmdc:mga0a205_57787_c1 nmdc:mga0a205_57787_c1_2359_3273 304
318 3300053153 Ga0500616_0002137 Ga0500616_0002137_7683_8627 304
319 3300000532 CNAas_1000585 CNAas_10005854 305
320 3300002459 JGI24751J29686_10000008 JGI24751J29686_1000000866 305
321 3300002459 JGI24751J29686_10000029 JGI24751J29686_1000002922 305
322 3300003203 JGI25406J46586_10016165 JGI25406J46586_100161654 305
323 3300005288 Ga0065714_10002184 Ga0065714_10002184211 305
324 3300005289 Ga0065704_10019236 Ga0065704_100192362 305
325 3300005290 Ga0065712_10000112 Ga0065712_10000112165 305
326 3300005290 Ga0065712_10068391 Ga0065712_100683917 305
327 3300005293 Ga0065715_10001931 Ga0065715_100019316 305
328 3300005293 Ga0065715_10089752 Ga0065715_100897522 305
329 3300005293 Ga0065715_10089793 Ga0065715_100897936 305
330 3300005293 Ga0065715_10093681 Ga0065715_100936812 305
331 3300005293 Ga0065715_10093762 Ga0065715_100937625 305
332 3300005293 Ga0065715_10113745 Ga0065715_101137452 305
333 3300005293 Ga0065715_10180225 Ga0065715_101802252 305
334 3300005293 Ga0065715_10185231 Ga0065715_101852312 305
335 3300005293 Ga0065715_10315577 Ga0065715_103155771 305
336 3300005330 Ga0070690_100244678 Ga0070690_1002446782 305
337 3300005331 Ga0070670_100000136 Ga0070670_10000013665 305
338 3300005331 Ga0070670_100000441 Ga0070670_10000044116 305
339 3300005331 Ga0070670_100390381 Ga0070670_1003903811 305
340 3300005334 Ga0068869_100015469 Ga0068869_1000154696 305
341 3300005334 Ga0068869_100020343 Ga0068869_1000203431 305
342 3300005334 Ga0068869_100115062 Ga0068869_1001150623 305
343 3300005334 Ga0068869_100270294 Ga0068869_1002702941 305
344 3300005335 Ga0070666_10016258 Ga0070666_100162585 305
345 3300005336 Ga0070680_100089143 Ga0070680_1000891433 305
346 3300005336 Ga0070680_100126791 Ga0070680_1001267911 305
347 3300005337 Ga0070682_100000524 Ga0070682_1000005245 305
348 3300005340 Ga0070689_100078063 Ga0070689_1000780633 305
349 3300005344 Ga0070661_100267260 Ga0070661_1002672602 305
350 3300005345 Ga0070692_10114106 Ga0070692_101141062 305
351 3300005345 Ga0070692_10221910 Ga0070692_102219102 305
352 3300005353 Ga0070669_100018464 Ga0070669_1000184646 305
353 3300005353 Ga0070669_100022032 Ga0070669_1000220322 305
354 3300005354 Ga0070675_100205132 Ga0070675_1002051323 305
355 3300005355 Ga0070671_100004945 Ga0070671_1000049457 305
356 3300005355 Ga0070671_100031819 Ga0070671_1000318193 305
357 3300005355 Ga0070671_100178039 Ga0070671_1001780392 305
358 3300005356 Ga0070674_100112801 Ga0070674_1001128012 305
359 3300005364 Ga0070673_100052782 Ga0070673_1000527822 305
360 3300005364 Ga0070673_100083508 Ga0070673_1000835082 305
361 3300005367 Ga0070667_100015290 Ga0070667_1000152905 305
362 3300005440 Ga0070705_100277560 Ga0070705_1002775601 305
363 3300005441 Ga0070700_100005818 Ga0070700_1000058184 305
364 3300005441 Ga0070700_100011361 Ga0070700_1000113614 305
365 3300005441 Ga0070700_100230486 Ga0070700_1002304862 305
366 3300005444 Ga0070694_100023245 Ga0070694_1000232454 305
367 3300005444 Ga0070694_100135931 Ga0070694_1001359312 305
368 3300005445 Ga0070708_100000455 Ga0070708_10000045523 305
369 3300005445 Ga0070708_100036694 Ga0070708_1000366944 305
370 3300005457 Ga0070662_100127195 Ga0070662_1001271952 305
371 3300005458 Ga0070681_10040975 Ga0070681_100409753 305
372 3300005458 Ga0070681_10092442 Ga0070681_100924423 305
373 3300005459 Ga0068867_100032828 Ga0068867_1000328284 305
374 3300005459 Ga0068867_100154345 Ga0068867_1001543451 305
375 3300005459 Ga0068867_100205392 Ga0068867_1002053922 305
376 3300005467 Ga0070706_100113050 Ga0070706_1001130502 305
377 3300005468 Ga0070707_100089645 Ga0070707_1000896452 305
378 3300005471 Ga0070698_100000720 Ga0070698_1000007208 305
379 3300005471 Ga0070698_100011587 Ga0070698_1000115878 305
380 3300005471 Ga0070698_100016323 Ga0070698_1000163232 305
381 3300005471 Ga0070698_100101515 Ga0070698_1001015152 305
382 3300005518 Ga0070699_100000488 Ga0070699_10000048831 305
383 3300005518 Ga0070699_100002881 Ga0070699_1000028815 305
384 3300005518 Ga0070699_100012643 Ga0070699_1000126434 305
385 3300005518 Ga0070699_100023012 Ga0070699_1000230123 305
386 3300005535 Ga0070684_100176076 Ga0070684_1001760762 305
387 3300005536 Ga0070697_100000109 Ga0070697_10000010924 305
388 3300005536 Ga0070697_100001352 Ga0070697_1000013528 305
389 3300005536 Ga0070697_100070341 Ga0070697_1000703412 305
390 3300005536 Ga0070697_100182072 Ga0070697_1001820722 305
391 3300005536 Ga0070697_100203505 Ga0070697_1002035051 305
392 3300005536 Ga0070697_100459993 Ga0070697_1004599931 305
393 3300005539 Ga0068853_100010391 Ga0068853_1000103911 305
394 3300005539 Ga0068853_100019109 Ga0068853_1000191093 305
395 3300005539 Ga0068853_100252337 Ga0068853_1002523372 305
396 3300005544 Ga0070686_100029278 Ga0070686_1000292784 305
397 3300005545 Ga0070695_100023861 Ga0070695_1000238613 305
398 3300005546 Ga0070696_100036894 Ga0070696_1000368943 305
399 3300005546 Ga0070696_100059260 Ga0070696_1000592603 305
400 3300005546 Ga0070696_100248563 Ga0070696_1002485631 305
401 3300005547 Ga0070693_100004270 Ga0070693_1000042705 305
402 3300005547 Ga0070693_100019333 Ga0070693_1000193332 305
403 3300005547 Ga0070693_100028367 Ga0070693_1000283672 305
404 3300005548 Ga0070665_100093974 Ga0070665_1000939742 305
405 3300005549 Ga0070704_100052511 Ga0070704_1000525113 305
406 3300005549 Ga0070704_100092917 Ga0070704_1000929173 305
407 3300005549 Ga0070704_100134084 Ga0070704_1001340842 305
408 3300005549 Ga0070704_100441549 Ga0070704_1004415491 305
409 3300005563 Ga0068855_100047483 Ga0068855_1000474834 305
410 3300005564 Ga0070664_100014093 Ga0070664_1000140933 305
411 3300005564 Ga0070664_100023076 Ga0070664_1000230764 305
412 3300005564 Ga0070664_100158886 Ga0070664_1001588862 305
413 3300005577 Ga0068857_100070475 Ga0068857_1000704752 305
414 3300005577 Ga0068857_100143019 Ga0068857_1001430191 305
415 3300005578 Ga0068854_100132244 Ga0068854_1001322442 305
416 3300005615 Ga0070702_100079975 Ga0070702_1000799751 305
417 3300005615 Ga0070702_100107582 Ga0070702_1001075821 305
418 3300005616 Ga0068852_100121870 Ga0068852_1001218703 305
419 3300005616 Ga0068852_100414802 Ga0068852_1004148021 305
420 3300005617 Ga0068859_100006153 Ga0068859_1000061535 305
421 3300005617 Ga0068859_100067200 Ga0068859_1000672002 305
422 3300005617 Ga0068859_100076653 Ga0068859_1000766532 305
423 3300005617 Ga0068859_100223522 Ga0068859_1002235221 305
424 3300005617 Ga0068859_100302110 Ga0068859_1003021102 305
425 3300005617 Ga0068859_100435480 Ga0068859_1004354801 305
426 3300005617 Ga0068859_100621561 Ga0068859_1006215611 305
427 3300005618 Ga0068864_100000679 Ga0068864_10000067923 305
428 3300005618 Ga0068864_100004285 Ga0068864_1000042855 305
429 3300005618 Ga0068864_100077115 Ga0068864_1000771153 305
430 3300005618 Ga0068864_100165773 Ga0068864_1001657732 305
431 3300005618 Ga0068864_100339290 Ga0068864_1003392903 305
432 3300005618 Ga0068864_100400909 Ga0068864_1004009092 305
433 3300005718 Ga0068866_10011197 Ga0068866_100111973 305
434 3300005719 Ga0068861_100037071 Ga0068861_1000370716 305
435 3300005719 Ga0068861_100062314 Ga0068861_1000623142 305
436 3300005719 Ga0068861_100299333 Ga0068861_1002993331 305
437 3300005834 Ga0068851_10191516 Ga0068851_101915162 305
438 3300005841 Ga0068863_100052139 Ga0068863_1000521391 305
439 3300005841 Ga0068863_100140903 Ga0068863_1001409031 305
440 3300005841 Ga0068863_100193495 Ga0068863_1001934951 305
441 3300005842 Ga0068858_100036159 Ga0068858_1000361595 305
442 3300005842 Ga0068858_100075620 Ga0068858_1000756202 305
443 3300005843 Ga0068860_100057419 Ga0068860_1000574195 305
444 3300005843 Ga0068860_100063230 Ga0068860_1000632303 305
445 3300005843 Ga0068860_100100867 Ga0068860_1001008673 305
446 3300005844 Ga0068862_100024435 Ga0068862_1000244354 305
447 3300005983 Ga0081540_1039264 Ga0081540_10392642 305
448 3300005985 Ga0081539_10000697 Ga0081539_1000069713 305
449 3300006237 Ga0097621_100001606 Ga0097621_1000016068 305
450 3300006237 Ga0097621_100004434 Ga0097621_1000044343 305
451 3300006358 Ga0068871_100006452 Ga0068871_1000064526 305
452 3300006358 Ga0068871_100026456 Ga0068871_1000264564 305
453 3300006847 Ga0075431_100074007 Ga0075431_1000740074 305
454 3300006852 Ga0075433_10009221 Ga0075433_100092212 305
455 3300006871 Ga0075434_100009348 Ga0075434_1000093482 305
456 3300006871 Ga0075434_100252334 Ga0075434_1002523342 305
457 3300006880 Ga0075429_100226734 Ga0075429_1002267342 305
458 3300006931 Ga0097620_100006152 Ga0097620_10000615211 305
459 3300006931 Ga0097620_100067198 Ga0097620_1000671982 305
460 3300006931 Ga0097620_100076660 Ga0097620_1000766603 305
461 3300006931 Ga0097620_100223541 Ga0097620_1002235411 305
462 3300006931 Ga0097620_100302115 Ga0097620_1003021152 305
463 3300006931 Ga0097620_100435479 Ga0097620_1004354791 305
464 3300006931 Ga0097620_100621548 Ga0097620_1006215481 305
465 3300007076 Ga0075435_100023341 Ga0075435_1000233411 305
466 3300009011 Ga0105251_10074341 Ga0105251_100743412 305
467 3300009093 Ga0105240_10279215 Ga0105240_102792152 305
468 3300009094 Ga0111539_10095139 Ga0111539_100951392 305
469 3300009094 Ga0111539_10158626 Ga0111539_101586262 305
470 3300009094 Ga0111539_10196967 Ga0111539_101969673 305
471 3300009101 Ga0105247_10004251 Ga0105247_100042513 305
472 3300009101 Ga0105247_10062449 Ga0105247_100624492 305
473 3300009147 Ga0114129_10003197 Ga0114129_1000319718 305
474 3300009147 Ga0114129_10028380 Ga0114129_100283803 305
475 3300009147 Ga0114129_10114835 Ga0114129_101148353 305
476 3300009147 Ga0114129_10431576 Ga0114129_104315762 305
477 3300009147 Ga0114129_10581003 Ga0114129_105810032 305
478 3300009148 Ga0105243_10006485 Ga0105243_1000648510 305
479 3300009148 Ga0105243_10132854 Ga0105243_101328541 305
480 3300009174 Ga0105241_10042086 Ga0105241_100420865 305
481 3300009174 Ga0105241_10057362 Ga0105241_100573622 305
482 3300009174 Ga0105241_10392324 Ga0105241_103923242 305
483 3300009174 Ga0105241_10447275 Ga0105241_104472751 305
484 3300009176 Ga0105242_10041696 Ga0105242_100416963 305
485 3300009176 Ga0105242_10374475 Ga0105242_103744752 305
486 3300009177 Ga0105248_10009745 Ga0105248_100097457 305
487 3300009177 Ga0105248_10029526 Ga0105248_100295262 305
488 3300009177 Ga0105248_10032794 Ga0105248_100327945 305
489 3300009177 Ga0105248_10054605 Ga0105248_100546056 305
490 3300009177 Ga0105248_10383283 Ga0105248_103832832 305
491 3300009545 Ga0105237_10031278 Ga0105237_100312782 305
492 3300009545 Ga0105237_10134931 Ga0105237_101349313 305
493 3300009545 Ga0105237_10722213 Ga0105237_107222131 305
494 3300009551 Ga0105238_10017007 Ga0105238_100170076 305
495 3300009551 Ga0105238_10021171 Ga0105238_100211717 305
496 3300009553 Ga0105249_10048917 Ga0105249_100489172 305
497 3300009553 Ga0105249_10094571 Ga0105249_100945713 305
498 3300009553 Ga0105249_10202012 Ga0105249_102020122 305
499 3300009553 Ga0105249_10205214 Ga0105249_102052142 305
500 3300010375 Ga0105239_10495885 Ga0105239_104958851 305
501 3300011119 Ga0105246_10036695 Ga0105246_100366953 305
502 3300013100 Ga0157373_10022534 Ga0157373_100225343 305
503 3300013100 Ga0157373_10099466 Ga0157373_100994662 305
504 3300013100 Ga0157373_10172593 Ga0157373_101725931 305
505 3300013105 Ga0157369_10195986 Ga0157369_101959862 305
506 3300013105 Ga0157369_10250896 Ga0157369_102508962 305
507 3300013296 Ga0157374_10005684 Ga0157374_100056847 305
508 3300013296 Ga0157374_10417297 Ga0157374_104172972 305
509 3300013297 Ga0157378_10000681 Ga0157378_1000068123 305
510 3300013297 Ga0157378_10012967 Ga0157378_100129677 305
511 3300013297 Ga0157378_10041373 Ga0157378_100413734 305
512 3300013297 Ga0157378_10045113 Ga0157378_100451134 305
513 3300013297 Ga0157378_10049614 Ga0157378_100496143 305
514 3300013306 Ga0163162_10000966 Ga0163162_100009669 305
515 3300013306 Ga0163162_10016251 Ga0163162_100162512 305
516 3300013306 Ga0163162_10066061 Ga0163162_100660613 305
517 3300013306 Ga0163162_10362899 Ga0163162_103628991 305
518 3300013308 Ga0157375_10005745 Ga0157375_1000574511 305
519 3300013308 Ga0157375_10005943 Ga0157375_1000594311 305
520 3300013308 Ga0157375_10085500 Ga0157375_100855002 305
521 3300013308 Ga0157375_10125224 Ga0157375_101252242 305
522 3300013308 Ga0157375_10593436 Ga0157375_105934362 305
523 3300014325 Ga0163163_10002791 Ga0163163_1000279112 305
524 3300014325 Ga0163163_10003423 Ga0163163_100034236 305
525 3300014325 Ga0163163_10006276 Ga0163163_100062762 305
526 3300014325 Ga0163163_10006974 Ga0163163_100069749 305
527 3300014325 Ga0163163_10007025 Ga0163163_100070256 305
528 3300014325 Ga0163163_10057894 Ga0163163_100578943 305
529 3300014326 Ga0157380_10001155 Ga0157380_1000115512 305
530 3300014326 Ga0157380_10001325 Ga0157380_100013259 305
531 3300014745 Ga0157377_10061326 Ga0157377_100613263 305
532 3300014969 Ga0157376_10091970 Ga0157376_100919702 305
533 3300015261 Ga0182006_1082602 Ga0182006_10826022 305
534 3300025900 Ga0207710_10000370 Ga0207710_100003702 305
535 3300025903 Ga0207680_10009612 Ga0207680_100096125 305
536 3300025904 Ga0207647_10018148 Ga0207647_100181481 305
537 3300025908 Ga0207643_10004644 Ga0207643_100046441 305
538 3300025910 Ga0207684_10052985 Ga0207684_100529852 305
539 3300025910 Ga0207684_10059965 Ga0207684_100599652 305
540 3300025910 Ga0207684_10209815 Ga0207684_102098152 305
541 3300025911 Ga0207654_10046572 Ga0207654_100465722 305
542 3300025912 Ga0207707_10016470 Ga0207707_100164705 305
543 3300025912 Ga0207707_10265252 Ga0207707_102652522 305
544 3300025913 Ga0207695_10245840 Ga0207695_102458402 305
545 3300025917 Ga0207660_10103717 Ga0207660_101037173 305
546 3300025918 Ga0207662_10030622 Ga0207662_100306223 305
547 3300025923 Ga0207681_10000872 Ga0207681_100008727 305
548 3300025923 Ga0207681_10033469 Ga0207681_100334692 305
549 3300025923 Ga0207681_10109339 Ga0207681_101093392 305
550 3300025924 Ga0207694_10007325 Ga0207694_100073257 305
551 3300025924 Ga0207694_10025798 Ga0207694_100257984 305
552 3300025925 Ga0207650_10000087 Ga0207650_1000008723 305
553 3300025925 Ga0207650_10188201 Ga0207650_101882011 305
554 3300025925 Ga0207650_10199803 Ga0207650_101998032 305
555 3300025931 Ga0207644_10010626 Ga0207644_100106265 305
556 3300025931 Ga0207644_10052688 Ga0207644_100526882 305
557 3300025933 Ga0207706_10044507 Ga0207706_100445073 305
558 3300025934 Ga0207686_10181941 Ga0207686_101819412 305
559 3300025935 Ga0207709_10119984 Ga0207709_101199842 305
560 3300025936 Ga0207670_10134648 Ga0207670_101346481 305
561 3300025936 Ga0207670_10348260 Ga0207670_103482601 305
562 3300025940 Ga0207691_10058065 Ga0207691_100580652 305
563 3300025941 Ga0207711_10006798 Ga0207711_100067987 305
564 3300025941 Ga0207711_10013320 Ga0207711_100133203 305
565 3300025941 Ga0207711_10104501 Ga0207711_101045014 305
566 3300025941 Ga0207711_10165419 Ga0207711_101654192 305
567 3300025942 Ga0207689_10002058 Ga0207689_100020587 305
568 3300025942 Ga0207689_10007728 Ga0207689_100077287 305
569 3300025942 Ga0207689_10092042 Ga0207689_100920422 305
570 3300025945 Ga0207679_10027488 Ga0207679_100274884 305
571 3300025945 Ga0207679_10046674 Ga0207679_100466742 305
572 3300025960 Ga0207651_10054061 Ga0207651_100540613 305
573 3300025960 Ga0207651_10066809 Ga0207651_100668092 305
574 3300025961 Ga0207712_10003498 Ga0207712_100034987 305
575 3300025961 Ga0207712_10023976 Ga0207712_100239762 305
576 3300025961 Ga0207712_10049886 Ga0207712_100498863 305
577 3300025981 Ga0207640_10113978 Ga0207640_101139782 305
578 3300025986 Ga0207658_10028514 Ga0207658_100285143 305
579 3300026035 Ga0207703_10141359 Ga0207703_101413591 305
580 3300026041 Ga0207639_10040920 Ga0207639_100409203 305
581 3300026041 Ga0207639_10200776 Ga0207639_102007762 305
582 3300026041 Ga0207639_10202016 Ga0207639_102020162 305
583 3300026075 Ga0207708_10000407 Ga0207708_1000040723 305
584 3300026075 Ga0207708_10010363 Ga0207708_100103633 305
585 3300026075 Ga0207708_10012137 Ga0207708_100121374 305
586 3300026075 Ga0207708_10021808 Ga0207708_100218085 305
587 3300026075 Ga0207708_10083376 Ga0207708_100833762 305
588 3300026088 Ga0207641_10051036 Ga0207641_100510361 305
589 3300026089 Ga0207648_10095943 Ga0207648_100959433 305
590 3300026095 Ga0207676_10002568 Ga0207676_100025685 305
591 3300026095 Ga0207676_10004535 Ga0207676_100045358 305
592 3300026095 Ga0207676_10009479 Ga0207676_100094797 305
593 3300026095 Ga0207676_10085531 Ga0207676_100855313 305
594 3300026095 Ga0207676_10122650 Ga0207676_101226502 305
595 3300026116 Ga0207674_10012317 Ga0207674_100123175 305
596 3300026116 Ga0207674_10041671 Ga0207674_100416713 305
597 3300026116 Ga0207674_10061516 Ga0207674_100615162 305
598 3300026116 Ga0207674_10068741 Ga0207674_100687414 305
599 3300026116 Ga0207674_10120625 Ga0207674_101206253 305
600 3300026116 Ga0207674_10190838 Ga0207674_101908381 305
601 3300026116 Ga0207674_10611602 Ga0207674_106116021 305
602 3300026118 Ga0207675_100039293 Ga0207675_1000392932 305
603 3300026118 Ga0207675_100051034 Ga0207675_1000510343 305
604 3300026118 Ga0207675_100445826 Ga0207675_1004458262 305
605 3300026118 Ga0207675_100577069 Ga0207675_1005770691 305
606 3300026142 Ga0207698_10068472 Ga0207698_100684723 305
607 3300026142 Ga0207698_10213061 Ga0207698_102130612 305
608 3300027907 Ga0207428_10199752 Ga0207428_101997522 305
609 3300027907 Ga0207428_10223282 Ga0207428_102232822 305
610 3300028379 Ga0268266_10065961 Ga0268266_100659613 305
611 3300028380 Ga0268265_10007156 Ga0268265_100071565 305
612 3300028381 Ga0268264_10061047 Ga0268264_100610471 305
613 3300028381 Ga0268264_10084447 Ga0268264_100844472 305
614 3300028381 Ga0268264_10090291 Ga0268264_100902911 305
615 3300028381 Ga0268264_10181311 Ga0268264_101813112 305
616 3300028381 Ga0268264_10404931 Ga0268264_104049312 305
617 3300031456 Ga0307513_10352076 Ga0307513_103520762 305
618 3300031548 Ga0307408_100037038 Ga0307408_1000370382 305
619 3300031548 Ga0307408_100292577 Ga0307408_1002925772 305
620 3300031731 Ga0307405_10096769 Ga0307405_100967693 305
621 3300031824 Ga0307413_10043237 Ga0307413_100432372 305
622 3300031901 Ga0307406_10005217 Ga0307406_100052173 305
623 3300031995 Ga0307409_100171547 Ga0307409_1001715472 305
624 3300031995 Ga0307409_100313145 Ga0307409_1003131452 305
625 3300032002 Ga0307416_100030004 Ga0307416_1000300045 305
626 3300032002 Ga0307416_100193296 Ga0307416_1001932962 305
627 3300032004 Ga0307414_10043925 Ga0307414_100439252 305
628 3300032005 Ga0307411_10067010 Ga0307411_100670101 305
629 3300035088 Ga0373940_0022120 Ga0373940_0022120_173_1090 305
630 3300035091 Ga0373951_0013750 Ga0373951_0013750_620_1537 305
631 3300035115 Ga0373941_0036489 Ga0373941_0036489_353_1270 305
632 3300035170 Ga0373943_0039383 Ga0373943_0039383_1060_1995 305
633 3300037312 Ga0395899_0349302 Ga0395899_0349302_58_975 305
634 3300038443 Ga0395901_0166555 Ga0395901_0166555_276_1193 305
635 3300038443 Ga0395901_0200318 Ga0395901_0200318_1028_1984 305
636 3300038443 Ga0395901_0213496 Ga0395901_0213496_636_1553 305
637 3300038996 Ga0242420_000152 Ga0242420_000152_1984_2901 305
638 3300042012 Ga0439455_0015858 Ga0439455_0015858_81_998 305
639 3300042157 Ga0439458_0004779 Ga0439458_0004779_1080_1997 305
640 3300045051 Ga0451576_0766432 Ga0451576_0766432_78_995 305
641 3300046512 Ga0495610_0118227 Ga0495610_0118227_70_1029 305
642 3300046616 Ga0495668_0063944 Ga0495668_0063944_839_1798 305
643 3300046684 Ga0495669_0166001 Ga0495669_0166001_78_1025 305
644 3300047320 Ga0495672_0052790 Ga0495672_0052790_449_1399 305
645 3300048911 Ga0496108_0131514 Ga0496108_0131514_755_1672 305
646 3300048915 Ga0496112_0540299 Ga0496112_0540299_11_928 305
647 3300049514 Ga0501291_000942 Ga0501291_000942_2093_3013 305
648 3300049574 Ga0501038_0070356 Ga0501038_0070356_1806_2723 305
649 3300049649 Ga0501198_003004 Ga0501198_003004_10_927 305
650 3300049661 Ga0501217_004334 Ga0501217_004334_1783_2700 305
651 3300049663 Ga0501223_003083 Ga0501223_003083_27_944 305
652 3300049668 Ga0501233_004661 Ga0501233_004661_973_1893 305
653 3300049668 Ga0501233_011994 Ga0501233_011994_532_1449 305
654 3300049686 Ga0501257_046456 Ga0501257_046456_129_1049 305
655 3300049705 Ga0501225_0003210 Ga0501225_0003210_3841_4758 305
656 3300049707 Ga0501234_002615 Ga0501234_002615_1907_2824 305
657 3300049707 Ga0501234_003422 Ga0501234_003422_1151_2068 305
658 3300049765 Ga0501268_010912 Ga0501268_010912_75_995 305
659 3300049853 Ga0501226_002652 Ga0501226_002652_780_1697 305
660 3300050507 nmdc:mga05p37_125154_c1 nmdc:mga05p37_125154_c1_751_1680 305
661 3300050507 nmdc:mga05p37_168938_c1 nmdc:mga05p37_168938_c1_115_1041 305
662 3300050508 nmdc:mga09592_211972_c1 nmdc:mga09592_211972_c1_239_1156 305
663 3300050510 nmdc:mga06r32_376222_c1 nmdc:mga06r32_376222_c1_343_1260 305
664 3300050511 nmdc:mga08y16_104215_c1 nmdc:mga08y16_104215_c1_1944_2882 305
665 3300050511 nmdc:mga08y16_1574_c1 nmdc:mga08y16_1574_c1_10817_11734 305
666 3300050511 nmdc:mga08y16_263690_c1 nmdc:mga08y16_263690_c1_657_1604 305
667 3300050512 nmdc:mga0n895_61474_c1 nmdc:mga0n895_61474_c1_1354_2271 305
668 3300050513 nmdc:mga0rr50_27553_c1 nmdc:mga0rr50_27553_c1_48_965 305
669 3300050515 nmdc:mga0a205_89118_c1 nmdc:mga0a205_89118_c1_771_1697 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

37

168

0.85

PF13732

DUF4162

Domain of unknown function (DUF4162)

221

307

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.9256 2 227
1l2t-assembly1.cif.gz_B dimeric structure of mj0796, a bacterial abc transporter cassette 0.9149 4 224
3tif-assembly1.cif.gz_B dimeric structure of a post-hydrolysis state of the atp-binding cassette mj0796 bound to adp and pi 0.9088 4 224
7dd0-assembly1.cif.gz_C crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.9081 2 227
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9062 4 227
ID Description Score Start End Superfamily
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9456 2 230 3.40.50.300
af_A0A0R0KIK5_1390_1640_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9408 2 228 3.40.50.300
af_A4HV32_726_961_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9406 2 231 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9399 2 228 3.40.50.300
af_Q555Z5_479_734_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9383 1 228 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1D2R6P7-F1-model_v4 ABC transporter domain-containing protein 0.9461 4 228 GO:0005524
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9449 1 227 GO:0005524
GO:0016887
AF-A0A2E7MAK6-F1-model_v4 3-dehydroquinate dehydratase 0.9385 4 228 GO:0005524
GO:0016887
AF-I0HK58-F1-model_v4 Sodium ABC transporter ATP-binding protein NatA 0.9382 4 228 GO:0005524
GO:0005886
GO:0016887
AF-A0A7W7BQI4-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9364 1 228 GO:0005524
GO:0016887
GO:0046677

Feature Viewer

pLDDT pTM Quality
88.95 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map