F474077

General Info

Members Datasets Scaffolds Average Seq Length
670 320 670 140

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10660660|Ga0105243_106606602
Length 166
Sequence MTFAGADETSRNKDQLNSMSTKKENRFIQPYLFFNGRCEEAVEFYRKALGAEVEIMMRFKDSPEPHQPGMVPPGFENKIMHTSFHIGETTVMASDGCSAEKPSFQGFSLSLSVPSESEADRAFAALAEAGQVRMPLTKTFWSPRFGMVADRFGIGWMITVPPAGQN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
184 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
199 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
213 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
252 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
253 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 0.75
Rhizosphere 97.91
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3656236 2162886007 Bacteria 944
2 MBSR1b_contig_13185514 2162886012 Bacteria 866
3 JGI24033J26618_1027880 3300002155 Bacteria 749
4 rootH2_10179150 3300003320 Unclassified 1123
5 Ga0065714_10282279 3300005288 Bacteria 721
6 Ga0065704_10137463 3300005289 Bacteria 1552
7 Ga0065707_10097886 3300005295 Bacteria 3132
8 Ga0070658_11985808 3300005327 Unclassified 502
9 Ga0070676_10006697 3300005328 Bacteria 6173
10 Ga0070676_10460829 3300005328 Bacteria 896
11 Ga0070683_100057726 3300005329 Bacteria 3606
12 Ga0070683_100670578 3300005329 Bacteria 993
13 Ga0070683_101492597 3300005329 Bacteria 650
14 Ga0070690_100103505 3300005330 Bacteria 1890
15 Ga0070690_100673285 3300005330 Bacteria 792
16 Ga0070690_100770067 3300005330 Unclassified 744
17 Ga0070670_100254993 3300005331 Bacteria 1529
18 Ga0070670_100446621 3300005331 Bacteria 1145
19 Ga0070677_10005945 3300005333 Bacteria 4044
20 Ga0070677_10245231 3300005333 Bacteria 886
21 Ga0068869_100006593 3300005334 Bacteria 7367
22 Ga0070666_10021060 3300005335 Bacteria 4222
23 Ga0070680_100307228 3300005336 Bacteria 1345
24 Ga0070680_101132707 3300005336 Unclassified 676
25 Ga0068868_100051356 3300005338 Bacteria 3243
26 Ga0068868_100454666 3300005338 Bacteria 1114
27 Ga0068868_100996147 3300005338 Bacteria 766
28 Ga0068868_102013559 3300005338 Bacteria 548
29 Ga0070689_100104977 3300005340 Bacteria 2240
30 Ga0070689_100502165 3300005340 Bacteria 1039
31 Ga0070689_101337257 3300005340 Unclassified 646
32 Ga0070691_10011578 3300005341 Bacteria 4031
33 Ga0070687_100451693 3300005343 Bacteria 855
34 Ga0070687_100600573 3300005343 Bacteria 756
35 Ga0070692_10062733 3300005345 Bacteria 1962
36 Ga0070692_10548203 3300005345 Bacteria 757
37 Ga0070668_101279098 3300005347 Unclassified 666
38 Ga0070669_100171774 3300005353 Bacteria 1690
39 Ga0070669_100284802 3300005353 Bacteria 1325
40 Ga0070675_100191262 3300005354 Bacteria 1773
41 Ga0070675_100517451 3300005354 Bacteria 1076
42 Ga0070675_102000350 3300005354 Unclassified 534
43 Ga0070671_100028460 3300005355 Bacteria 4602
44 Ga0070671_100075823 3300005355 Bacteria 2810
45 Ga0070671_100255328 3300005355 Bacteria 1489
46 Ga0070671_100761636 3300005355 Bacteria 842
47 Ga0070674_100113001 3300005356 Bacteria 1997
48 Ga0070674_100113445 3300005356 Bacteria 1994
49 Ga0070673_100465860 3300005364 Bacteria 1138
50 Ga0070688_100269385 3300005365 Bacteria 1219
51 Ga0070688_101673864 3300005365 Bacteria 520
52 Ga0070659_101128373 3300005366 Bacteria 692
53 Ga0070667_100280869 3300005367 Bacteria 1495
54 Ga0070667_100737629 3300005367 Bacteria 913
55 Ga0070667_101257158 3300005367 Bacteria 693
56 Ga0070703_10129479 3300005406 Bacteria 925
57 Ga0070709_10455873 3300005434 Bacteria 964
58 Ga0070709_10813712 3300005434 Bacteria 734
59 Ga0070714_100004720 3300005435 Bacteria 10309
60 Ga0070714_100191167 3300005435 Bacteria 1868
61 Ga0070714_100956092 3300005435 Unclassified 833
62 Ga0070714_101262542 3300005435 Bacteria 721
63 Ga0070713_100713031 3300005436 Unclassified 958
64 Ga0070713_101811134 3300005436 Bacteria 592
65 Ga0070710_10076220 3300005437 Bacteria 1946
66 Ga0070701_10577749 3300005438 Unclassified 741
67 Ga0070701_10584205 3300005438 Bacteria 737
68 Ga0070711_100160343 3300005439 Bacteria 1705
69 Ga0070705_100015637 3300005440 Bacteria 3927
70 Ga0070700_100251410 3300005441 Bacteria 1268
71 Ga0070700_100302460 3300005441 Bacteria 1168
72 Ga0070694_100796156 3300005444 Unclassified 775
73 Ga0070708_100041235 3300005445 Bacteria 4047
74 Ga0070708_100341698 3300005445 Bacteria 1411
75 Ga0070708_100750149 3300005445 Bacteria 918
76 Ga0070663_100711116 3300005455 Bacteria 855
77 Ga0070678_100134872 3300005456 Bacteria 1967
78 Ga0070678_100349560 3300005456 Bacteria 1271
79 Ga0070678_101315180 3300005456 Bacteria 673
80 Ga0070662_100169171 3300005457 Bacteria 1715
81 Ga0070662_100228439 3300005457 Bacteria 1488
82 Ga0070662_100252671 3300005457 Bacteria 1418
83 Ga0070681_10099661 3300005458 Bacteria 2851
84 Ga0070681_10545646 3300005458 Bacteria 1073
85 Ga0070681_10972983 3300005458 Bacteria 768
86 Ga0068867_100039383 3300005459 Bacteria 3446
87 Ga0068867_100120300 3300005459 Bacteria 2029
88 Ga0068867_100162813 3300005459 Bacteria 1760
89 Ga0070685_10247387 3300005466 Bacteria 1179
90 Ga0070706_100108905 3300005467 Bacteria 2577
91 Ga0070706_100154369 3300005467 Bacteria 2143
92 Ga0070707_100029338 3300005468 Bacteria 5238
93 Ga0070707_100082110 3300005468 Bacteria 3112
94 Ga0070707_101571094 3300005468 Bacteria 625
95 Ga0070698_100010681 3300005471 Bacteria 9783
96 Ga0070698_100407519 3300005471 Bacteria 1293
97 Ga0070698_100605363 3300005471 Bacteria 1036
98 Ga0070699_100801640 3300005518 Unclassified 862
99 Ga0070679_100289260 3300005530 Bacteria 1590
100 Ga0070679_100442045 3300005530 Bacteria 1245
101 Ga0070684_101413003 3300005535 Unclassified 655
102 Ga0070697_100048365 3300005536 Bacteria 3448
103 Ga0070697_100476468 3300005536 Bacteria 1090
104 Ga0068853_101518488 3300005539 Bacteria 649
105 Ga0070672_100042667 3300005543 Bacteria 3493
106 Ga0070672_100064861 3300005543 Bacteria 2887
107 Ga0070686_100049183 3300005544 Bacteria 2674
108 Ga0070695_100689810 3300005545 Bacteria 810
109 Ga0070695_101092125 3300005545 Bacteria 652
110 Ga0070696_100405936 3300005546 Bacteria 1067
111 Ga0070696_100496446 3300005546 Bacteria 970
112 Ga0070696_100560636 3300005546 Bacteria 916
113 Ga0070693_100154340 3300005547 Bacteria 1457
114 Ga0070693_100665073 3300005547 Bacteria 759
115 Ga0070665_100000213 3300005548 Bacteria 100019
116 Ga0070665_100224024 3300005548 Bacteria 1881
117 Ga0070665_100270395 3300005548 Unclassified 1701
118 Ga0070665_100581028 3300005548 Unclassified 1133
119 Ga0070704_100122532 3300005549 Bacteria 2000
120 Ga0070704_100165672 3300005549 Bacteria 1752
121 Ga0070704_100845743 3300005549 Unclassified 820
122 Ga0068855_100416113 3300005563 Bacteria 1471
123 Ga0068855_101117399 3300005563 Bacteria 823
124 Ga0070664_100354320 3300005564 Bacteria 1336
125 Ga0070664_100785045 3300005564 Unclassified 890
126 Ga0068857_101221424 3300005577 Bacteria 728
127 Ga0068854_101520972 3300005578 Bacteria 608
128 Ga0068856_100046850 3300005614 Bacteria 4258
129 Ga0070702_100009578 3300005615 Bacteria 4748
130 Ga0068852_100468748 3300005616 Bacteria 1250
131 Ga0068852_101723331 3300005616 Bacteria 649
132 Ga0068859_100065189 3300005617 Bacteria 3677
133 Ga0068859_100399868 3300005617 Bacteria 1470
134 Ga0068859_100520746 3300005617 Bacteria 1284
135 Ga0068864_100129379 3300005618 Bacteria 2266
136 Ga0068864_100570896 3300005618 Bacteria 1095
137 Ga0068866_10262125 3300005718 Bacteria 1063
138 Ga0068866_11044219 3300005718 Bacteria 583
139 Ga0068866_11147425 3300005718 Bacteria 559
140 Ga0068861_100093020 3300005719 Bacteria 2383
141 Ga0068851_10692184 3300005834 Bacteria 627
142 Ga0068851_10859940 3300005834 Bacteria 566
143 Ga0068870_10084739 3300005840 Bacteria 1760
144 Ga0068863_100008248 3300005841 Bacteria 10178
145 Ga0068863_100059673 3300005841 Bacteria 3609
146 Ga0068863_102259039 3300005841 Bacteria 554
147 Ga0068858_100050595 3300005842 Bacteria 3845
148 Ga0068860_100065520 3300005843 Bacteria 3450
149 Ga0068862_100324760 3300005844 Bacteria 1421
150 Ga0068862_101102400 3300005844 Bacteria 789
151 Ga0068862_101252450 3300005844 Unclassified 742
152 Ga0081455_10001038 3300005937 Bacteria 35067
153 Ga0081455_10254376 3300005937 Bacteria 1283
154 Ga0081538_10005463 3300005981 Bacteria 11415
155 Ga0081538_10021530 3300005981 Bacteria 4701
156 Ga0081538_10335284 3300005981 Bacteria 549
157 Ga0081540_1138026 3300005983 Bacteria 984
158 Ga0070717_10021015 3300006028 Bacteria 5142
159 Ga0075363_100308751 3300006048 Bacteria 919
160 Ga0070716_100063940 3300006173 Bacteria 2138
161 Ga0075362_10253828 3300006177 Bacteria 865
162 Ga0075427_10025225 3300006194 Bacteria 958
163 Ga0075366_10026233 3300006195 Bacteria 3411
164 Ga0075366_10074178 3300006195 Bacteria 2028
165 Ga0097621_100107358 3300006237 Bacteria 2356
166 Ga0097621_100622818 3300006237 Bacteria 988
167 Ga0068871_100890579 3300006358 Bacteria 824
168 Ga0075428_100033970 3300006844 Bacteria 5627
169 Ga0075428_100146614 3300006844 Bacteria 2565
170 Ga0075428_100333119 3300006844 Bacteria 1630
171 Ga0075428_100879519 3300006844 Bacteria 951
172 Ga0075428_101163997 3300006844 Bacteria 813
173 Ga0075428_101836071 3300006844 Bacteria 630
174 Ga0075430_100034821 3300006846 Bacteria 4274
175 Ga0075430_100086200 3300006846 Bacteria 2629
176 Ga0075430_100104588 3300006846 Bacteria 2363
177 Ga0075431_100004030 3300006847 Bacteria 14308
178 Ga0075431_100021493 3300006847 Bacteria 6600
179 Ga0075431_100716502 3300006847 Bacteria 977
180 Ga0075431_101231338 3300006847 Bacteria 711
181 Ga0075433_10000563 3300006852 Bacteria 24441
182 Ga0075433_10335548 3300006852 Bacteria 1336
183 Ga0075433_10344199 3300006852 Bacteria 1318
184 Ga0075433_11686332 3300006852 Bacteria 546
185 Ga0075434_100007123 3300006871 Bacteria 10331
186 Ga0075434_100027156 3300006871 Bacteria 5617
187 Ga0075434_100176498 3300006871 Bacteria 2156
188 Ga0075434_100686298 3300006871 Bacteria 1042
189 Ga0075434_100901216 3300006871 Bacteria 899
190 Ga0075429_100028261 3300006880 Bacteria 4870
191 Ga0075429_101109440 3300006880 Bacteria 691
192 Ga0075429_101337146 3300006880 Bacteria 624
193 Ga0075429_101360632 3300006880 Unclassified 619
194 Ga0075429_101615048 3300006880 Bacteria 563
195 Ga0068865_100056205 3300006881 Bacteria 2741
196 Ga0068865_100082112 3300006881 Bacteria 2316
197 Ga0068865_101395657 3300006881 Unclassified 625
198 Ga0075436_100086008 3300006914 Bacteria 2183
199 Ga0075436_100192897 3300006914 Bacteria 1442
200 Ga0075436_100284912 3300006914 Bacteria 1182
201 Ga0097620_100065193 3300006931 Bacteria 3677
202 Ga0097620_100399868 3300006931 Bacteria 1470
203 Ga0097620_100520704 3300006931 Bacteria 1284
204 Ga0075435_100074197 3300007076 Bacteria 2782
205 Ga0075435_100136640 3300007076 Bacteria 2054
206 Ga0075435_100153599 3300007076 Bacteria 1936
207 Ga0105240_10527188 3300009093 Bacteria 1310
208 Ga0111539_10152367 3300009094 Bacteria 2706
209 Ga0111539_10448084 3300009094 Unclassified 1503
210 Ga0111539_10506146 3300009094 Bacteria 1407
211 Ga0111539_11064073 3300009094 Bacteria 940
212 Ga0111539_12854796 3300009094 Bacteria 559
213 Ga0105245_10353838 3300009098 Bacteria 1456
214 Ga0105245_11854281 3300009098 Unclassified 656
215 Ga0105247_10293878 3300009101 Bacteria 1125
216 Ga0105247_11414443 3300009101 Bacteria 563
217 Ga0114129_10001057 3300009147 Bacteria 36115
218 Ga0114129_10002853 3300009147 Bacteria 24169
219 Ga0114129_10064442 3300009147 Bacteria 5114
220 Ga0114129_10389415 3300009147 Bacteria 1839
221 Ga0114129_10833197 3300009147 Bacteria 1174
222 Ga0114129_11334113 3300009147 Bacteria 888
223 Ga0114129_11398260 3300009147 Bacteria 863
224 Ga0114129_11604281 3300009147 Bacteria 796
225 Ga0114129_12128998 3300009147 Bacteria 676
226 Ga0114129_12283945 3300009147 Unclassified 650
227 Ga0114129_13108299 3300009147 Bacteria 542
228 Ga0105243_10302239 3300009148 Bacteria 1451
229 Ga0105243_10660660 3300009148 Bacteria 1014
230 Ga0105241_10965480 3300009174 Bacteria 795
231 Ga0105242_10124258 3300009176 Bacteria 2219
232 Ga0105242_10182571 3300009176 Bacteria 1852
233 Ga0105248_10011418 3300009177 Bacteria 9789
234 Ga0105248_10105975 3300009177 Bacteria 3170
235 Ga0105238_10018245 3300009551 Bacteria 7137
236 Ga0105249_10118923 3300009553 Bacteria 2509
237 Ga0105249_10189724 3300009553 Bacteria 2005
238 Ga0105249_12300166 3300009553 Bacteria 612
239 Ga0099796_10080296 3300010159 Bacteria 1195
240 Ga0099796_10299585 3300010159 Bacteria 681
241 Ga0105239_10160510 3300010375 Bacteria 2511
242 Ga0105239_11120665 3300010375 Bacteria 906
243 Ga0105239_12367018 3300010375 Bacteria 618
244 Ga0105246_10070025 3300011119 Bacteria 2466
245 Ga0105246_10237977 3300011119 Bacteria 1438
246 Ga0105246_11284024 3300011119 Bacteria 678
247 Ga0157370_10138398 3300013104 Bacteria 2268
248 Ga0157369_10125280 3300013105 Bacteria 2724
249 Ga0157374_10165330 3300013296 Bacteria 2156
250 Ga0157374_10210725 3300013296 Bacteria 1905
251 Ga0157374_10225191 3300013296 Bacteria 1841
252 Ga0157374_10438900 3300013296 Bacteria 1306
253 Ga0157378_10030129 3300013297 Bacteria 4794
254 Ga0157378_10113850 3300013297 Bacteria 2484
255 Ga0157378_10847352 3300013297 Bacteria 942
256 Ga0157372_10013791 3300013307 Bacteria 8636
257 Ga0157372_10105472 3300013307 Bacteria 3223
258 Ga0157375_10000111 3300013308 Bacteria 79589
259 Ga0157375_10048135 3300013308 Bacteria 4168
260 Ga0157375_10078285 3300013308 Bacteria 3338
261 Ga0157375_10117523 3300013308 Bacteria 2765
262 Ga0157375_10493520 3300013308 Bacteria 1389
263 Ga0157375_13247026 3300013308 Unclassified 542
264 Ga0163163_10789135 3300014325 Bacteria 1013
265 Ga0163163_11189296 3300014325 Bacteria 825
266 Ga0157379_10015814 3300014968 Bacteria 6630
267 Ga0157379_10457428 3300014968 Bacteria 1179
268 Ga0157376_10449346 3300014969 Bacteria 1257
269 Ga0163161_10405754 3300017792 Bacteria 1094
270 Ga0163161_10451046 3300017792 Bacteria 1040
271 Ga0207697_10324372 3300025315 Bacteria 683
272 Ga0207656_10564555 3300025321 Bacteria 580
273 Ga0207682_10056075 3300025893 Bacteria 1640
274 Ga0207688_10010225 3300025901 Bacteria 5108
275 Ga0207680_10010143 3300025903 Bacteria 4701
276 Ga0207685_10201061 3300025905 Bacteria 936
277 Ga0207685_10438866 3300025905 Bacteria 677
278 Ga0207645_10004849 3300025907 Bacteria 9876
279 Ga0207643_10060709 3300025908 Bacteria 2159
280 Ga0207643_10093008 3300025908 Bacteria 1760
281 Ga0207684_10099871 3300025910 Bacteria 2479
282 Ga0207684_10153184 3300025910 Bacteria 1984
283 Ga0207684_10490460 3300025910 Bacteria 1053
284 Ga0207684_11356458 3300025910 Unclassified 584
285 Ga0207654_10747114 3300025911 Bacteria 705
286 Ga0207707_10285019 3300025912 Bacteria 1430
287 Ga0207695_10046527 3300025913 Bacteria 4599
288 Ga0207693_10062934 3300025915 Bacteria 2907
289 Ga0207660_10277645 3300025917 Bacteria 1329
290 Ga0207662_10277776 3300025918 Bacteria 1107
291 Ga0207662_10728406 3300025918 Bacteria 696
292 Ga0207662_10911090 3300025918 Bacteria 623
293 Ga0207649_11621418 3300025920 Bacteria 512
294 Ga0207652_10370143 3300025921 Bacteria 1293
295 Ga0207646_10040212 3300025922 Bacteria 4206
296 Ga0207646_10065229 3300025922 Bacteria 3251
297 Ga0207646_11251808 3300025922 Bacteria 649
298 Ga0207694_10053367 3300025924 Bacteria 3134
299 Ga0207650_10003791 3300025925 Bacteria 10339
300 Ga0207650_10126538 3300025925 Bacteria 1995
301 Ga0207659_10038703 3300025926 Bacteria 3319
302 Ga0207659_10155406 3300025926 Bacteria 1790
303 Ga0207659_10265962 3300025926 Bacteria 1397
304 Ga0207687_10364018 3300025927 Bacteria 1181
305 Ga0207687_11272338 3300025927 Unclassified 632
306 Ga0207700_11011003 3300025928 Unclassified 744
307 Ga0207664_10003657 3300025929 Bacteria 10301
308 Ga0207664_10451878 3300025929 Bacteria 1147
309 Ga0207664_11091830 3300025929 Bacteria 713
310 Ga0207644_10014819 3300025931 Bacteria 5226
311 Ga0207644_10054631 3300025931 Bacteria 2877
312 Ga0207644_10074166 3300025931 Bacteria 2497
313 Ga0207706_10350969 3300025933 Bacteria 1283
314 Ga0207706_10504641 3300025933 Bacteria 1044
315 Ga0207686_10004561 3300025934 Bacteria 7423
316 Ga0207670_10116145 3300025936 Unclassified 1937
317 Ga0207670_10352971 3300025936 Bacteria 1165
318 Ga0207670_11943425 3300025936 Bacteria 500
319 Ga0207669_10155085 3300025937 Bacteria 1609
320 Ga0207669_10297584 3300025937 Bacteria 1225
321 Ga0207704_10010162 3300025938 Bacteria 4576
322 Ga0207704_10248624 3300025938 Bacteria 1333
323 Ga0207665_10386809 3300025939 Bacteria 1063
324 Ga0207691_10045532 3300025940 Bacteria 4032
325 Ga0207691_10103612 3300025940 Bacteria 2537
326 Ga0207691_10407093 3300025940 Bacteria 1160
327 Ga0207711_10011139 3300025941 Bacteria 7473
328 Ga0207711_10473394 3300025941 Bacteria 1167
329 Ga0207689_10086096 3300025942 Bacteria 2583
330 Ga0207661_10041605 3300025944 Bacteria 3618
331 Ga0207661_10170911 3300025944 Bacteria 1892
332 Ga0207661_10861483 3300025944 Bacteria 834
333 Ga0207679_10807060 3300025945 Bacteria 856
334 Ga0207651_10361960 3300025960 Bacteria 1224
335 Ga0207651_10369113 3300025960 Bacteria 1213
336 Ga0207712_10242359 3300025961 Bacteria 1453
337 Ga0207712_11718799 3300025961 Bacteria 562
338 Ga0207668_11247361 3300025972 Bacteria 669
339 Ga0207640_10922796 3300025981 Bacteria 764
340 Ga0207658_10039086 3300025986 Bacteria 3422
341 Ga0207658_10146762 3300025986 Bacteria 1917
342 Ga0207658_10680917 3300025986 Bacteria 928
343 Ga0207658_11366225 3300025986 Bacteria 648
344 Ga0207658_11868426 3300025986 Bacteria 547
345 Ga0207677_10036461 3300026023 Bacteria 3205
346 Ga0207677_10497984 3300026023 Bacteria 1053
347 Ga0207677_11386508 3300026023 Bacteria 647
348 Ga0207703_10617354 3300026035 Bacteria 1026
349 Ga0207678_10227492 3300026067 Bacteria 1597
350 Ga0207678_10913400 3300026067 Unclassified 776
351 Ga0207678_11165037 3300026067 Bacteria 682
352 Ga0207708_10054534 3300026075 Bacteria 3048
353 Ga0207708_10149509 3300026075 Bacteria 1837
354 Ga0207702_10135629 3300026078 Bacteria 2220
355 Ga0207641_10015592 3300026088 Bacteria 6228
356 Ga0207641_10037704 3300026088 Bacteria 4038
357 Ga0207641_10040804 3300026088 Bacteria 3888
358 Ga0207648_10020832 3300026089 Bacteria 5903
359 Ga0207648_10050253 3300026089 Bacteria 3646
360 Ga0207648_10095534 3300026089 Bacteria 2600
361 Ga0207676_10002193 3300026095 Bacteria 14076
362 Ga0207676_10461096 3300026095 Bacteria 1200
363 Ga0207676_10519004 3300026095 Bacteria 1134
364 Ga0207676_10782828 3300026095 Bacteria 929
365 Ga0207675_100458575 3300026118 Bacteria 1264
366 Ga0207683_10009965 3300026121 Bacteria 8107
367 Ga0207683_10498849 3300026121 Bacteria 1124
368 Ga0207683_10766097 3300026121 Bacteria 895
369 Ga0207698_11121233 3300026142 Bacteria 800
370 Ga0207698_11199623 3300026142 Bacteria 773
371 Ga0207698_11904645 3300026142 Bacteria 609
372 Ga0207428_10497186 3300027907 Bacteria 886
373 Ga0207428_10619363 3300027907 Bacteria 779
374 Ga0268266_10000235 3300028379 Bacteria 94600
375 Ga0268266_10095516 3300028379 Bacteria 2611
376 Ga0268266_10228718 3300028379 Unclassified 1712
377 Ga0268266_10356960 3300028379 Bacteria 1375
378 Ga0268266_10397223 3300028379 Bacteria 1303
379 Ga0268266_10404554 3300028379 Bacteria 1291
380 Ga0268266_11949731 3300028379 Bacteria 561
381 Ga0268265_10754321 3300028380 Unclassified 945
382 Ga0268265_11062208 3300028380 Unclassified 802
383 Ga0268264_10189181 3300028381 Bacteria 1875
384 Ga0268264_11839185 3300028381 Bacteria 616
385 Ga0265334_10099086 3300028573 Bacteria 1057
386 Ga0265318_10030913 3300028577 Bacteria 2080
387 Ga0265323_10012238 3300028653 Bacteria 3446
388 Ga0265336_10147173 3300028666 Bacteria 701
389 Ga0265338_10003888 3300028800 Bacteria 20654
390 Ga0265338_10006496 3300028800 Bacteria 14868
391 Ga0265338_10031473 3300028800 Bacteria 5201
392 Ga0265338_10231801 3300028800 Unclassified 1373
393 Ga0265338_10237743 3300028800 Bacteria 1351
394 Ga0265338_10822887 3300028800 Bacteria 635
395 Ga0265330_10008764 3300031235 Bacteria 4847
396 Ga0265332_10073987 3300031238 Bacteria 1449
397 Ga0265328_10004615 3300031239 Bacteria 5965
398 Ga0265328_10005251 3300031239 Bacteria 5562
399 Ga0265320_10091412 3300031240 Bacteria 1409
400 Ga0265325_10004125 3300031241 Bacteria 9241
401 Ga0265329_10073748 3300031242 Bacteria 1080
402 Ga0265339_10003464 3300031249 Bacteria 11037
403 Ga0265339_10183160 3300031249 Bacteria 1042
404 Ga0265339_10324857 3300031249 Bacteria 729
405 Ga0265331_10001550 3300031250 Bacteria 16851
406 Ga0265331_10013174 3300031250 Bacteria 4452
407 Ga0265327_10098150 3300031251 Bacteria 1418
408 Ga0265327_10139810 3300031251 Bacteria 1132
409 Ga0265316_10104668 3300031344 Bacteria 2148
410 Ga0265316_10171011 3300031344 Bacteria 1621
411 Ga0307408_100237898 3300031548 Bacteria 1495
412 Ga0307408_100676921 3300031548 Bacteria 925
413 Ga0265313_10003585 3300031595 Bacteria 12487
414 Ga0265313_10017323 3300031595 Bacteria 4100
415 Ga0307508_10000191 3300031616 Bacteria 74025
416 Ga0316575_10079749 3300031665 Bacteria 1320
417 Ga0265314_10000948 3300031711 Bacteria 34109
418 Ga0265342_10033300 3300031712 Bacteria 3169
419 Ga0265342_10060308 3300031712 Bacteria 2237
420 Ga0265342_10080744 3300031712 Bacteria 1879
421 Ga0307405_10013515 3300031731 Bacteria 4358
422 Ga0307410_10121511 3300031852 Bacteria 1905
423 Ga0307406_10016265 3300031901 Bacteria 4321
424 Ga0307407_10073603 3300031903 Bacteria 2042
425 Ga0307412_12283486 3300031911 Bacteria 505
426 Ga0307409_100090527 3300031995 Bacteria 2505
427 Ga0307409_100223826 3300031995 Bacteria 1700
428 Ga0307416_100021690 3300032002 Bacteria 4618
429 Ga0307416_100072122 3300032002 Bacteria 2873
430 Ga0307416_102103371 3300032002 Bacteria 666
431 Ga0307414_10358594 3300032004 Bacteria 1254
432 Ga0307411_10069496 3300032005 Bacteria 2379
433 Ga0307415_100023898 3300032126 Bacteria 3805
434 Ga0307415_102317834 3300032126 Bacteria 527
435 Ga0373958_0122844 3300034819 Bacteria 629
436 Ga0373926_0221978 3300035083 Bacteria 730
437 Ga0373923_0286571 3300035111 Bacteria 777
438 Ga0373923_0352098 3300035111 Bacteria 703
439 Ga0373936_0047766 3300035113 Bacteria 1727
440 Ga0373939_0059637 3300035114 Bacteria 1211
441 Ga0373945_0255923 3300035116 Unclassified 740
442 Ga0373953_0242552 3300035117 Bacteria 782
443 Ga0373954_0034522 3300035118 Unclassified 2343
444 Ga0373956_0021865 3300035119 Bacteria 2731
445 Ga0373946_0080081 3300035171 Bacteria 1428
446 Ga0373946_0359939 3300035171 Unclassified 729
447 Ga0373955_0211557 3300035172 Unclassified 1156
448 Ga0373924_0099196 3300035410 Bacteria 1252
449 Ga0373924_0404555 3300035410 Unclassified 610
450 Ga0373935_0017087 3300035692 Bacteria 4395
451 Ga0373935_0145270 3300035692 Bacteria 1605
452 Ga0373927_0023279 3300035695 Bacteria 4057
453 Ga0373927_1010937 3300035695 Unclassified 548
454 Ga0373933_0056585 3300035724 Bacteria 2355
455 Ga0373947_0006717 3300035725 Bacteria 6674
456 Ga0373947_0357300 3300035725 Bacteria 981
457 Ga0373947_1262779 3300035725 Bacteria 503
458 Ga0373937_0082838 3300036401 Bacteria 2968
459 Ga0373937_0198114 3300036401 Bacteria 1888
460 Ga0373937_0377890 3300036401 Bacteria 1343
461 Ga0373937_1136852 3300036401 Bacteria 730
462 Ga0373937_1483469 3300036401 Unclassified 626
463 Ga0373925_0002783 3300037068 Bacteria 13812
464 Ga0373925_0013259 3300037068 Bacteria 5965
465 Ga0373925_0178458 3300037068 Bacteria 1680
466 Ga0373925_1374995 3300037068 Unclassified 579
467 Ga0395899_0000570 3300037312 Bacteria 39268
468 Ga0395899_0002181 3300037312 Bacteria 16076
469 Ga0395899_0726312 3300037312 Bacteria 621
470 Ga0395900_0205304 3300037418 Bacteria 1991
471 Ga0395900_0450626 3300037418 Bacteria 1243
472 Ga0395900_0680672 3300037418 Bacteria 963
473 Ga0395898_0021031 3300037466 Bacteria 6619
474 Ga0395905_0004846 3300037471 Bacteria 13877
475 Ga0395905_1122908 3300037471 Bacteria 689
476 Ga0395901_0125606 3300038443 Bacteria 2696
477 Ga0395901_0182121 3300038443 Bacteria 2203
478 Ga0395901_0449362 3300038443 Bacteria 1318
479 Ga0436365_1502616 3300039437 Bacteria 755
480 Ga0439441_034999 3300042001 Bacteria 988
481 Ga0439441_062713 3300042001 Bacteria 785
482 Ga0451577_0012047 3300042876 Bacteria 8136
483 Ga0453683_0373036 3300044673 Bacteria 918
484 Ga0453684_0000511 3300044712 Bacteria 150804
485 Ga0453684_0040410 3300044712 Bacteria 6334
486 Ga0453684_0167635 3300044712 Bacteria 2591
487 Ga0451576_0062672 3300045051 Bacteria 3876
488 Ga0451576_0088056 3300045051 Bacteria 3230
489 Ga0451576_0268675 3300045051 Bacteria 1783
490 Ga0451576_0957971 3300045051 Unclassified 897
491 Ga0451576_1116925 3300045051 Bacteria 825
492 Ga0451576_1200430 3300045051 Bacteria 792
493 Ga0451576_1342421 3300045051 Bacteria 745
494 Ga0451576_1630420 3300045051 Bacteria 669
495 Ga0451576_2457465 3300045051 Bacteria 532
496 Ga0466967_0441981 3300045976 Bacteria 1270
497 Ga0466967_0553257 3300045976 Bacteria 1133
498 Ga0495629_0503611 3300046459 Bacteria 816
499 Ga0495580_0002914 3300046472 Bacteria 14695
500 Ga0495580_0464753 3300046472 Bacteria 848
501 Ga0495582_0493483 3300046473 Unclassified 708
502 Ga0495639_0074003 3300046475 Bacteria 1578
503 Ga0495594_0507739 3300046499 Bacteria 685
504 Ga0495594_0604976 3300046499 Unclassified 621
505 Ga0495608_0514362 3300046511 Unclassified 724
506 Ga0495618_0014600 3300046514 Unclassified 4787
507 Ga0495618_0423461 3300046514 Unclassified 811
508 Ga0495630_0026387 3300046517 Unclassified 4301
509 Ga0495630_0040776 3300046517 Bacteria 3469
510 Ga0495630_1528137 3300046517 Bacteria 501
511 Ga0495643_0010957 3300046522 Bacteria 5550
512 Ga0495666_0282539 3300046526 Bacteria 752
513 Ga0495666_0431747 3300046526 Unclassified 591
514 Ga0495666_0455475 3300046526 Bacteria 573
515 Ga0495642_0054389 3300046528 Bacteria 1651
516 Ga0495642_0265037 3300046528 Bacteria 752
517 Ga0495654_0179994 3300046530 Bacteria 916
518 Ga0495586_0008895 3300046535 Bacteria 5345
519 Ga0495598_0016727 3300046537 Bacteria 1877
520 Ga0495598_0133134 3300046537 Bacteria 854
521 Ga0495621_0083098 3300046539 Bacteria 1197
522 Ga0495621_0108963 3300046539 Bacteria 1060
523 Ga0495597_0054544 3300046542 Bacteria 1755
524 Ga0495667_0054104 3300046559 Bacteria 2642
525 Ga0495668_0058083 3300046616 Bacteria 2135
526 Ga0495634_0010848 3300046642 Bacteria 6660
527 Ga0495661_0007815 3300046665 Bacteria 7439
528 Ga0495599_0544688 3300046678 Bacteria 680
529 Ga0495647_0082717 3300046681 Bacteria 1304
530 Ga0495658_0784968 3300046683 Bacteria 610
531 Ga0495613_0006984 3300046689 Bacteria 8414
532 Ga0495674_0170584 3300047319 Bacteria 1816
533 Ga0495680_0079942 3300047322 Unclassified 2471
534 Ga0495687_006968 3300047443 Bacteria 6789
535 Ga0495675_0280600 3300047444 Bacteria 993
536 Ga0495684_0053441 3300047471 Bacteria 3082
537 Ga0495615_0056629 3300048090 Bacteria 1024
538 Ga0495615_0268881 3300048090 Bacteria 545
539 Ga0496104_1339741 3300048907 Bacteria 619
540 Ga0496108_0955136 3300048911 Bacteria 734
541 Ga0496109_0303147 3300048912 Bacteria 1507
542 Ga0496109_0409720 3300048912 Bacteria 1281
543 Ga0496112_0840173 3300048915 Bacteria 842
544 Ga0501031_0000631 3300049568 Bacteria 20805
545 Ga0501031_0049874 3300049568 Unclassified 2728
546 Ga0501032_0000148 3300049569 Bacteria 57181
547 Ga0501032_0002706 3300049569 Bacteria 13828
548 Ga0501032_0140210 3300049569 Unclassified 1592
549 Ga0501033_0003368 3300049570 Bacteria 13186
550 Ga0501033_0034024 3300049570 Bacteria 3824
551 Ga0501033_0057492 3300049570 Bacteria 2875
552 Ga0501034_0156034 3300049571 Bacteria 2256
553 Ga0501036_0448808 3300049572 Bacteria 1074
554 Ga0501037_0101773 3300049573 Bacteria 2073
555 Ga0501037_0183297 3300049573 Unclassified 1485
556 Ga0501038_0033270 3300049574 Bacteria 4542
557 Ga0501038_0145081 3300049574 Bacteria 1939
558 Ga0501038_0700898 3300049574 Bacteria 759
559 Ga0501039_0095339 3300049575 Unclassified 2320
560 Ga0501039_0294199 3300049575 Bacteria 1276
561 Ga0501040_0108555 3300049576 Bacteria 1940
562 Ga0501042_0163154 3300049578 Bacteria 1608
563 Ga0501042_0502304 3300049578 Bacteria 881
564 Ga0501042_0608144 3300049578 Bacteria 795
565 Ga0501043_0152387 3300049579 Bacteria 1809
566 Ga0501043_0345472 3300049579 Bacteria 1131
567 Ga0501043_0545397 3300049579 Bacteria 862
568 Ga0501046_0009935 3300049580 Bacteria 8198
569 Ga0501046_0055377 3300049580 Bacteria 3117
570 Ga0501047_0000909 3300049581 Bacteria 30250
571 Ga0501047_0066763 3300049581 Bacteria 3468
572 Ga0501047_0201263 3300049581 Bacteria 1852
573 Ga0501047_0203284 3300049581 Bacteria 1841
574 Ga0501047_0365332 3300049581 Bacteria 1279
575 Ga0501048_0298524 3300049582 Bacteria 1146
576 Ga0501048_0627722 3300049582 Bacteria 771
577 Ga0501048_0906802 3300049582 Bacteria 634
578 Ga0501067_0102532 3300049583 Bacteria 1590
579 Ga0501068_0042370 3300049584 Bacteria 2738
580 Ga0501068_0216012 3300049584 Bacteria 1218
581 Ga0501069_0020517 3300049585 Bacteria 3581
582 Ga0501069_0098424 3300049585 Bacteria 1659
583 Ga0501070_0006216 3300049586 Bacteria 10166
584 Ga0501070_0051481 3300049586 Bacteria 3418
585 Ga0501071_0176569 3300049587 Bacteria 1600
586 Ga0501071_0754992 3300049587 Bacteria 749
587 Ga0501072_0166695 3300049588 Bacteria 1758
588 Ga0501072_0228777 3300049588 Bacteria 1481
589 Ga0501072_0487980 3300049588 Bacteria 975
590 Ga0501073_0082404 3300049589 Bacteria 2238
591 Ga0501073_0203462 3300049589 Bacteria 1369
592 Ga0501073_0282951 3300049589 Bacteria 1144
593 Ga0501074_0005852 3300049590 Bacteria 8870
594 Ga0501074_0106334 3300049590 Bacteria 2009
595 Ga0501074_0271256 3300049590 Bacteria 1206
596 Ga0501074_0538933 3300049590 Unclassified 826
597 Ga0501075_0323306 3300049591 Bacteria 1175
598 Ga0501076_0026248 3300049592 Bacteria 4510
599 Ga0501076_0522250 3300049592 Bacteria 979
600 Ga0501077_0152362 3300049593 Bacteria 1467
601 Ga0501077_0773897 3300049593 Bacteria 617
602 Ga0501079_0022932 3300049741 Bacteria 4793
603 Ga0501079_0096703 3300049741 Bacteria 2289
604 Ga0501079_1000871 3300049741 Bacteria 658
605 Ga0501080_0146967 3300049742 Bacteria 2179
606 Ga0501080_0167459 3300049742 Bacteria 2027
607 Ga0501080_0358473 3300049742 Bacteria 1316
608 Ga0501080_0632198 3300049742 Bacteria 948
609 Ga0501081_0192703 3300049743 Bacteria 1476
610 Ga0501035_0027702 3300049822 Bacteria 5179
611 Ga0501035_0057958 3300049822 Bacteria 3452
612 Ga0501044_0000268 3300049823 Bacteria 66050
613 Ga0501044_0000442 3300049823 Bacteria 50741
614 Ga0501044_0006715 3300049823 Bacteria 12682
615 Ga0501044_0223050 3300049823 Bacteria 1835
616 Ga0501044_0350512 3300049823 Bacteria 1396
617 Ga0501045_0132239 3300049824 Bacteria 1855
618 Ga0501045_0773257 3300049824 Bacteria 707
619 nmdc:mga03683_285916_c1 3300050489 Bacteria 771
620 nmdc:mga0k408_20281_c1 3300050493 Bacteria 3722
621 nmdc:mga05p37_100422_c1 3300050507 Bacteria 3564
622 nmdc:mga05p37_1488656_c1 3300050507 Bacteria 675
623 nmdc:mga05p37_2034756_c1 3300050507 Bacteria 542
624 nmdc:mga05p37_237205_c1 3300050507 Bacteria 2195
625 nmdc:mga05p37_368604_c1 3300050507 Bacteria 1686
626 nmdc:mga05p37_48070_c1 3300050507 Bacteria 5247
627 nmdc:mga05p37_639_c1 3300050507 Bacteria 38794
628 nmdc:mga05p37_693605_c1 3300050507 Unclassified 1133
629 nmdc:mga05p37_9412_c1 3300050507 Bacteria 11566
630 nmdc:mga09592_18418_c1 3300050508 Bacteria 5728
631 nmdc:mga09592_298966_c1 3300050508 Bacteria 1396
632 nmdc:mga09592_688361_c1 3300050508 Unclassified 871
633 nmdc:mga09592_77365_c1 3300050508 Bacteria 2830
634 nmdc:mga0qj67_169204_c1 3300050509 Bacteria 1774
635 nmdc:mga0qj67_61221_c1 3300050509 Bacteria 2988
636 nmdc:mga0qj67_75438_c1 3300050509 Bacteria 2695
637 nmdc:mga06r32_1071_c1 3300050510 Bacteria 6048
638 nmdc:mga06r32_415554_c1 3300050510 Bacteria 554
639 nmdc:mga06r32_423676_c1 3300050510 Unclassified 1312
640 nmdc:mga06r32_456177_c1 3300050510 Bacteria 1258
641 nmdc:mga06r32_591106_c1 3300050510 Bacteria 1081
642 nmdc:mga08y16_2027684_c1 3300050511 Bacteria 524
643 nmdc:mga08y16_789807_c1 3300050511 Bacteria 943
644 nmdc:mga08y16_845572_c1 3300050511 Bacteria 905
645 nmdc:mga08y16_948676_c1 3300050511 Bacteria 843
646 nmdc:mga0n895_1322660_c1 3300050512 Bacteria 691
647 nmdc:mga0n895_1597249_c1 3300050512 Bacteria 617
648 nmdc:mga0n895_27412_c1 3300050512 Bacteria 5413
649 nmdc:mga0n895_558486_c1 3300050512 Bacteria 1150
650 nmdc:mga0n895_83406_c1 3300050512 Bacteria 3188
651 nmdc:mga0rr50_1114364_c1 3300050513 Bacteria 671
652 nmdc:mga0rr50_1282879_c1 3300050513 Bacteria 621
653 nmdc:mga0rr50_1766787_c1 3300050513 Bacteria 521
654 nmdc:mga0rr50_530763_c1 3300050513 Bacteria 1002
655 nmdc:mga0rr50_7612_c1 3300050513 Bacteria 6696
656 nmdc:mga08x19_458659_c1 3300050514 Bacteria 897
657 nmdc:mga08x19_506466_c1 3300050514 Bacteria 853
658 nmdc:mga08x19_882294_c1 3300050514 Bacteria 635
659 nmdc:mga0a205_212288_c1 3300050515 Bacteria 1823
660 nmdc:mga0a205_625855_c1 3300050515 Bacteria 928
661 nmdc:mga0a205_73683_c1 3300050515 Bacteria 3299
662 nmdc:mga0a205_746217_c1 3300050515 Bacteria 828
663 Ga0495601_0061455 3300053077 Unclassified 2385
664 Ga0495601_0324159 3300053077 Bacteria 1003
665 Ga0501084_0056030 3300054114 Bacteria 3298
666 Ga0501084_0170957 3300054114 Bacteria 1834
667 Ga0501084_1487873 3300054114 Bacteria 567
668 Ga0501084_1560849 3300054114 Bacteria 552
669 Ga0530510_0024902 3300061734 Bacteria 4276
670 Ga0530510_0586565 3300061734 Bacteria 847

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026121 Ga0207683_10766097 Ga0207683_107660971 122
2 3300006844 Ga0075428_101836071 Ga0075428_1018360712 125
3 3300005341 Ga0070691_10011578 Ga0070691_100115781 130
4 3300009094 Ga0111539_10152367 Ga0111539_101523673 131
5 3300050511 nmdc:mga08y16_789807_c1 nmdc:mga08y16_789807_c1_37_450 131
6 3300049581 Ga0501047_0365332 Ga0501047_0365332_30_440 132
7 3300005354 Ga0070675_102000350 Ga0070675_1020003501 133
8 3300005444 Ga0070694_100796156 Ga0070694_1007961561 133
9 3300013308 Ga0157375_13247026 Ga0157375_132470261 133
10 3300026142 Ga0207698_11121233 Ga0207698_111212331 133
11 3300048911 Ga0496108_0955136 Ga0496108_0955136_284_703 133
12 3300005338 Ga0068868_100454666 Ga0068868_1004546662 134
13 3300005546 Ga0070696_100496446 Ga0070696_1004964462 134
14 3300005548 Ga0070665_100224024 Ga0070665_1002240243 134
15 3300005578 Ga0068854_101520972 Ga0068854_1015209722 134
16 3300005718 Ga0068866_11044219 Ga0068866_110442192 134
17 3300005981 Ga0081538_10021530 Ga0081538_100215302 134
18 3300006177 Ga0075362_10253828 Ga0075362_102538282 134
19 3300006844 Ga0075428_100879519 Ga0075428_1008795192 134
20 3300009093 Ga0105240_10527188 Ga0105240_105271882 134
21 3300009094 Ga0111539_10448084 Ga0111539_104480842 134
22 3300009147 Ga0114129_10002853 Ga0114129_100028534 134
23 3300009147 Ga0114129_11334113 Ga0114129_113341131 134
24 3300010375 Ga0105239_12367018 Ga0105239_123670182 134
25 3300013104 Ga0157370_10138398 Ga0157370_101383982 134
26 3300025910 Ga0207684_10490460 Ga0207684_104904602 134
27 3300025913 Ga0207695_10046527 Ga0207695_100465278 134
28 3300025981 Ga0207640_10922796 Ga0207640_109227962 134
29 3300026023 Ga0207677_11386508 Ga0207677_113865081 134
30 3300027907 Ga0207428_10497186 Ga0207428_104971862 134
31 3300028379 Ga0268266_10404554 Ga0268266_104045542 134
32 3300035111 Ga0373923_0352098 Ga0373923_0352098_66_482 134
33 3300036401 Ga0373937_0082838 Ga0373937_0082838_1848_2264 134
34 3300045051 Ga0451576_0062672 Ga0451576_0062672_1974_2402 134
35 3300050489 nmdc:mga03683_285916_c1 nmdc:mga03683_285916_c1_193_597 134
36 3300050507 nmdc:mga05p37_1488656_c1 nmdc:mga05p37_1488656_c1_93_497 134
37 3300050507 nmdc:mga05p37_9412_c1 nmdc:mga05p37_9412_c1_10993_11430 134
38 3300050511 nmdc:mga08y16_845572_c1 nmdc:mga08y16_845572_c1_147_551 134
39 3300050513 nmdc:mga0rr50_1766787_c1 nmdc:mga0rr50_1766787_c1_22_459 134
40 3300054114 Ga0501084_1560849 Ga0501084_1560849_88_492 134
41 3300005340 Ga0070689_100502165 Ga0070689_1005021652 135
42 3300005436 Ga0070713_100713031 Ga0070713_1007130311 135
43 3300005535 Ga0070684_101413003 Ga0070684_1014130031 135
44 3300005548 Ga0070665_100581028 Ga0070665_1005810283 135
45 3300005563 Ga0068855_100416113 Ga0068855_1004161132 135
46 3300005617 Ga0068859_100520746 Ga0068859_1005207462 135
47 3300005843 Ga0068860_100065520 Ga0068860_1000655201 135
48 3300005844 Ga0068862_101252450 Ga0068862_1012524501 135
49 3300006931 Ga0097620_100520704 Ga0097620_1005207042 135
50 3300013296 Ga0157374_10210725 Ga0157374_102107254 135
51 3300028380 Ga0268265_10754321 Ga0268265_107543211 135
52 3300032002 Ga0307416_102103371 Ga0307416_1021033712 135
53 3300035111 Ga0373923_0286571 Ga0373923_0286571_149_586 135
54 3300035116 Ga0373945_0255923 Ga0373945_0255923_47_484 135
55 3300035171 Ga0373946_0080081 Ga0373946_0080081_729_1166 135
56 3300035692 Ga0373935_0017087 Ga0373935_0017087_2575_3012 135
57 3300035695 Ga0373927_0023279 Ga0373927_0023279_2916_3353 135
58 3300035725 Ga0373947_0006717 Ga0373947_0006717_5834_6271 135
59 3300037068 Ga0373925_0002783 Ga0373925_0002783_6812_7249 135
60 3300046511 Ga0495608_0514362 Ga0495608_0514362_98_505 135
61 3300046517 Ga0495630_0040776 Ga0495630_0040776_232_669 135
62 3300046526 Ga0495666_0282539 Ga0495666_0282539_199_636 135
63 3300050511 nmdc:mga08y16_2027684_c1 nmdc:mga08y16_2027684_c1_21_467 135
64 3300005327 Ga0070658_11985808 Ga0070658_119858081 136
65 3300005329 Ga0070683_100057726 Ga0070683_1000577263 136
66 3300005329 Ga0070683_100670578 Ga0070683_1006705782 136
67 3300005336 Ga0070680_101132707 Ga0070680_1011327071 136
68 3300005338 Ga0068868_100996147 Ga0068868_1009961471 136
69 3300005345 Ga0070692_10062733 Ga0070692_100627333 136
70 3300005365 Ga0070688_101673864 Ga0070688_1016738641 136
71 3300005434 Ga0070709_10813712 Ga0070709_108137121 136
72 3300005445 Ga0070708_100750149 Ga0070708_1007501492 136
73 3300005458 Ga0070681_10099661 Ga0070681_100996612 136
74 3300005471 Ga0070698_100605363 Ga0070698_1006053632 136
75 3300005518 Ga0070699_100801640 Ga0070699_1008016402 136
76 3300005530 Ga0070679_100289260 Ga0070679_1002892601 136
77 3300005530 Ga0070679_100442045 Ga0070679_1004420452 136
78 3300005536 Ga0070697_100476468 Ga0070697_1004764682 136
79 3300005539 Ga0068853_101518488 Ga0068853_1015184881 136
80 3300005545 Ga0070695_100689810 Ga0070695_1006898102 136
81 3300005548 Ga0070665_100000213 Ga0070665_10000021365 136
82 3300005563 Ga0068855_101117399 Ga0068855_1011173992 136
83 3300005614 Ga0068856_100046850 Ga0068856_1000468504 136
84 3300005616 Ga0068852_100468748 Ga0068852_1004687481 136
85 3300005617 Ga0068859_100065189 Ga0068859_1000651892 136
86 3300005834 Ga0068851_10692184 Ga0068851_106921842 136
87 3300005841 Ga0068863_102259039 Ga0068863_1022590391 136
88 3300005937 Ga0081455_10254376 Ga0081455_102543763 136
89 3300006048 Ga0075363_100308751 Ga0075363_1003087512 136
90 3300006173 Ga0070716_100063940 Ga0070716_1000639404 136
91 3300006844 Ga0075428_101163997 Ga0075428_1011639972 136
92 3300006846 Ga0075430_100034821 Ga0075430_1000348213 136
93 3300006847 Ga0075431_100021493 Ga0075431_10002149313 136
94 3300006871 Ga0075434_100176498 Ga0075434_1001764984 136
95 3300006880 Ga0075429_101360632 Ga0075429_1013606321 136
96 3300006880 Ga0075429_101615048 Ga0075429_1016150481 136
97 3300006931 Ga0097620_100065193 Ga0097620_1000651935 136
98 3300009147 Ga0114129_11604281 Ga0114129_116042812 136
99 3300009147 Ga0114129_12283945 Ga0114129_122839451 136
100 3300009147 Ga0114129_13108299 Ga0114129_131082991 136
101 3300009174 Ga0105241_10965480 Ga0105241_109654801 136
102 3300009551 Ga0105238_10018245 Ga0105238_100182456 136
103 3300010375 Ga0105239_10160510 Ga0105239_101605103 136
104 3300010375 Ga0105239_11120665 Ga0105239_111206652 136
105 3300011119 Ga0105246_11284024 Ga0105246_112840242 136
106 3300013105 Ga0157369_10125280 Ga0157369_101252802 136
107 3300013307 Ga0157372_10013791 Ga0157372_100137916 136
108 3300013307 Ga0157372_10105472 Ga0157372_101054723 136
109 3300025321 Ga0207656_10564555 Ga0207656_105645552 136
110 3300025905 Ga0207685_10201061 Ga0207685_102010612 136
111 3300025910 Ga0207684_11356458 Ga0207684_113564582 136
112 3300025911 Ga0207654_10747114 Ga0207654_107471142 136
113 3300025921 Ga0207652_10370143 Ga0207652_103701431 136
114 3300025922 Ga0207646_11251808 Ga0207646_112518081 136
115 3300025924 Ga0207694_10053367 Ga0207694_100533673 136
116 3300025939 Ga0207665_10386809 Ga0207665_103868092 136
117 3300025944 Ga0207661_10041605 Ga0207661_100416052 136
118 3300025944 Ga0207661_10170911 Ga0207661_101709112 136
119 3300025972 Ga0207668_11247361 Ga0207668_112473611 136
120 3300026067 Ga0207678_10913400 Ga0207678_109134002 136
121 3300026078 Ga0207702_10135629 Ga0207702_101356294 136
122 3300026142 Ga0207698_11904645 Ga0207698_119046452 136
123 3300028379 Ga0268266_10000235 Ga0268266_1000023568 136
124 3300028800 Ga0265338_10003888 Ga0265338_100038883 136
125 3300028800 Ga0265338_10822887 Ga0265338_108228871 136
126 3300031238 Ga0265332_10073987 Ga0265332_100739873 136
127 3300031241 Ga0265325_10004125 Ga0265325_100041257 136
128 3300031249 Ga0265339_10003464 Ga0265339_100034644 136
129 3300031249 Ga0265339_10324857 Ga0265339_103248571 136
130 3300031250 Ga0265331_10001550 Ga0265331_1000155011 136
131 3300031251 Ga0265327_10098150 Ga0265327_100981502 136
132 3300031251 Ga0265327_10139810 Ga0265327_101398102 136
133 3300031344 Ga0265316_10104668 Ga0265316_101046683 136
134 3300031595 Ga0265313_10003585 Ga0265313_100035859 136
135 3300031616 Ga0307508_10000191 Ga0307508_1000019130 136
136 3300031711 Ga0265314_10000948 Ga0265314_100009487 136
137 3300031712 Ga0265342_10060308 Ga0265342_100603082 136
138 3300031911 Ga0307412_12283486 Ga0307412_122834861 136
139 3300034819 Ga0373958_0122844 Ga0373958_0122844_110_562 136
140 3300035083 Ga0373926_0221978 Ga0373926_0221978_62_502 136
141 3300035113 Ga0373936_0047766 Ga0373936_0047766_394_834 136
142 3300035114 Ga0373939_0059637 Ga0373939_0059637_32_484 136
143 3300035692 Ga0373935_0145270 Ga0373935_0145270_166_606 136
144 3300035725 Ga0373947_1262779 Ga0373947_1262779_39_485 136
145 3300036401 Ga0373937_1483469 Ga0373937_1483469_16_444 136
146 3300037068 Ga0373925_0013259 Ga0373925_0013259_1219_1659 136
147 3300042001 Ga0439441_034999 Ga0439441_034999_142_585 136
148 3300042001 Ga0439441_062713 Ga0439441_062713_156_599 136
149 3300044712 Ga0453684_0000511 Ga0453684_0000511_57450_57896 136
150 3300045051 Ga0451576_1342421 Ga0451576_1342421_293_724 136
151 3300046499 Ga0495594_0507739 Ga0495594_0507739_176_610 136
152 3300046514 Ga0495618_0423461 Ga0495618_0423461_342_770 136
153 3300046522 Ga0495643_0010957 Ga0495643_0010957_1622_2047 136
154 3300046526 Ga0495666_0455475 Ga0495666_0455475_12_458 136
155 3300046528 Ga0495642_0054389 Ga0495642_0054389_840_1265 136
156 3300046528 Ga0495642_0265037 Ga0495642_0265037_261_674 136
157 3300046537 Ga0495598_0016727 Ga0495598_0016727_99_515 136
158 3300046539 Ga0495621_0108963 Ga0495621_0108963_367_783 136
159 3300046542 Ga0495597_0054544 Ga0495597_0054544_827_1252 136
160 3300046616 Ga0495668_0058083 Ga0495668_0058083_1255_1680 136
161 3300046665 Ga0495661_0007815 Ga0495661_0007815_3269_3694 136
162 3300047443 Ga0495687_006968 Ga0495687_006968_3620_4045 136
163 3300048090 Ga0495615_0056629 Ga0495615_0056629_65_481 136
164 3300048912 Ga0496109_0303147 Ga0496109_0303147_617_1033 136
165 3300049569 Ga0501032_0000148 Ga0501032_0000148_9966_10394 136
166 3300049574 Ga0501038_0700898 Ga0501038_0700898_93_521 136
167 3300049580 Ga0501046_0009935 Ga0501046_0009935_2773_3201 136
168 3300049581 Ga0501047_0000909 Ga0501047_0000909_29351_29779 136
169 3300049581 Ga0501047_0201263 Ga0501047_0201263_1220_1648 136
170 3300049582 Ga0501048_0298524 Ga0501048_0298524_129_557 136
171 3300049587 Ga0501071_0176569 Ga0501071_0176569_316_726 136
172 3300049588 Ga0501072_0166695 Ga0501072_0166695_695_1105 136
173 3300049742 Ga0501080_0632198 Ga0501080_0632198_24_452 136
174 3300049822 Ga0501035_0057958 Ga0501035_0057958_472_900 136
175 3300049823 Ga0501044_0000268 Ga0501044_0000268_54779_55207 136
176 3300049823 Ga0501044_0350512 Ga0501044_0350512_953_1366 136
177 3300050507 nmdc:mga05p37_2034756_c1 nmdc:mga05p37_2034756_c1_45_455 136
178 3300050507 nmdc:mga05p37_693605_c1 nmdc:mga05p37_693605_c1_45_455 136
179 3300050508 nmdc:mga09592_18418_c1 nmdc:mga09592_18418_c1_2742_3152 136
180 3300050508 nmdc:mga09592_688361_c1 nmdc:mga09592_688361_c1_48_458 136
181 3300050509 nmdc:mga0qj67_169204_c1 nmdc:mga0qj67_169204_c1_1318_1728 136
182 3300050510 nmdc:mga06r32_456177_c1 nmdc:mga06r32_456177_c1_199_609 136
183 3300050513 nmdc:mga0rr50_1282879_c1 nmdc:mga0rr50_1282879_c1_168_578 136
184 3300050514 nmdc:mga08x19_882294_c1 nmdc:mga08x19_882294_c1_70_480 136
185 3300053077 Ga0495601_0324159 Ga0495601_0324159_415_834 136
186 2162886007 SwRhRL2b_contig_3656236 SwRhRL2b_0976.00004030 137
187 2162886012 MBSR1b_contig_13185514 MBSR1b_0751.00003070 137
188 3300002155 JGI24033J26618_1027880 JGI24033J26618_10278801 137
189 3300003320 rootH2_10179150 rootH2_101791501 137
190 3300005288 Ga0065714_10282279 Ga0065714_102822791 137
191 3300005289 Ga0065704_10137463 Ga0065704_101374632 137
192 3300005295 Ga0065707_10097886 Ga0065707_100978863 137
193 3300005328 Ga0070676_10006697 Ga0070676_100066977 137
194 3300005328 Ga0070676_10460829 Ga0070676_104608291 137
195 3300005329 Ga0070683_101492597 Ga0070683_1014925972 137
196 3300005330 Ga0070690_100103505 Ga0070690_1001035052 137
197 3300005330 Ga0070690_100673285 Ga0070690_1006732851 137
198 3300005330 Ga0070690_100770067 Ga0070690_1007700671 137
199 3300005331 Ga0070670_100254993 Ga0070670_1002549931 137
200 3300005331 Ga0070670_100446621 Ga0070670_1004466212 137
201 3300005333 Ga0070677_10005945 Ga0070677_100059452 137
202 3300005333 Ga0070677_10245231 Ga0070677_102452311 137
203 3300005334 Ga0068869_100006593 Ga0068869_1000065938 137
204 3300005335 Ga0070666_10021060 Ga0070666_100210602 137
205 3300005336 Ga0070680_100307228 Ga0070680_1003072283 137
206 3300005338 Ga0068868_100051356 Ga0068868_1000513562 137
207 3300005338 Ga0068868_102013559 Ga0068868_1020135591 137
208 3300005340 Ga0070689_100104977 Ga0070689_1001049774 137
209 3300005340 Ga0070689_101337257 Ga0070689_1013372571 137
210 3300005343 Ga0070687_100451693 Ga0070687_1004516933 137
211 3300005343 Ga0070687_100600573 Ga0070687_1006005731 137
212 3300005345 Ga0070692_10548203 Ga0070692_105482031 137
213 3300005347 Ga0070668_101279098 Ga0070668_1012790982 137
214 3300005353 Ga0070669_100171774 Ga0070669_1001717744 137
215 3300005353 Ga0070669_100284802 Ga0070669_1002848021 137
216 3300005354 Ga0070675_100191262 Ga0070675_1001912622 137
217 3300005354 Ga0070675_100517451 Ga0070675_1005174511 137
218 3300005355 Ga0070671_100028460 Ga0070671_1000284607 137
219 3300005355 Ga0070671_100075823 Ga0070671_1000758232 137
220 3300005355 Ga0070671_100255328 Ga0070671_1002553282 137
221 3300005355 Ga0070671_100761636 Ga0070671_1007616362 137
222 3300005356 Ga0070674_100113001 Ga0070674_1001130013 137
223 3300005356 Ga0070674_100113445 Ga0070674_1001134453 137
224 3300005364 Ga0070673_100465860 Ga0070673_1004658602 137
225 3300005365 Ga0070688_100269385 Ga0070688_1002693852 137
226 3300005366 Ga0070659_101128373 Ga0070659_1011283731 137
227 3300005367 Ga0070667_100280869 Ga0070667_1002808691 137
228 3300005367 Ga0070667_100737629 Ga0070667_1007376292 137
229 3300005367 Ga0070667_101257158 Ga0070667_1012571582 137
230 3300005406 Ga0070703_10129479 Ga0070703_101294792 137
231 3300005434 Ga0070709_10455873 Ga0070709_104558731 137
232 3300005435 Ga0070714_100004720 Ga0070714_1000047209 137
233 3300005435 Ga0070714_100191167 Ga0070714_1001911672 137
234 3300005435 Ga0070714_100956092 Ga0070714_1009560922 137
235 3300005435 Ga0070714_101262542 Ga0070714_1012625422 137
236 3300005436 Ga0070713_101811134 Ga0070713_1018111341 137
237 3300005437 Ga0070710_10076220 Ga0070710_100762201 137
238 3300005438 Ga0070701_10577749 Ga0070701_105777492 137
239 3300005438 Ga0070701_10584205 Ga0070701_105842052 137
240 3300005439 Ga0070711_100160343 Ga0070711_1001603431 137
241 3300005440 Ga0070705_100015637 Ga0070705_1000156373 137
242 3300005441 Ga0070700_100251410 Ga0070700_1002514101 137
243 3300005441 Ga0070700_100302460 Ga0070700_1003024601 137
244 3300005445 Ga0070708_100041235 Ga0070708_1000412353 137
245 3300005445 Ga0070708_100341698 Ga0070708_1003416982 137
246 3300005455 Ga0070663_100711116 Ga0070663_1007111162 137
247 3300005456 Ga0070678_100134872 Ga0070678_1001348723 137
248 3300005456 Ga0070678_100349560 Ga0070678_1003495602 137
249 3300005456 Ga0070678_101315180 Ga0070678_1013151801 137
250 3300005457 Ga0070662_100169171 Ga0070662_1001691713 137
251 3300005457 Ga0070662_100228439 Ga0070662_1002284392 137
252 3300005457 Ga0070662_100252671 Ga0070662_1002526713 137
253 3300005458 Ga0070681_10545646 Ga0070681_105456461 137
254 3300005458 Ga0070681_10972983 Ga0070681_109729831 137
255 3300005459 Ga0068867_100039383 Ga0068867_1000393834 137
256 3300005459 Ga0068867_100120300 Ga0068867_1001203002 137
257 3300005459 Ga0068867_100162813 Ga0068867_1001628132 137
258 3300005466 Ga0070685_10247387 Ga0070685_102473872 137
259 3300005467 Ga0070706_100108905 Ga0070706_1001089053 137
260 3300005467 Ga0070706_100154369 Ga0070706_1001543692 137
261 3300005468 Ga0070707_100029338 Ga0070707_1000293382 137
262 3300005468 Ga0070707_100082110 Ga0070707_1000821104 137
263 3300005468 Ga0070707_101571094 Ga0070707_1015710941 137
264 3300005471 Ga0070698_100010681 Ga0070698_1000106816 137
265 3300005471 Ga0070698_100407519 Ga0070698_1004075192 137
266 3300005536 Ga0070697_100048365 Ga0070697_1000483655 137
267 3300005543 Ga0070672_100042667 Ga0070672_1000426672 137
268 3300005543 Ga0070672_100064861 Ga0070672_1000648613 137
269 3300005544 Ga0070686_100049183 Ga0070686_1000491833 137
270 3300005545 Ga0070695_101092125 Ga0070695_1010921252 137
271 3300005546 Ga0070696_100405936 Ga0070696_1004059362 137
272 3300005546 Ga0070696_100560636 Ga0070696_1005606362 137
273 3300005547 Ga0070693_100154340 Ga0070693_1001543401 137
274 3300005547 Ga0070693_100665073 Ga0070693_1006650732 137
275 3300005548 Ga0070665_100270395 Ga0070665_1002703953 137
276 3300005549 Ga0070704_100122532 Ga0070704_1001225322 137
277 3300005549 Ga0070704_100165672 Ga0070704_1001656722 137
278 3300005549 Ga0070704_100845743 Ga0070704_1008457431 137
279 3300005564 Ga0070664_100354320 Ga0070664_1003543202 137
280 3300005564 Ga0070664_100785045 Ga0070664_1007850451 137
281 3300005577 Ga0068857_101221424 Ga0068857_1012214241 137
282 3300005615 Ga0070702_100009578 Ga0070702_1000095785 137
283 3300005616 Ga0068852_101723331 Ga0068852_1017233311 137
284 3300005617 Ga0068859_100399868 Ga0068859_1003998682 137
285 3300005618 Ga0068864_100129379 Ga0068864_1001293792 137
286 3300005618 Ga0068864_100570896 Ga0068864_1005708962 137
287 3300005718 Ga0068866_10262125 Ga0068866_102621252 137
288 3300005718 Ga0068866_11147425 Ga0068866_111474251 137
289 3300005719 Ga0068861_100093020 Ga0068861_1000930202 137
290 3300005834 Ga0068851_10859940 Ga0068851_108599402 137
291 3300005840 Ga0068870_10084739 Ga0068870_100847392 137
292 3300005841 Ga0068863_100008248 Ga0068863_10000824812 137
293 3300005841 Ga0068863_100059673 Ga0068863_1000596732 137
294 3300005842 Ga0068858_100050595 Ga0068858_1000505953 137
295 3300005844 Ga0068862_100324760 Ga0068862_1003247602 137
296 3300005844 Ga0068862_101102400 Ga0068862_1011024002 137
297 3300005937 Ga0081455_10001038 Ga0081455_1000103822 137
298 3300005981 Ga0081538_10005463 Ga0081538_1000546311 137
299 3300005981 Ga0081538_10335284 Ga0081538_103352841 137
300 3300005983 Ga0081540_1138026 Ga0081540_11380262 137
301 3300006028 Ga0070717_10021015 Ga0070717_100210152 137
302 3300006194 Ga0075427_10025225 Ga0075427_100252251 137
303 3300006195 Ga0075366_10026233 Ga0075366_100262333 137
304 3300006195 Ga0075366_10074178 Ga0075366_100741782 137
305 3300006237 Ga0097621_100107358 Ga0097621_1001073584 137
306 3300006237 Ga0097621_100622818 Ga0097621_1006228182 137
307 3300006358 Ga0068871_100890579 Ga0068871_1008905792 137
308 3300006844 Ga0075428_100033970 Ga0075428_1000339702 137
309 3300006844 Ga0075428_100146614 Ga0075428_1001466144 137
310 3300006844 Ga0075428_100333119 Ga0075428_1003331193 137
311 3300006846 Ga0075430_100086200 Ga0075430_1000862002 137
312 3300006846 Ga0075430_100104588 Ga0075430_1001045883 137
313 3300006847 Ga0075431_100004030 Ga0075431_10000403011 137
314 3300006847 Ga0075431_100716502 Ga0075431_1007165022 137
315 3300006847 Ga0075431_101231338 Ga0075431_1012313381 137
316 3300006852 Ga0075433_10000563 Ga0075433_100005632 137
317 3300006852 Ga0075433_10335548 Ga0075433_103355482 137
318 3300006852 Ga0075433_10344199 Ga0075433_103441992 137
319 3300006852 Ga0075433_11686332 Ga0075433_116863321 137
320 3300006871 Ga0075434_100007123 Ga0075434_10000712312 137
321 3300006871 Ga0075434_100027156 Ga0075434_1000271567 137
322 3300006871 Ga0075434_100686298 Ga0075434_1006862982 137
323 3300006871 Ga0075434_100901216 Ga0075434_1009012162 137
324 3300006880 Ga0075429_100028261 Ga0075429_1000282615 137
325 3300006880 Ga0075429_101109440 Ga0075429_1011094402 137
326 3300006880 Ga0075429_101337146 Ga0075429_1013371461 137
327 3300006881 Ga0068865_100056205 Ga0068865_1000562052 137
328 3300006881 Ga0068865_100082112 Ga0068865_1000821123 137
329 3300006881 Ga0068865_101395657 Ga0068865_1013956572 137
330 3300006914 Ga0075436_100086008 Ga0075436_1000860082 137
331 3300006914 Ga0075436_100192897 Ga0075436_1001928973 137
332 3300006914 Ga0075436_100284912 Ga0075436_1002849122 137
333 3300006931 Ga0097620_100399868 Ga0097620_1003998682 137
334 3300007076 Ga0075435_100074197 Ga0075435_1000741974 137
335 3300007076 Ga0075435_100136640 Ga0075435_1001366403 137
336 3300007076 Ga0075435_100153599 Ga0075435_1001535993 137
337 3300009094 Ga0111539_10506146 Ga0111539_105061462 137
338 3300009094 Ga0111539_11064073 Ga0111539_110640732 137
339 3300009094 Ga0111539_12854796 Ga0111539_128547961 137
340 3300009098 Ga0105245_10353838 Ga0105245_103538381 137
341 3300009098 Ga0105245_11854281 Ga0105245_118542811 137
342 3300009101 Ga0105247_10293878 Ga0105247_102938782 137
343 3300009101 Ga0105247_11414443 Ga0105247_114144431 137
344 3300009147 Ga0114129_10001057 Ga0114129_100010576 137
345 3300009147 Ga0114129_10064442 Ga0114129_100644426 137
346 3300009147 Ga0114129_10389415 Ga0114129_103894151 137
347 3300009147 Ga0114129_10833197 Ga0114129_108331972 137
348 3300009147 Ga0114129_11398260 Ga0114129_113982602 137
349 3300009147 Ga0114129_12128998 Ga0114129_121289982 137
350 3300009148 Ga0105243_10302239 Ga0105243_103022393 137
351 3300009148 Ga0105243_10660660 Ga0105243_106606602 137
352 3300009176 Ga0105242_10124258 Ga0105242_101242583 137
353 3300009176 Ga0105242_10182571 Ga0105242_101825711 137
354 3300009177 Ga0105248_10011418 Ga0105248_1001141811 137
355 3300009177 Ga0105248_10105975 Ga0105248_101059755 137
356 3300009553 Ga0105249_10118923 Ga0105249_101189233 137
357 3300009553 Ga0105249_10189724 Ga0105249_101897244 137
358 3300009553 Ga0105249_12300166 Ga0105249_123001661 137
359 3300010159 Ga0099796_10080296 Ga0099796_100802962 137
360 3300010159 Ga0099796_10299585 Ga0099796_102995851 137
361 3300011119 Ga0105246_10070025 Ga0105246_100700254 137
362 3300011119 Ga0105246_10237977 Ga0105246_102379772 137
363 3300013296 Ga0157374_10165330 Ga0157374_101653302 137
364 3300013296 Ga0157374_10225191 Ga0157374_102251912 137
365 3300013296 Ga0157374_10438900 Ga0157374_104389003 137
366 3300013297 Ga0157378_10030129 Ga0157378_100301295 137
367 3300013297 Ga0157378_10113850 Ga0157378_101138504 137
368 3300013297 Ga0157378_10847352 Ga0157378_108473522 137
369 3300013308 Ga0157375_10000111 Ga0157375_1000011121 137
370 3300013308 Ga0157375_10048135 Ga0157375_100481352 137
371 3300013308 Ga0157375_10078285 Ga0157375_100782854 137
372 3300013308 Ga0157375_10117523 Ga0157375_101175233 137
373 3300013308 Ga0157375_10493520 Ga0157375_104935202 137
374 3300014325 Ga0163163_10789135 Ga0163163_107891352 137
375 3300014325 Ga0163163_11189296 Ga0163163_111892962 137
376 3300014968 Ga0157379_10015814 Ga0157379_100158147 137
377 3300014968 Ga0157379_10457428 Ga0157379_104574282 137
378 3300014969 Ga0157376_10449346 Ga0157376_104493462 137
379 3300017792 Ga0163161_10405754 Ga0163161_104057542 137
380 3300017792 Ga0163161_10451046 Ga0163161_104510462 137
381 3300025315 Ga0207697_10324372 Ga0207697_103243721 137
382 3300025893 Ga0207682_10056075 Ga0207682_100560752 137
383 3300025901 Ga0207688_10010225 Ga0207688_100102259 137
384 3300025903 Ga0207680_10010143 Ga0207680_100101433 137
385 3300025905 Ga0207685_10438866 Ga0207685_104388661 137
386 3300025907 Ga0207645_10004849 Ga0207645_100048492 137
387 3300025908 Ga0207643_10060709 Ga0207643_100607093 137
388 3300025908 Ga0207643_10093008 Ga0207643_100930082 137
389 3300025910 Ga0207684_10099871 Ga0207684_100998712 137
390 3300025910 Ga0207684_10153184 Ga0207684_101531842 137
391 3300025912 Ga0207707_10285019 Ga0207707_102850191 137
392 3300025915 Ga0207693_10062934 Ga0207693_100629342 137
393 3300025917 Ga0207660_10277645 Ga0207660_102776452 137
394 3300025918 Ga0207662_10277776 Ga0207662_102777762 137
395 3300025918 Ga0207662_10728406 Ga0207662_107284061 137
396 3300025918 Ga0207662_10911090 Ga0207662_109110902 137
397 3300025920 Ga0207649_11621418 Ga0207649_116214181 137
398 3300025922 Ga0207646_10040212 Ga0207646_100402126 137
399 3300025922 Ga0207646_10065229 Ga0207646_100652292 137
400 3300025925 Ga0207650_10003791 Ga0207650_100037918 137
401 3300025925 Ga0207650_10126538 Ga0207650_101265382 137
402 3300025926 Ga0207659_10038703 Ga0207659_100387034 137
403 3300025926 Ga0207659_10155406 Ga0207659_101554062 137
404 3300025926 Ga0207659_10265962 Ga0207659_102659622 137
405 3300025927 Ga0207687_10364018 Ga0207687_103640182 137
406 3300025927 Ga0207687_11272338 Ga0207687_112723381 137
407 3300025928 Ga0207700_11011003 Ga0207700_110110031 137
408 3300025929 Ga0207664_10003657 Ga0207664_100036572 137
409 3300025929 Ga0207664_10451878 Ga0207664_104518782 137
410 3300025929 Ga0207664_11091830 Ga0207664_110918301 137
411 3300025931 Ga0207644_10014819 Ga0207644_100148199 137
412 3300025931 Ga0207644_10054631 Ga0207644_100546314 137
413 3300025931 Ga0207644_10074166 Ga0207644_100741664 137
414 3300025933 Ga0207706_10350969 Ga0207706_103509692 137
415 3300025933 Ga0207706_10504641 Ga0207706_105046412 137
416 3300025934 Ga0207686_10004561 Ga0207686_100045616 137
417 3300025936 Ga0207670_10116145 Ga0207670_101161452 137
418 3300025936 Ga0207670_10352971 Ga0207670_103529712 137
419 3300025936 Ga0207670_11943425 Ga0207670_119434251 137
420 3300025937 Ga0207669_10155085 Ga0207669_101550852 137
421 3300025937 Ga0207669_10297584 Ga0207669_102975843 137
422 3300025938 Ga0207704_10010162 Ga0207704_100101625 137
423 3300025938 Ga0207704_10248624 Ga0207704_102486242 137
424 3300025940 Ga0207691_10045532 Ga0207691_100455324 137
425 3300025940 Ga0207691_10103612 Ga0207691_101036122 137
426 3300025940 Ga0207691_10407093 Ga0207691_104070932 137
427 3300025941 Ga0207711_10011139 Ga0207711_100111393 137
428 3300025941 Ga0207711_10473394 Ga0207711_104733942 137
429 3300025942 Ga0207689_10086096 Ga0207689_100860964 137
430 3300025944 Ga0207661_10861483 Ga0207661_108614832 137
431 3300025945 Ga0207679_10807060 Ga0207679_108070602 137
432 3300025960 Ga0207651_10361960 Ga0207651_103619602 137
433 3300025960 Ga0207651_10369113 Ga0207651_103691132 137
434 3300025961 Ga0207712_10242359 Ga0207712_102423592 137
435 3300025961 Ga0207712_11718799 Ga0207712_117187991 137
436 3300025986 Ga0207658_10039086 Ga0207658_100390862 137
437 3300025986 Ga0207658_10146762 Ga0207658_101467622 137
438 3300025986 Ga0207658_10680917 Ga0207658_106809172 137
439 3300025986 Ga0207658_11366225 Ga0207658_113662252 137
440 3300025986 Ga0207658_11868426 Ga0207658_118684261 137
441 3300026023 Ga0207677_10036461 Ga0207677_100364613 137
442 3300026023 Ga0207677_10497984 Ga0207677_104979842 137
443 3300026035 Ga0207703_10617354 Ga0207703_106173542 137
444 3300026067 Ga0207678_10227492 Ga0207678_102274923 137
445 3300026067 Ga0207678_11165037 Ga0207678_111650372 137
446 3300026075 Ga0207708_10054534 Ga0207708_100545346 137
447 3300026075 Ga0207708_10149509 Ga0207708_101495093 137
448 3300026088 Ga0207641_10015592 Ga0207641_100155923 137
449 3300026088 Ga0207641_10037704 Ga0207641_100377042 137
450 3300026088 Ga0207641_10040804 Ga0207641_100408044 137
451 3300026089 Ga0207648_10020832 Ga0207648_100208328 137
452 3300026089 Ga0207648_10050253 Ga0207648_100502532 137
453 3300026089 Ga0207648_10095534 Ga0207648_100955341 137
454 3300026095 Ga0207676_10002193 Ga0207676_1000219312 137
455 3300026095 Ga0207676_10461096 Ga0207676_104610962 137
456 3300026095 Ga0207676_10519004 Ga0207676_105190042 137
457 3300026095 Ga0207676_10782828 Ga0207676_107828282 137
458 3300026118 Ga0207675_100458575 Ga0207675_1004585752 137
459 3300026121 Ga0207683_10009965 Ga0207683_1000996511 137
460 3300026121 Ga0207683_10498849 Ga0207683_104988492 137
461 3300026142 Ga0207698_11199623 Ga0207698_111996232 137
462 3300027907 Ga0207428_10619363 Ga0207428_106193631 137
463 3300028379 Ga0268266_10095516 Ga0268266_100955163 137
464 3300028379 Ga0268266_10228718 Ga0268266_102287183 137
465 3300028379 Ga0268266_10356960 Ga0268266_103569602 137
466 3300028379 Ga0268266_10397223 Ga0268266_103972232 137
467 3300028379 Ga0268266_11949731 Ga0268266_119497311 137
468 3300028380 Ga0268265_11062208 Ga0268265_110622082 137
469 3300028381 Ga0268264_10189181 Ga0268264_101891813 137
470 3300028381 Ga0268264_11839185 Ga0268264_118391851 137
471 3300028573 Ga0265334_10099086 Ga0265334_100990862 137
472 3300028577 Ga0265318_10030913 Ga0265318_100309134 137
473 3300028653 Ga0265323_10012238 Ga0265323_100122384 137
474 3300028666 Ga0265336_10147173 Ga0265336_101471732 137
475 3300028800 Ga0265338_10006496 Ga0265338_1000649611 137
476 3300028800 Ga0265338_10031473 Ga0265338_100314733 137
477 3300028800 Ga0265338_10231801 Ga0265338_102318012 137
478 3300028800 Ga0265338_10237743 Ga0265338_102377432 137
479 3300031235 Ga0265330_10008764 Ga0265330_100087641 137
480 3300031239 Ga0265328_10004615 Ga0265328_100046154 137
481 3300031239 Ga0265328_10005251 Ga0265328_100052512 137
482 3300031240 Ga0265320_10091412 Ga0265320_100914122 137
483 3300031242 Ga0265329_10073748 Ga0265329_100737482 137
484 3300031249 Ga0265339_10183160 Ga0265339_101831602 137
485 3300031250 Ga0265331_10013174 Ga0265331_100131742 137
486 3300031344 Ga0265316_10171011 Ga0265316_101710113 137
487 3300031548 Ga0307408_100237898 Ga0307408_1002378983 137
488 3300031548 Ga0307408_100676921 Ga0307408_1006769212 137
489 3300031595 Ga0265313_10017323 Ga0265313_100173237 137
490 3300031665 Ga0316575_10079749 Ga0316575_100797492 137
491 3300031712 Ga0265342_10033300 Ga0265342_100333005 137
492 3300031712 Ga0265342_10080744 Ga0265342_100807443 137
493 3300031731 Ga0307405_10013515 Ga0307405_100135153 137
494 3300031852 Ga0307410_10121511 Ga0307410_101215114 137
495 3300031901 Ga0307406_10016265 Ga0307406_100162653 137
496 3300031903 Ga0307407_10073603 Ga0307407_100736034 137
497 3300031995 Ga0307409_100090527 Ga0307409_1000905272 137
498 3300031995 Ga0307409_100223826 Ga0307409_1002238264 137
499 3300032002 Ga0307416_100021690 Ga0307416_1000216907 137
500 3300032002 Ga0307416_100072122 Ga0307416_1000721223 137
501 3300032004 Ga0307414_10358594 Ga0307414_103585942 137
502 3300032005 Ga0307411_10069496 Ga0307411_100694965 137
503 3300032126 Ga0307415_100023898 Ga0307415_1000238984 137
504 3300032126 Ga0307415_102317834 Ga0307415_1023178341 137
505 3300035117 Ga0373953_0242552 Ga0373953_0242552_55_498 137
506 3300035118 Ga0373954_0034522 Ga0373954_0034522_592_1035 137
507 3300035119 Ga0373956_0021865 Ga0373956_0021865_927_1370 137
508 3300035171 Ga0373946_0359939 Ga0373946_0359939_211_624 137
509 3300035172 Ga0373955_0211557 Ga0373955_0211557_154_588 137
510 3300035410 Ga0373924_0099196 Ga0373924_0099196_527_970 137
511 3300035410 Ga0373924_0404555 Ga0373924_0404555_22_468 137
512 3300035695 Ga0373927_1010937 Ga0373927_1010937_109_522 137
513 3300035724 Ga0373933_0056585 Ga0373933_0056585_1013_1456 137
514 3300035725 Ga0373947_0357300 Ga0373947_0357300_405_818 137
515 3300036401 Ga0373937_0198114 Ga0373937_0198114_1059_1559 137
516 3300036401 Ga0373937_0377890 Ga0373937_0377890_76_522 137
517 3300036401 Ga0373937_1136852 Ga0373937_1136852_56_478 137
518 3300037068 Ga0373925_0178458 Ga0373925_0178458_423_836 137
519 3300037068 Ga0373925_1374995 Ga0373925_1374995_54_500 137
520 3300037312 Ga0395899_0000570 Ga0395899_0000570_22857_23270 137
521 3300037312 Ga0395899_0002181 Ga0395899_0002181_1356_1769 137
522 3300037312 Ga0395899_0726312 Ga0395899_0726312_156_602 137
523 3300037418 Ga0395900_0205304 Ga0395900_0205304_1415_1828 137
524 3300037418 Ga0395900_0450626 Ga0395900_0450626_388_804 137
525 3300037418 Ga0395900_0680672 Ga0395900_0680672_365_811 137
526 3300037466 Ga0395898_0021031 Ga0395898_0021031_5308_5721 137
527 3300037471 Ga0395905_0004846 Ga0395905_0004846_4533_4946 137
528 3300037471 Ga0395905_1122908 Ga0395905_1122908_154_567 137
529 3300038443 Ga0395901_0125606 Ga0395901_0125606_1276_1689 137
530 3300038443 Ga0395901_0182121 Ga0395901_0182121_1336_1749 137
531 3300038443 Ga0395901_0449362 Ga0395901_0449362_12_458 137
532 3300039437 Ga0436365_1502616 Ga0436365_1502616_63_530 137
533 3300042876 Ga0451577_0012047 Ga0451577_0012047_6495_6908 137
534 3300044673 Ga0453683_0373036 Ga0453683_0373036_54_467 137
535 3300044712 Ga0453684_0040410 Ga0453684_0040410_509_937 137
536 3300044712 Ga0453684_0167635 Ga0453684_0167635_1383_1796 137
537 3300045051 Ga0451576_0088056 Ga0451576_0088056_658_1104 137
538 3300045051 Ga0451576_0268675 Ga0451576_0268675_806_1258 137
539 3300045051 Ga0451576_0957971 Ga0451576_0957971_354_800 137
540 3300045051 Ga0451576_1116925 Ga0451576_1116925_358_804 137
541 3300045051 Ga0451576_1200430 Ga0451576_1200430_134_571 137
542 3300045051 Ga0451576_1630420 Ga0451576_1630420_71_517 137
543 3300045051 Ga0451576_2457465 Ga0451576_2457465_65_478 137
544 3300045976 Ga0466967_0441981 Ga0466967_0441981_822_1238 137
545 3300045976 Ga0466967_0553257 Ga0466967_0553257_550_1014 137
546 3300046459 Ga0495629_0503611 Ga0495629_0503611_76_519 137
547 3300046472 Ga0495580_0002914 Ga0495580_0002914_11214_11627 137
548 3300046472 Ga0495580_0464753 Ga0495580_0464753_240_740 137
549 3300046473 Ga0495582_0493483 Ga0495582_0493483_67_480 137
550 3300046475 Ga0495639_0074003 Ga0495639_0074003_881_1324 137
551 3300046499 Ga0495594_0604976 Ga0495594_0604976_134_580 137
552 3300046514 Ga0495618_0014600 Ga0495618_0014600_3604_4047 137
553 3300046517 Ga0495630_0026387 Ga0495630_0026387_600_1043 137
554 3300046517 Ga0495630_1528137 Ga0495630_1528137_46_480 137
555 3300046526 Ga0495666_0431747 Ga0495666_0431747_21_467 137
556 3300046530 Ga0495654_0179994 Ga0495654_0179994_129_542 137
557 3300046535 Ga0495586_0008895 Ga0495586_0008895_3691_4134 137
558 3300046537 Ga0495598_0133134 Ga0495598_0133134_93_506 137
559 3300046539 Ga0495621_0083098 Ga0495621_0083098_360_773 137
560 3300046559 Ga0495667_0054104 Ga0495667_0054104_1034_1477 137
561 3300046642 Ga0495634_0010848 Ga0495634_0010848_1295_1738 137
562 3300046678 Ga0495599_0544688 Ga0495599_0544688_118_558 137
563 3300046681 Ga0495647_0082717 Ga0495647_0082717_419_862 137
564 3300046683 Ga0495658_0784968 Ga0495658_0784968_123_569 137
565 3300046689 Ga0495613_0006984 Ga0495613_0006984_5073_5516 137
566 3300047319 Ga0495674_0170584 Ga0495674_0170584_1169_1612 137
567 3300047322 Ga0495680_0079942 Ga0495680_0079942_1012_1455 137
568 3300047444 Ga0495675_0280600 Ga0495675_0280600_373_822 137
569 3300047471 Ga0495684_0053441 Ga0495684_0053441_161_604 137
570 3300048090 Ga0495615_0268881 Ga0495615_0268881_62_493 137
571 3300048907 Ga0496104_1339741 Ga0496104_1339741_74_487 137
572 3300048912 Ga0496109_0409720 Ga0496109_0409720_335_751 137
573 3300048915 Ga0496112_0840173 Ga0496112_0840173_368_781 137
574 3300049568 Ga0501031_0000631 Ga0501031_0000631_8162_8596 137
575 3300049568 Ga0501031_0049874 Ga0501031_0049874_1485_1925 137
576 3300049569 Ga0501032_0002706 Ga0501032_0002706_10241_10675 137
577 3300049569 Ga0501032_0140210 Ga0501032_0140210_706_1146 137
578 3300049570 Ga0501033_0003368 Ga0501033_0003368_8262_8696 137
579 3300049570 Ga0501033_0034024 Ga0501033_0034024_2199_2639 137
580 3300049570 Ga0501033_0057492 Ga0501033_0057492_1027_1452 137
581 3300049571 Ga0501034_0156034 Ga0501034_0156034_685_1101 137
582 3300049572 Ga0501036_0448808 Ga0501036_0448808_140_565 137
583 3300049573 Ga0501037_0101773 Ga0501037_0101773_754_1179 137
584 3300049573 Ga0501037_0183297 Ga0501037_0183297_871_1311 137
585 3300049574 Ga0501038_0033270 Ga0501038_0033270_3891_4316 137
586 3300049574 Ga0501038_0145081 Ga0501038_0145081_558_974 137
587 3300049575 Ga0501039_0095339 Ga0501039_0095339_187_612 137
588 3300049575 Ga0501039_0294199 Ga0501039_0294199_313_738 137
589 3300049576 Ga0501040_0108555 Ga0501040_0108555_791_1216 137
590 3300049578 Ga0501042_0163154 Ga0501042_0163154_1015_1431 137
591 3300049578 Ga0501042_0502304 Ga0501042_0502304_352_777 137
592 3300049578 Ga0501042_0608144 Ga0501042_0608144_223_636 137
593 3300049579 Ga0501043_0152387 Ga0501043_0152387_1234_1668 137
594 3300049579 Ga0501043_0345472 Ga0501043_0345472_237_662 137
595 3300049579 Ga0501043_0545397 Ga0501043_0545397_91_507 137
596 3300049580 Ga0501046_0055377 Ga0501046_0055377_2276_2710 137
597 3300049581 Ga0501047_0066763 Ga0501047_0066763_1187_1603 137
598 3300049581 Ga0501047_0203284 Ga0501047_0203284_1028_1468 137
599 3300049582 Ga0501048_0627722 Ga0501048_0627722_304_729 137
600 3300049582 Ga0501048_0906802 Ga0501048_0906802_46_468 137
601 3300049583 Ga0501067_0102532 Ga0501067_0102532_1128_1544 137
602 3300049584 Ga0501068_0042370 Ga0501068_0042370_709_1134 137
603 3300049584 Ga0501068_0216012 Ga0501068_0216012_186_602 137
604 3300049585 Ga0501069_0020517 Ga0501069_0020517_253_669 137
605 3300049585 Ga0501069_0098424 Ga0501069_0098424_396_809 137
606 3300049586 Ga0501070_0006216 Ga0501070_0006216_3272_3685 137
607 3300049586 Ga0501070_0051481 Ga0501070_0051481_2800_3213 137
608 3300049587 Ga0501071_0754992 Ga0501071_0754992_179_604 137
609 3300049588 Ga0501072_0228777 Ga0501072_0228777_778_1203 137
610 3300049588 Ga0501072_0487980 Ga0501072_0487980_146_559 137
611 3300049589 Ga0501073_0082404 Ga0501073_0082404_574_1017 137
612 3300049589 Ga0501073_0203462 Ga0501073_0203462_666_1082 137
613 3300049589 Ga0501073_0282951 Ga0501073_0282951_617_1060 137
614 3300049590 Ga0501074_0005852 Ga0501074_0005852_1667_2080 137
615 3300049590 Ga0501074_0106334 Ga0501074_0106334_535_960 137
616 3300049590 Ga0501074_0271256 Ga0501074_0271256_711_1127 137
617 3300049590 Ga0501074_0538933 Ga0501074_0538933_354_779 137
618 3300049591 Ga0501075_0323306 Ga0501075_0323306_731_1156 137
619 3300049592 Ga0501076_0026248 Ga0501076_0026248_2263_2688 137
620 3300049592 Ga0501076_0522250 Ga0501076_0522250_337_750 137
621 3300049593 Ga0501077_0152362 Ga0501077_0152362_1014_1439 137
622 3300049593 Ga0501077_0773897 Ga0501077_0773897_84_497 137
623 3300049741 Ga0501079_0022932 Ga0501079_0022932_3546_3971 137
624 3300049741 Ga0501079_0096703 Ga0501079_0096703_1492_1917 137
625 3300049741 Ga0501079_1000871 Ga0501079_1000871_47_463 137
626 3300049742 Ga0501080_0146967 Ga0501080_0146967_633_1046 137
627 3300049742 Ga0501080_0167459 Ga0501080_0167459_74_490 137
628 3300049742 Ga0501080_0358473 Ga0501080_0358473_212_655 137
629 3300049743 Ga0501081_0192703 Ga0501081_0192703_913_1338 137
630 3300049822 Ga0501035_0027702 Ga0501035_0027702_900_1334 137
631 3300049823 Ga0501044_0000442 Ga0501044_0000442_38377_38811 137
632 3300049823 Ga0501044_0006715 Ga0501044_0006715_1942_2382 137
633 3300049823 Ga0501044_0223050 Ga0501044_0223050_862_1278 137
634 3300049824 Ga0501045_0132239 Ga0501045_0132239_581_1006 137
635 3300049824 Ga0501045_0773257 Ga0501045_0773257_212_625 137
636 3300050493 nmdc:mga0k408_20281_c1 nmdc:mga0k408_20281_c1_1629_2057 137
637 3300050507 nmdc:mga05p37_100422_c1 nmdc:mga05p37_100422_c1_873_1292 137
638 3300050507 nmdc:mga05p37_237205_c1 nmdc:mga05p37_237205_c1_394_807 137
639 3300050507 nmdc:mga05p37_368604_c1 nmdc:mga05p37_368604_c1_167_586 137
640 3300050507 nmdc:mga05p37_48070_c1 nmdc:mga05p37_48070_c1_3421_3834 137
641 3300050507 nmdc:mga05p37_639_c1 nmdc:mga05p37_639_c1_37677_38096 137
642 3300050508 nmdc:mga09592_298966_c1 nmdc:mga09592_298966_c1_454_867 137
643 3300050508 nmdc:mga09592_77365_c1 nmdc:mga09592_77365_c1_1576_1995 137
644 3300050509 nmdc:mga0qj67_61221_c1 nmdc:mga0qj67_61221_c1_2063_2482 137
645 3300050509 nmdc:mga0qj67_75438_c1 nmdc:mga0qj67_75438_c1_2231_2644 137
646 3300050510 nmdc:mga06r32_1071_c1 nmdc:mga06r32_1071_c1_5502_5921 137
647 3300050510 nmdc:mga06r32_415554_c1 nmdc:mga06r32_415554_c1_71_484 137
648 3300050510 nmdc:mga06r32_423676_c1 nmdc:mga06r32_423676_c1_60_521 137
649 3300050510 nmdc:mga06r32_591106_c1 nmdc:mga06r32_591106_c1_485_898 137
650 3300050511 nmdc:mga08y16_948676_c1 nmdc:mga08y16_948676_c1_199_645 137
651 3300050512 nmdc:mga0n895_1322660_c1 nmdc:mga0n895_1322660_c1_143_556 137
652 3300050512 nmdc:mga0n895_1597249_c1 nmdc:mga0n895_1597249_c1_179_592 137
653 3300050512 nmdc:mga0n895_27412_c1 nmdc:mga0n895_27412_c1_4459_4872 137
654 3300050512 nmdc:mga0n895_558486_c1 nmdc:mga0n895_558486_c1_563_976 137
655 3300050512 nmdc:mga0n895_83406_c1 nmdc:mga0n895_83406_c1_2158_2571 137
656 3300050513 nmdc:mga0rr50_1114364_c1 nmdc:mga0rr50_1114364_c1_244_657 137
657 3300050513 nmdc:mga0rr50_530763_c1 nmdc:mga0rr50_530763_c1_551_964 137
658 3300050513 nmdc:mga0rr50_7612_c1 nmdc:mga0rr50_7612_c1_3478_3891 137
659 3300050514 nmdc:mga08x19_458659_c1 nmdc:mga08x19_458659_c1_249_665 137
660 3300050514 nmdc:mga08x19_506466_c1 nmdc:mga08x19_506466_c1_145_558 137
661 3300050515 nmdc:mga0a205_212288_c1 nmdc:mga0a205_212288_c1_539_952 137
662 3300050515 nmdc:mga0a205_625855_c1 nmdc:mga0a205_625855_c1_122_535 137
663 3300050515 nmdc:mga0a205_73683_c1 nmdc:mga0a205_73683_c1_315_728 137
664 3300050515 nmdc:mga0a205_746217_c1 nmdc:mga0a205_746217_c1_253_666 137
665 3300053077 Ga0495601_0061455 Ga0495601_0061455_1480_1896 137
666 3300054114 Ga0501084_0056030 Ga0501084_0056030_1702_2127 137
667 3300054114 Ga0501084_0170957 Ga0501084_0170957_1151_1576 137
668 3300054114 Ga0501084_1487873 Ga0501084_1487873_125_541 137
669 3300061734 Ga0530510_0024902 Ga0530510_0024902_3722_4147 137
670 3300061734 Ga0530510_0586565 Ga0530510_0586565_243_668 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

158

0.89

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

26

159

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8992 1 136
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8738 1 136
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8484 1 136
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8423 1 136
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.8349 1 135
ID Description Score Start End Superfamily
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9517 80 135 3.30.720.110
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9218 78 136 3.30.720.110
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9108 11 137 3.10.180.10
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9072 78 136 3.30.720.110
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8772 80 135 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A1J5SNH6-F1-model_v4 Uncharacterized protein 0.9977 2 137
AF-A0A536UDD0-F1-model_v4 VOC family protein 0.9939 1 137
AF-A1VUF7-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9933 1 137 GO:0008168
GO:0032259
AF-A0A1Y6BHF6-F1-model_v4 PhnB protein 0.9928 1 137
AF-A0A534STB7-F1-model_v4 VOC family protein 0.9917 1 136

Feature Viewer

pLDDT pTM Quality
94.76 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map