F474077
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 670 | 320 | 670 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10660660|Ga0105243_106606602 |
| Length | 166 |
| Sequence | MTFAGADETSRNKDQLNSMSTKKENRFIQPYLFFNGRCEEAVEFYRKALGAEVEIMMRFKDSPEPHQPGMVPPGFENKIMHTSFHIGETTVMASDGCSAEKPSFQGFSLSLSVPSESEADRAFAALAEAGQVRMPLTKTFWSPRFGMVADRFGIGWMITVPPAGQN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 191 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 199 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 231 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 232 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 233 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 234 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 235 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 236 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 237 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 238 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 308 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 309 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.9 |
| Nodule | 0 |
| Rhizoplane | 0.75 |
| Rhizosphere | 97.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3656236 | 2162886007 | Bacteria | 944 |
| 2 | MBSR1b_contig_13185514 | 2162886012 | Bacteria | 866 |
| 3 | JGI24033J26618_1027880 | 3300002155 | Bacteria | 749 |
| 4 | rootH2_10179150 | 3300003320 | Unclassified | 1123 |
| 5 | Ga0065714_10282279 | 3300005288 | Bacteria | 721 |
| 6 | Ga0065704_10137463 | 3300005289 | Bacteria | 1552 |
| 7 | Ga0065707_10097886 | 3300005295 | Bacteria | 3132 |
| 8 | Ga0070658_11985808 | 3300005327 | Unclassified | 502 |
| 9 | Ga0070676_10006697 | 3300005328 | Bacteria | 6173 |
| 10 | Ga0070676_10460829 | 3300005328 | Bacteria | 896 |
| 11 | Ga0070683_100057726 | 3300005329 | Bacteria | 3606 |
| 12 | Ga0070683_100670578 | 3300005329 | Bacteria | 993 |
| 13 | Ga0070683_101492597 | 3300005329 | Bacteria | 650 |
| 14 | Ga0070690_100103505 | 3300005330 | Bacteria | 1890 |
| 15 | Ga0070690_100673285 | 3300005330 | Bacteria | 792 |
| 16 | Ga0070690_100770067 | 3300005330 | Unclassified | 744 |
| 17 | Ga0070670_100254993 | 3300005331 | Bacteria | 1529 |
| 18 | Ga0070670_100446621 | 3300005331 | Bacteria | 1145 |
| 19 | Ga0070677_10005945 | 3300005333 | Bacteria | 4044 |
| 20 | Ga0070677_10245231 | 3300005333 | Bacteria | 886 |
| 21 | Ga0068869_100006593 | 3300005334 | Bacteria | 7367 |
| 22 | Ga0070666_10021060 | 3300005335 | Bacteria | 4222 |
| 23 | Ga0070680_100307228 | 3300005336 | Bacteria | 1345 |
| 24 | Ga0070680_101132707 | 3300005336 | Unclassified | 676 |
| 25 | Ga0068868_100051356 | 3300005338 | Bacteria | 3243 |
| 26 | Ga0068868_100454666 | 3300005338 | Bacteria | 1114 |
| 27 | Ga0068868_100996147 | 3300005338 | Bacteria | 766 |
| 28 | Ga0068868_102013559 | 3300005338 | Bacteria | 548 |
| 29 | Ga0070689_100104977 | 3300005340 | Bacteria | 2240 |
| 30 | Ga0070689_100502165 | 3300005340 | Bacteria | 1039 |
| 31 | Ga0070689_101337257 | 3300005340 | Unclassified | 646 |
| 32 | Ga0070691_10011578 | 3300005341 | Bacteria | 4031 |
| 33 | Ga0070687_100451693 | 3300005343 | Bacteria | 855 |
| 34 | Ga0070687_100600573 | 3300005343 | Bacteria | 756 |
| 35 | Ga0070692_10062733 | 3300005345 | Bacteria | 1962 |
| 36 | Ga0070692_10548203 | 3300005345 | Bacteria | 757 |
| 37 | Ga0070668_101279098 | 3300005347 | Unclassified | 666 |
| 38 | Ga0070669_100171774 | 3300005353 | Bacteria | 1690 |
| 39 | Ga0070669_100284802 | 3300005353 | Bacteria | 1325 |
| 40 | Ga0070675_100191262 | 3300005354 | Bacteria | 1773 |
| 41 | Ga0070675_100517451 | 3300005354 | Bacteria | 1076 |
| 42 | Ga0070675_102000350 | 3300005354 | Unclassified | 534 |
| 43 | Ga0070671_100028460 | 3300005355 | Bacteria | 4602 |
| 44 | Ga0070671_100075823 | 3300005355 | Bacteria | 2810 |
| 45 | Ga0070671_100255328 | 3300005355 | Bacteria | 1489 |
| 46 | Ga0070671_100761636 | 3300005355 | Bacteria | 842 |
| 47 | Ga0070674_100113001 | 3300005356 | Bacteria | 1997 |
| 48 | Ga0070674_100113445 | 3300005356 | Bacteria | 1994 |
| 49 | Ga0070673_100465860 | 3300005364 | Bacteria | 1138 |
| 50 | Ga0070688_100269385 | 3300005365 | Bacteria | 1219 |
| 51 | Ga0070688_101673864 | 3300005365 | Bacteria | 520 |
| 52 | Ga0070659_101128373 | 3300005366 | Bacteria | 692 |
| 53 | Ga0070667_100280869 | 3300005367 | Bacteria | 1495 |
| 54 | Ga0070667_100737629 | 3300005367 | Bacteria | 913 |
| 55 | Ga0070667_101257158 | 3300005367 | Bacteria | 693 |
| 56 | Ga0070703_10129479 | 3300005406 | Bacteria | 925 |
| 57 | Ga0070709_10455873 | 3300005434 | Bacteria | 964 |
| 58 | Ga0070709_10813712 | 3300005434 | Bacteria | 734 |
| 59 | Ga0070714_100004720 | 3300005435 | Bacteria | 10309 |
| 60 | Ga0070714_100191167 | 3300005435 | Bacteria | 1868 |
| 61 | Ga0070714_100956092 | 3300005435 | Unclassified | 833 |
| 62 | Ga0070714_101262542 | 3300005435 | Bacteria | 721 |
| 63 | Ga0070713_100713031 | 3300005436 | Unclassified | 958 |
| 64 | Ga0070713_101811134 | 3300005436 | Bacteria | 592 |
| 65 | Ga0070710_10076220 | 3300005437 | Bacteria | 1946 |
| 66 | Ga0070701_10577749 | 3300005438 | Unclassified | 741 |
| 67 | Ga0070701_10584205 | 3300005438 | Bacteria | 737 |
| 68 | Ga0070711_100160343 | 3300005439 | Bacteria | 1705 |
| 69 | Ga0070705_100015637 | 3300005440 | Bacteria | 3927 |
| 70 | Ga0070700_100251410 | 3300005441 | Bacteria | 1268 |
| 71 | Ga0070700_100302460 | 3300005441 | Bacteria | 1168 |
| 72 | Ga0070694_100796156 | 3300005444 | Unclassified | 775 |
| 73 | Ga0070708_100041235 | 3300005445 | Bacteria | 4047 |
| 74 | Ga0070708_100341698 | 3300005445 | Bacteria | 1411 |
| 75 | Ga0070708_100750149 | 3300005445 | Bacteria | 918 |
| 76 | Ga0070663_100711116 | 3300005455 | Bacteria | 855 |
| 77 | Ga0070678_100134872 | 3300005456 | Bacteria | 1967 |
| 78 | Ga0070678_100349560 | 3300005456 | Bacteria | 1271 |
| 79 | Ga0070678_101315180 | 3300005456 | Bacteria | 673 |
| 80 | Ga0070662_100169171 | 3300005457 | Bacteria | 1715 |
| 81 | Ga0070662_100228439 | 3300005457 | Bacteria | 1488 |
| 82 | Ga0070662_100252671 | 3300005457 | Bacteria | 1418 |
| 83 | Ga0070681_10099661 | 3300005458 | Bacteria | 2851 |
| 84 | Ga0070681_10545646 | 3300005458 | Bacteria | 1073 |
| 85 | Ga0070681_10972983 | 3300005458 | Bacteria | 768 |
| 86 | Ga0068867_100039383 | 3300005459 | Bacteria | 3446 |
| 87 | Ga0068867_100120300 | 3300005459 | Bacteria | 2029 |
| 88 | Ga0068867_100162813 | 3300005459 | Bacteria | 1760 |
| 89 | Ga0070685_10247387 | 3300005466 | Bacteria | 1179 |
| 90 | Ga0070706_100108905 | 3300005467 | Bacteria | 2577 |
| 91 | Ga0070706_100154369 | 3300005467 | Bacteria | 2143 |
| 92 | Ga0070707_100029338 | 3300005468 | Bacteria | 5238 |
| 93 | Ga0070707_100082110 | 3300005468 | Bacteria | 3112 |
| 94 | Ga0070707_101571094 | 3300005468 | Bacteria | 625 |
| 95 | Ga0070698_100010681 | 3300005471 | Bacteria | 9783 |
| 96 | Ga0070698_100407519 | 3300005471 | Bacteria | 1293 |
| 97 | Ga0070698_100605363 | 3300005471 | Bacteria | 1036 |
| 98 | Ga0070699_100801640 | 3300005518 | Unclassified | 862 |
| 99 | Ga0070679_100289260 | 3300005530 | Bacteria | 1590 |
| 100 | Ga0070679_100442045 | 3300005530 | Bacteria | 1245 |
| 101 | Ga0070684_101413003 | 3300005535 | Unclassified | 655 |
| 102 | Ga0070697_100048365 | 3300005536 | Bacteria | 3448 |
| 103 | Ga0070697_100476468 | 3300005536 | Bacteria | 1090 |
| 104 | Ga0068853_101518488 | 3300005539 | Bacteria | 649 |
| 105 | Ga0070672_100042667 | 3300005543 | Bacteria | 3493 |
| 106 | Ga0070672_100064861 | 3300005543 | Bacteria | 2887 |
| 107 | Ga0070686_100049183 | 3300005544 | Bacteria | 2674 |
| 108 | Ga0070695_100689810 | 3300005545 | Bacteria | 810 |
| 109 | Ga0070695_101092125 | 3300005545 | Bacteria | 652 |
| 110 | Ga0070696_100405936 | 3300005546 | Bacteria | 1067 |
| 111 | Ga0070696_100496446 | 3300005546 | Bacteria | 970 |
| 112 | Ga0070696_100560636 | 3300005546 | Bacteria | 916 |
| 113 | Ga0070693_100154340 | 3300005547 | Bacteria | 1457 |
| 114 | Ga0070693_100665073 | 3300005547 | Bacteria | 759 |
| 115 | Ga0070665_100000213 | 3300005548 | Bacteria | 100019 |
| 116 | Ga0070665_100224024 | 3300005548 | Bacteria | 1881 |
| 117 | Ga0070665_100270395 | 3300005548 | Unclassified | 1701 |
| 118 | Ga0070665_100581028 | 3300005548 | Unclassified | 1133 |
| 119 | Ga0070704_100122532 | 3300005549 | Bacteria | 2000 |
| 120 | Ga0070704_100165672 | 3300005549 | Bacteria | 1752 |
| 121 | Ga0070704_100845743 | 3300005549 | Unclassified | 820 |
| 122 | Ga0068855_100416113 | 3300005563 | Bacteria | 1471 |
| 123 | Ga0068855_101117399 | 3300005563 | Bacteria | 823 |
| 124 | Ga0070664_100354320 | 3300005564 | Bacteria | 1336 |
| 125 | Ga0070664_100785045 | 3300005564 | Unclassified | 890 |
| 126 | Ga0068857_101221424 | 3300005577 | Bacteria | 728 |
| 127 | Ga0068854_101520972 | 3300005578 | Bacteria | 608 |
| 128 | Ga0068856_100046850 | 3300005614 | Bacteria | 4258 |
| 129 | Ga0070702_100009578 | 3300005615 | Bacteria | 4748 |
| 130 | Ga0068852_100468748 | 3300005616 | Bacteria | 1250 |
| 131 | Ga0068852_101723331 | 3300005616 | Bacteria | 649 |
| 132 | Ga0068859_100065189 | 3300005617 | Bacteria | 3677 |
| 133 | Ga0068859_100399868 | 3300005617 | Bacteria | 1470 |
| 134 | Ga0068859_100520746 | 3300005617 | Bacteria | 1284 |
| 135 | Ga0068864_100129379 | 3300005618 | Bacteria | 2266 |
| 136 | Ga0068864_100570896 | 3300005618 | Bacteria | 1095 |
| 137 | Ga0068866_10262125 | 3300005718 | Bacteria | 1063 |
| 138 | Ga0068866_11044219 | 3300005718 | Bacteria | 583 |
| 139 | Ga0068866_11147425 | 3300005718 | Bacteria | 559 |
| 140 | Ga0068861_100093020 | 3300005719 | Bacteria | 2383 |
| 141 | Ga0068851_10692184 | 3300005834 | Bacteria | 627 |
| 142 | Ga0068851_10859940 | 3300005834 | Bacteria | 566 |
| 143 | Ga0068870_10084739 | 3300005840 | Bacteria | 1760 |
| 144 | Ga0068863_100008248 | 3300005841 | Bacteria | 10178 |
| 145 | Ga0068863_100059673 | 3300005841 | Bacteria | 3609 |
| 146 | Ga0068863_102259039 | 3300005841 | Bacteria | 554 |
| 147 | Ga0068858_100050595 | 3300005842 | Bacteria | 3845 |
| 148 | Ga0068860_100065520 | 3300005843 | Bacteria | 3450 |
| 149 | Ga0068862_100324760 | 3300005844 | Bacteria | 1421 |
| 150 | Ga0068862_101102400 | 3300005844 | Bacteria | 789 |
| 151 | Ga0068862_101252450 | 3300005844 | Unclassified | 742 |
| 152 | Ga0081455_10001038 | 3300005937 | Bacteria | 35067 |
| 153 | Ga0081455_10254376 | 3300005937 | Bacteria | 1283 |
| 154 | Ga0081538_10005463 | 3300005981 | Bacteria | 11415 |
| 155 | Ga0081538_10021530 | 3300005981 | Bacteria | 4701 |
| 156 | Ga0081538_10335284 | 3300005981 | Bacteria | 549 |
| 157 | Ga0081540_1138026 | 3300005983 | Bacteria | 984 |
| 158 | Ga0070717_10021015 | 3300006028 | Bacteria | 5142 |
| 159 | Ga0075363_100308751 | 3300006048 | Bacteria | 919 |
| 160 | Ga0070716_100063940 | 3300006173 | Bacteria | 2138 |
| 161 | Ga0075362_10253828 | 3300006177 | Bacteria | 865 |
| 162 | Ga0075427_10025225 | 3300006194 | Bacteria | 958 |
| 163 | Ga0075366_10026233 | 3300006195 | Bacteria | 3411 |
| 164 | Ga0075366_10074178 | 3300006195 | Bacteria | 2028 |
| 165 | Ga0097621_100107358 | 3300006237 | Bacteria | 2356 |
| 166 | Ga0097621_100622818 | 3300006237 | Bacteria | 988 |
| 167 | Ga0068871_100890579 | 3300006358 | Bacteria | 824 |
| 168 | Ga0075428_100033970 | 3300006844 | Bacteria | 5627 |
| 169 | Ga0075428_100146614 | 3300006844 | Bacteria | 2565 |
| 170 | Ga0075428_100333119 | 3300006844 | Bacteria | 1630 |
| 171 | Ga0075428_100879519 | 3300006844 | Bacteria | 951 |
| 172 | Ga0075428_101163997 | 3300006844 | Bacteria | 813 |
| 173 | Ga0075428_101836071 | 3300006844 | Bacteria | 630 |
| 174 | Ga0075430_100034821 | 3300006846 | Bacteria | 4274 |
| 175 | Ga0075430_100086200 | 3300006846 | Bacteria | 2629 |
| 176 | Ga0075430_100104588 | 3300006846 | Bacteria | 2363 |
| 177 | Ga0075431_100004030 | 3300006847 | Bacteria | 14308 |
| 178 | Ga0075431_100021493 | 3300006847 | Bacteria | 6600 |
| 179 | Ga0075431_100716502 | 3300006847 | Bacteria | 977 |
| 180 | Ga0075431_101231338 | 3300006847 | Bacteria | 711 |
| 181 | Ga0075433_10000563 | 3300006852 | Bacteria | 24441 |
| 182 | Ga0075433_10335548 | 3300006852 | Bacteria | 1336 |
| 183 | Ga0075433_10344199 | 3300006852 | Bacteria | 1318 |
| 184 | Ga0075433_11686332 | 3300006852 | Bacteria | 546 |
| 185 | Ga0075434_100007123 | 3300006871 | Bacteria | 10331 |
| 186 | Ga0075434_100027156 | 3300006871 | Bacteria | 5617 |
| 187 | Ga0075434_100176498 | 3300006871 | Bacteria | 2156 |
| 188 | Ga0075434_100686298 | 3300006871 | Bacteria | 1042 |
| 189 | Ga0075434_100901216 | 3300006871 | Bacteria | 899 |
| 190 | Ga0075429_100028261 | 3300006880 | Bacteria | 4870 |
| 191 | Ga0075429_101109440 | 3300006880 | Bacteria | 691 |
| 192 | Ga0075429_101337146 | 3300006880 | Bacteria | 624 |
| 193 | Ga0075429_101360632 | 3300006880 | Unclassified | 619 |
| 194 | Ga0075429_101615048 | 3300006880 | Bacteria | 563 |
| 195 | Ga0068865_100056205 | 3300006881 | Bacteria | 2741 |
| 196 | Ga0068865_100082112 | 3300006881 | Bacteria | 2316 |
| 197 | Ga0068865_101395657 | 3300006881 | Unclassified | 625 |
| 198 | Ga0075436_100086008 | 3300006914 | Bacteria | 2183 |
| 199 | Ga0075436_100192897 | 3300006914 | Bacteria | 1442 |
| 200 | Ga0075436_100284912 | 3300006914 | Bacteria | 1182 |
| 201 | Ga0097620_100065193 | 3300006931 | Bacteria | 3677 |
| 202 | Ga0097620_100399868 | 3300006931 | Bacteria | 1470 |
| 203 | Ga0097620_100520704 | 3300006931 | Bacteria | 1284 |
| 204 | Ga0075435_100074197 | 3300007076 | Bacteria | 2782 |
| 205 | Ga0075435_100136640 | 3300007076 | Bacteria | 2054 |
| 206 | Ga0075435_100153599 | 3300007076 | Bacteria | 1936 |
| 207 | Ga0105240_10527188 | 3300009093 | Bacteria | 1310 |
| 208 | Ga0111539_10152367 | 3300009094 | Bacteria | 2706 |
| 209 | Ga0111539_10448084 | 3300009094 | Unclassified | 1503 |
| 210 | Ga0111539_10506146 | 3300009094 | Bacteria | 1407 |
| 211 | Ga0111539_11064073 | 3300009094 | Bacteria | 940 |
| 212 | Ga0111539_12854796 | 3300009094 | Bacteria | 559 |
| 213 | Ga0105245_10353838 | 3300009098 | Bacteria | 1456 |
| 214 | Ga0105245_11854281 | 3300009098 | Unclassified | 656 |
| 215 | Ga0105247_10293878 | 3300009101 | Bacteria | 1125 |
| 216 | Ga0105247_11414443 | 3300009101 | Bacteria | 563 |
| 217 | Ga0114129_10001057 | 3300009147 | Bacteria | 36115 |
| 218 | Ga0114129_10002853 | 3300009147 | Bacteria | 24169 |
| 219 | Ga0114129_10064442 | 3300009147 | Bacteria | 5114 |
| 220 | Ga0114129_10389415 | 3300009147 | Bacteria | 1839 |
| 221 | Ga0114129_10833197 | 3300009147 | Bacteria | 1174 |
| 222 | Ga0114129_11334113 | 3300009147 | Bacteria | 888 |
| 223 | Ga0114129_11398260 | 3300009147 | Bacteria | 863 |
| 224 | Ga0114129_11604281 | 3300009147 | Bacteria | 796 |
| 225 | Ga0114129_12128998 | 3300009147 | Bacteria | 676 |
| 226 | Ga0114129_12283945 | 3300009147 | Unclassified | 650 |
| 227 | Ga0114129_13108299 | 3300009147 | Bacteria | 542 |
| 228 | Ga0105243_10302239 | 3300009148 | Bacteria | 1451 |
| 229 | Ga0105243_10660660 | 3300009148 | Bacteria | 1014 |
| 230 | Ga0105241_10965480 | 3300009174 | Bacteria | 795 |
| 231 | Ga0105242_10124258 | 3300009176 | Bacteria | 2219 |
| 232 | Ga0105242_10182571 | 3300009176 | Bacteria | 1852 |
| 233 | Ga0105248_10011418 | 3300009177 | Bacteria | 9789 |
| 234 | Ga0105248_10105975 | 3300009177 | Bacteria | 3170 |
| 235 | Ga0105238_10018245 | 3300009551 | Bacteria | 7137 |
| 236 | Ga0105249_10118923 | 3300009553 | Bacteria | 2509 |
| 237 | Ga0105249_10189724 | 3300009553 | Bacteria | 2005 |
| 238 | Ga0105249_12300166 | 3300009553 | Bacteria | 612 |
| 239 | Ga0099796_10080296 | 3300010159 | Bacteria | 1195 |
| 240 | Ga0099796_10299585 | 3300010159 | Bacteria | 681 |
| 241 | Ga0105239_10160510 | 3300010375 | Bacteria | 2511 |
| 242 | Ga0105239_11120665 | 3300010375 | Bacteria | 906 |
| 243 | Ga0105239_12367018 | 3300010375 | Bacteria | 618 |
| 244 | Ga0105246_10070025 | 3300011119 | Bacteria | 2466 |
| 245 | Ga0105246_10237977 | 3300011119 | Bacteria | 1438 |
| 246 | Ga0105246_11284024 | 3300011119 | Bacteria | 678 |
| 247 | Ga0157370_10138398 | 3300013104 | Bacteria | 2268 |
| 248 | Ga0157369_10125280 | 3300013105 | Bacteria | 2724 |
| 249 | Ga0157374_10165330 | 3300013296 | Bacteria | 2156 |
| 250 | Ga0157374_10210725 | 3300013296 | Bacteria | 1905 |
| 251 | Ga0157374_10225191 | 3300013296 | Bacteria | 1841 |
| 252 | Ga0157374_10438900 | 3300013296 | Bacteria | 1306 |
| 253 | Ga0157378_10030129 | 3300013297 | Bacteria | 4794 |
| 254 | Ga0157378_10113850 | 3300013297 | Bacteria | 2484 |
| 255 | Ga0157378_10847352 | 3300013297 | Bacteria | 942 |
| 256 | Ga0157372_10013791 | 3300013307 | Bacteria | 8636 |
| 257 | Ga0157372_10105472 | 3300013307 | Bacteria | 3223 |
| 258 | Ga0157375_10000111 | 3300013308 | Bacteria | 79589 |
| 259 | Ga0157375_10048135 | 3300013308 | Bacteria | 4168 |
| 260 | Ga0157375_10078285 | 3300013308 | Bacteria | 3338 |
| 261 | Ga0157375_10117523 | 3300013308 | Bacteria | 2765 |
| 262 | Ga0157375_10493520 | 3300013308 | Bacteria | 1389 |
| 263 | Ga0157375_13247026 | 3300013308 | Unclassified | 542 |
| 264 | Ga0163163_10789135 | 3300014325 | Bacteria | 1013 |
| 265 | Ga0163163_11189296 | 3300014325 | Bacteria | 825 |
| 266 | Ga0157379_10015814 | 3300014968 | Bacteria | 6630 |
| 267 | Ga0157379_10457428 | 3300014968 | Bacteria | 1179 |
| 268 | Ga0157376_10449346 | 3300014969 | Bacteria | 1257 |
| 269 | Ga0163161_10405754 | 3300017792 | Bacteria | 1094 |
| 270 | Ga0163161_10451046 | 3300017792 | Bacteria | 1040 |
| 271 | Ga0207697_10324372 | 3300025315 | Bacteria | 683 |
| 272 | Ga0207656_10564555 | 3300025321 | Bacteria | 580 |
| 273 | Ga0207682_10056075 | 3300025893 | Bacteria | 1640 |
| 274 | Ga0207688_10010225 | 3300025901 | Bacteria | 5108 |
| 275 | Ga0207680_10010143 | 3300025903 | Bacteria | 4701 |
| 276 | Ga0207685_10201061 | 3300025905 | Bacteria | 936 |
| 277 | Ga0207685_10438866 | 3300025905 | Bacteria | 677 |
| 278 | Ga0207645_10004849 | 3300025907 | Bacteria | 9876 |
| 279 | Ga0207643_10060709 | 3300025908 | Bacteria | 2159 |
| 280 | Ga0207643_10093008 | 3300025908 | Bacteria | 1760 |
| 281 | Ga0207684_10099871 | 3300025910 | Bacteria | 2479 |
| 282 | Ga0207684_10153184 | 3300025910 | Bacteria | 1984 |
| 283 | Ga0207684_10490460 | 3300025910 | Bacteria | 1053 |
| 284 | Ga0207684_11356458 | 3300025910 | Unclassified | 584 |
| 285 | Ga0207654_10747114 | 3300025911 | Bacteria | 705 |
| 286 | Ga0207707_10285019 | 3300025912 | Bacteria | 1430 |
| 287 | Ga0207695_10046527 | 3300025913 | Bacteria | 4599 |
| 288 | Ga0207693_10062934 | 3300025915 | Bacteria | 2907 |
| 289 | Ga0207660_10277645 | 3300025917 | Bacteria | 1329 |
| 290 | Ga0207662_10277776 | 3300025918 | Bacteria | 1107 |
| 291 | Ga0207662_10728406 | 3300025918 | Bacteria | 696 |
| 292 | Ga0207662_10911090 | 3300025918 | Bacteria | 623 |
| 293 | Ga0207649_11621418 | 3300025920 | Bacteria | 512 |
| 294 | Ga0207652_10370143 | 3300025921 | Bacteria | 1293 |
| 295 | Ga0207646_10040212 | 3300025922 | Bacteria | 4206 |
| 296 | Ga0207646_10065229 | 3300025922 | Bacteria | 3251 |
| 297 | Ga0207646_11251808 | 3300025922 | Bacteria | 649 |
| 298 | Ga0207694_10053367 | 3300025924 | Bacteria | 3134 |
| 299 | Ga0207650_10003791 | 3300025925 | Bacteria | 10339 |
| 300 | Ga0207650_10126538 | 3300025925 | Bacteria | 1995 |
| 301 | Ga0207659_10038703 | 3300025926 | Bacteria | 3319 |
| 302 | Ga0207659_10155406 | 3300025926 | Bacteria | 1790 |
| 303 | Ga0207659_10265962 | 3300025926 | Bacteria | 1397 |
| 304 | Ga0207687_10364018 | 3300025927 | Bacteria | 1181 |
| 305 | Ga0207687_11272338 | 3300025927 | Unclassified | 632 |
| 306 | Ga0207700_11011003 | 3300025928 | Unclassified | 744 |
| 307 | Ga0207664_10003657 | 3300025929 | Bacteria | 10301 |
| 308 | Ga0207664_10451878 | 3300025929 | Bacteria | 1147 |
| 309 | Ga0207664_11091830 | 3300025929 | Bacteria | 713 |
| 310 | Ga0207644_10014819 | 3300025931 | Bacteria | 5226 |
| 311 | Ga0207644_10054631 | 3300025931 | Bacteria | 2877 |
| 312 | Ga0207644_10074166 | 3300025931 | Bacteria | 2497 |
| 313 | Ga0207706_10350969 | 3300025933 | Bacteria | 1283 |
| 314 | Ga0207706_10504641 | 3300025933 | Bacteria | 1044 |
| 315 | Ga0207686_10004561 | 3300025934 | Bacteria | 7423 |
| 316 | Ga0207670_10116145 | 3300025936 | Unclassified | 1937 |
| 317 | Ga0207670_10352971 | 3300025936 | Bacteria | 1165 |
| 318 | Ga0207670_11943425 | 3300025936 | Bacteria | 500 |
| 319 | Ga0207669_10155085 | 3300025937 | Bacteria | 1609 |
| 320 | Ga0207669_10297584 | 3300025937 | Bacteria | 1225 |
| 321 | Ga0207704_10010162 | 3300025938 | Bacteria | 4576 |
| 322 | Ga0207704_10248624 | 3300025938 | Bacteria | 1333 |
| 323 | Ga0207665_10386809 | 3300025939 | Bacteria | 1063 |
| 324 | Ga0207691_10045532 | 3300025940 | Bacteria | 4032 |
| 325 | Ga0207691_10103612 | 3300025940 | Bacteria | 2537 |
| 326 | Ga0207691_10407093 | 3300025940 | Bacteria | 1160 |
| 327 | Ga0207711_10011139 | 3300025941 | Bacteria | 7473 |
| 328 | Ga0207711_10473394 | 3300025941 | Bacteria | 1167 |
| 329 | Ga0207689_10086096 | 3300025942 | Bacteria | 2583 |
| 330 | Ga0207661_10041605 | 3300025944 | Bacteria | 3618 |
| 331 | Ga0207661_10170911 | 3300025944 | Bacteria | 1892 |
| 332 | Ga0207661_10861483 | 3300025944 | Bacteria | 834 |
| 333 | Ga0207679_10807060 | 3300025945 | Bacteria | 856 |
| 334 | Ga0207651_10361960 | 3300025960 | Bacteria | 1224 |
| 335 | Ga0207651_10369113 | 3300025960 | Bacteria | 1213 |
| 336 | Ga0207712_10242359 | 3300025961 | Bacteria | 1453 |
| 337 | Ga0207712_11718799 | 3300025961 | Bacteria | 562 |
| 338 | Ga0207668_11247361 | 3300025972 | Bacteria | 669 |
| 339 | Ga0207640_10922796 | 3300025981 | Bacteria | 764 |
| 340 | Ga0207658_10039086 | 3300025986 | Bacteria | 3422 |
| 341 | Ga0207658_10146762 | 3300025986 | Bacteria | 1917 |
| 342 | Ga0207658_10680917 | 3300025986 | Bacteria | 928 |
| 343 | Ga0207658_11366225 | 3300025986 | Bacteria | 648 |
| 344 | Ga0207658_11868426 | 3300025986 | Bacteria | 547 |
| 345 | Ga0207677_10036461 | 3300026023 | Bacteria | 3205 |
| 346 | Ga0207677_10497984 | 3300026023 | Bacteria | 1053 |
| 347 | Ga0207677_11386508 | 3300026023 | Bacteria | 647 |
| 348 | Ga0207703_10617354 | 3300026035 | Bacteria | 1026 |
| 349 | Ga0207678_10227492 | 3300026067 | Bacteria | 1597 |
| 350 | Ga0207678_10913400 | 3300026067 | Unclassified | 776 |
| 351 | Ga0207678_11165037 | 3300026067 | Bacteria | 682 |
| 352 | Ga0207708_10054534 | 3300026075 | Bacteria | 3048 |
| 353 | Ga0207708_10149509 | 3300026075 | Bacteria | 1837 |
| 354 | Ga0207702_10135629 | 3300026078 | Bacteria | 2220 |
| 355 | Ga0207641_10015592 | 3300026088 | Bacteria | 6228 |
| 356 | Ga0207641_10037704 | 3300026088 | Bacteria | 4038 |
| 357 | Ga0207641_10040804 | 3300026088 | Bacteria | 3888 |
| 358 | Ga0207648_10020832 | 3300026089 | Bacteria | 5903 |
| 359 | Ga0207648_10050253 | 3300026089 | Bacteria | 3646 |
| 360 | Ga0207648_10095534 | 3300026089 | Bacteria | 2600 |
| 361 | Ga0207676_10002193 | 3300026095 | Bacteria | 14076 |
| 362 | Ga0207676_10461096 | 3300026095 | Bacteria | 1200 |
| 363 | Ga0207676_10519004 | 3300026095 | Bacteria | 1134 |
| 364 | Ga0207676_10782828 | 3300026095 | Bacteria | 929 |
| 365 | Ga0207675_100458575 | 3300026118 | Bacteria | 1264 |
| 366 | Ga0207683_10009965 | 3300026121 | Bacteria | 8107 |
| 367 | Ga0207683_10498849 | 3300026121 | Bacteria | 1124 |
| 368 | Ga0207683_10766097 | 3300026121 | Bacteria | 895 |
| 369 | Ga0207698_11121233 | 3300026142 | Bacteria | 800 |
| 370 | Ga0207698_11199623 | 3300026142 | Bacteria | 773 |
| 371 | Ga0207698_11904645 | 3300026142 | Bacteria | 609 |
| 372 | Ga0207428_10497186 | 3300027907 | Bacteria | 886 |
| 373 | Ga0207428_10619363 | 3300027907 | Bacteria | 779 |
| 374 | Ga0268266_10000235 | 3300028379 | Bacteria | 94600 |
| 375 | Ga0268266_10095516 | 3300028379 | Bacteria | 2611 |
| 376 | Ga0268266_10228718 | 3300028379 | Unclassified | 1712 |
| 377 | Ga0268266_10356960 | 3300028379 | Bacteria | 1375 |
| 378 | Ga0268266_10397223 | 3300028379 | Bacteria | 1303 |
| 379 | Ga0268266_10404554 | 3300028379 | Bacteria | 1291 |
| 380 | Ga0268266_11949731 | 3300028379 | Bacteria | 561 |
| 381 | Ga0268265_10754321 | 3300028380 | Unclassified | 945 |
| 382 | Ga0268265_11062208 | 3300028380 | Unclassified | 802 |
| 383 | Ga0268264_10189181 | 3300028381 | Bacteria | 1875 |
| 384 | Ga0268264_11839185 | 3300028381 | Bacteria | 616 |
| 385 | Ga0265334_10099086 | 3300028573 | Bacteria | 1057 |
| 386 | Ga0265318_10030913 | 3300028577 | Bacteria | 2080 |
| 387 | Ga0265323_10012238 | 3300028653 | Bacteria | 3446 |
| 388 | Ga0265336_10147173 | 3300028666 | Bacteria | 701 |
| 389 | Ga0265338_10003888 | 3300028800 | Bacteria | 20654 |
| 390 | Ga0265338_10006496 | 3300028800 | Bacteria | 14868 |
| 391 | Ga0265338_10031473 | 3300028800 | Bacteria | 5201 |
| 392 | Ga0265338_10231801 | 3300028800 | Unclassified | 1373 |
| 393 | Ga0265338_10237743 | 3300028800 | Bacteria | 1351 |
| 394 | Ga0265338_10822887 | 3300028800 | Bacteria | 635 |
| 395 | Ga0265330_10008764 | 3300031235 | Bacteria | 4847 |
| 396 | Ga0265332_10073987 | 3300031238 | Bacteria | 1449 |
| 397 | Ga0265328_10004615 | 3300031239 | Bacteria | 5965 |
| 398 | Ga0265328_10005251 | 3300031239 | Bacteria | 5562 |
| 399 | Ga0265320_10091412 | 3300031240 | Bacteria | 1409 |
| 400 | Ga0265325_10004125 | 3300031241 | Bacteria | 9241 |
| 401 | Ga0265329_10073748 | 3300031242 | Bacteria | 1080 |
| 402 | Ga0265339_10003464 | 3300031249 | Bacteria | 11037 |
| 403 | Ga0265339_10183160 | 3300031249 | Bacteria | 1042 |
| 404 | Ga0265339_10324857 | 3300031249 | Bacteria | 729 |
| 405 | Ga0265331_10001550 | 3300031250 | Bacteria | 16851 |
| 406 | Ga0265331_10013174 | 3300031250 | Bacteria | 4452 |
| 407 | Ga0265327_10098150 | 3300031251 | Bacteria | 1418 |
| 408 | Ga0265327_10139810 | 3300031251 | Bacteria | 1132 |
| 409 | Ga0265316_10104668 | 3300031344 | Bacteria | 2148 |
| 410 | Ga0265316_10171011 | 3300031344 | Bacteria | 1621 |
| 411 | Ga0307408_100237898 | 3300031548 | Bacteria | 1495 |
| 412 | Ga0307408_100676921 | 3300031548 | Bacteria | 925 |
| 413 | Ga0265313_10003585 | 3300031595 | Bacteria | 12487 |
| 414 | Ga0265313_10017323 | 3300031595 | Bacteria | 4100 |
| 415 | Ga0307508_10000191 | 3300031616 | Bacteria | 74025 |
| 416 | Ga0316575_10079749 | 3300031665 | Bacteria | 1320 |
| 417 | Ga0265314_10000948 | 3300031711 | Bacteria | 34109 |
| 418 | Ga0265342_10033300 | 3300031712 | Bacteria | 3169 |
| 419 | Ga0265342_10060308 | 3300031712 | Bacteria | 2237 |
| 420 | Ga0265342_10080744 | 3300031712 | Bacteria | 1879 |
| 421 | Ga0307405_10013515 | 3300031731 | Bacteria | 4358 |
| 422 | Ga0307410_10121511 | 3300031852 | Bacteria | 1905 |
| 423 | Ga0307406_10016265 | 3300031901 | Bacteria | 4321 |
| 424 | Ga0307407_10073603 | 3300031903 | Bacteria | 2042 |
| 425 | Ga0307412_12283486 | 3300031911 | Bacteria | 505 |
| 426 | Ga0307409_100090527 | 3300031995 | Bacteria | 2505 |
| 427 | Ga0307409_100223826 | 3300031995 | Bacteria | 1700 |
| 428 | Ga0307416_100021690 | 3300032002 | Bacteria | 4618 |
| 429 | Ga0307416_100072122 | 3300032002 | Bacteria | 2873 |
| 430 | Ga0307416_102103371 | 3300032002 | Bacteria | 666 |
| 431 | Ga0307414_10358594 | 3300032004 | Bacteria | 1254 |
| 432 | Ga0307411_10069496 | 3300032005 | Bacteria | 2379 |
| 433 | Ga0307415_100023898 | 3300032126 | Bacteria | 3805 |
| 434 | Ga0307415_102317834 | 3300032126 | Bacteria | 527 |
| 435 | Ga0373958_0122844 | 3300034819 | Bacteria | 629 |
| 436 | Ga0373926_0221978 | 3300035083 | Bacteria | 730 |
| 437 | Ga0373923_0286571 | 3300035111 | Bacteria | 777 |
| 438 | Ga0373923_0352098 | 3300035111 | Bacteria | 703 |
| 439 | Ga0373936_0047766 | 3300035113 | Bacteria | 1727 |
| 440 | Ga0373939_0059637 | 3300035114 | Bacteria | 1211 |
| 441 | Ga0373945_0255923 | 3300035116 | Unclassified | 740 |
| 442 | Ga0373953_0242552 | 3300035117 | Bacteria | 782 |
| 443 | Ga0373954_0034522 | 3300035118 | Unclassified | 2343 |
| 444 | Ga0373956_0021865 | 3300035119 | Bacteria | 2731 |
| 445 | Ga0373946_0080081 | 3300035171 | Bacteria | 1428 |
| 446 | Ga0373946_0359939 | 3300035171 | Unclassified | 729 |
| 447 | Ga0373955_0211557 | 3300035172 | Unclassified | 1156 |
| 448 | Ga0373924_0099196 | 3300035410 | Bacteria | 1252 |
| 449 | Ga0373924_0404555 | 3300035410 | Unclassified | 610 |
| 450 | Ga0373935_0017087 | 3300035692 | Bacteria | 4395 |
| 451 | Ga0373935_0145270 | 3300035692 | Bacteria | 1605 |
| 452 | Ga0373927_0023279 | 3300035695 | Bacteria | 4057 |
| 453 | Ga0373927_1010937 | 3300035695 | Unclassified | 548 |
| 454 | Ga0373933_0056585 | 3300035724 | Bacteria | 2355 |
| 455 | Ga0373947_0006717 | 3300035725 | Bacteria | 6674 |
| 456 | Ga0373947_0357300 | 3300035725 | Bacteria | 981 |
| 457 | Ga0373947_1262779 | 3300035725 | Bacteria | 503 |
| 458 | Ga0373937_0082838 | 3300036401 | Bacteria | 2968 |
| 459 | Ga0373937_0198114 | 3300036401 | Bacteria | 1888 |
| 460 | Ga0373937_0377890 | 3300036401 | Bacteria | 1343 |
| 461 | Ga0373937_1136852 | 3300036401 | Bacteria | 730 |
| 462 | Ga0373937_1483469 | 3300036401 | Unclassified | 626 |
| 463 | Ga0373925_0002783 | 3300037068 | Bacteria | 13812 |
| 464 | Ga0373925_0013259 | 3300037068 | Bacteria | 5965 |
| 465 | Ga0373925_0178458 | 3300037068 | Bacteria | 1680 |
| 466 | Ga0373925_1374995 | 3300037068 | Unclassified | 579 |
| 467 | Ga0395899_0000570 | 3300037312 | Bacteria | 39268 |
| 468 | Ga0395899_0002181 | 3300037312 | Bacteria | 16076 |
| 469 | Ga0395899_0726312 | 3300037312 | Bacteria | 621 |
| 470 | Ga0395900_0205304 | 3300037418 | Bacteria | 1991 |
| 471 | Ga0395900_0450626 | 3300037418 | Bacteria | 1243 |
| 472 | Ga0395900_0680672 | 3300037418 | Bacteria | 963 |
| 473 | Ga0395898_0021031 | 3300037466 | Bacteria | 6619 |
| 474 | Ga0395905_0004846 | 3300037471 | Bacteria | 13877 |
| 475 | Ga0395905_1122908 | 3300037471 | Bacteria | 689 |
| 476 | Ga0395901_0125606 | 3300038443 | Bacteria | 2696 |
| 477 | Ga0395901_0182121 | 3300038443 | Bacteria | 2203 |
| 478 | Ga0395901_0449362 | 3300038443 | Bacteria | 1318 |
| 479 | Ga0436365_1502616 | 3300039437 | Bacteria | 755 |
| 480 | Ga0439441_034999 | 3300042001 | Bacteria | 988 |
| 481 | Ga0439441_062713 | 3300042001 | Bacteria | 785 |
| 482 | Ga0451577_0012047 | 3300042876 | Bacteria | 8136 |
| 483 | Ga0453683_0373036 | 3300044673 | Bacteria | 918 |
| 484 | Ga0453684_0000511 | 3300044712 | Bacteria | 150804 |
| 485 | Ga0453684_0040410 | 3300044712 | Bacteria | 6334 |
| 486 | Ga0453684_0167635 | 3300044712 | Bacteria | 2591 |
| 487 | Ga0451576_0062672 | 3300045051 | Bacteria | 3876 |
| 488 | Ga0451576_0088056 | 3300045051 | Bacteria | 3230 |
| 489 | Ga0451576_0268675 | 3300045051 | Bacteria | 1783 |
| 490 | Ga0451576_0957971 | 3300045051 | Unclassified | 897 |
| 491 | Ga0451576_1116925 | 3300045051 | Bacteria | 825 |
| 492 | Ga0451576_1200430 | 3300045051 | Bacteria | 792 |
| 493 | Ga0451576_1342421 | 3300045051 | Bacteria | 745 |
| 494 | Ga0451576_1630420 | 3300045051 | Bacteria | 669 |
| 495 | Ga0451576_2457465 | 3300045051 | Bacteria | 532 |
| 496 | Ga0466967_0441981 | 3300045976 | Bacteria | 1270 |
| 497 | Ga0466967_0553257 | 3300045976 | Bacteria | 1133 |
| 498 | Ga0495629_0503611 | 3300046459 | Bacteria | 816 |
| 499 | Ga0495580_0002914 | 3300046472 | Bacteria | 14695 |
| 500 | Ga0495580_0464753 | 3300046472 | Bacteria | 848 |
| 501 | Ga0495582_0493483 | 3300046473 | Unclassified | 708 |
| 502 | Ga0495639_0074003 | 3300046475 | Bacteria | 1578 |
| 503 | Ga0495594_0507739 | 3300046499 | Bacteria | 685 |
| 504 | Ga0495594_0604976 | 3300046499 | Unclassified | 621 |
| 505 | Ga0495608_0514362 | 3300046511 | Unclassified | 724 |
| 506 | Ga0495618_0014600 | 3300046514 | Unclassified | 4787 |
| 507 | Ga0495618_0423461 | 3300046514 | Unclassified | 811 |
| 508 | Ga0495630_0026387 | 3300046517 | Unclassified | 4301 |
| 509 | Ga0495630_0040776 | 3300046517 | Bacteria | 3469 |
| 510 | Ga0495630_1528137 | 3300046517 | Bacteria | 501 |
| 511 | Ga0495643_0010957 | 3300046522 | Bacteria | 5550 |
| 512 | Ga0495666_0282539 | 3300046526 | Bacteria | 752 |
| 513 | Ga0495666_0431747 | 3300046526 | Unclassified | 591 |
| 514 | Ga0495666_0455475 | 3300046526 | Bacteria | 573 |
| 515 | Ga0495642_0054389 | 3300046528 | Bacteria | 1651 |
| 516 | Ga0495642_0265037 | 3300046528 | Bacteria | 752 |
| 517 | Ga0495654_0179994 | 3300046530 | Bacteria | 916 |
| 518 | Ga0495586_0008895 | 3300046535 | Bacteria | 5345 |
| 519 | Ga0495598_0016727 | 3300046537 | Bacteria | 1877 |
| 520 | Ga0495598_0133134 | 3300046537 | Bacteria | 854 |
| 521 | Ga0495621_0083098 | 3300046539 | Bacteria | 1197 |
| 522 | Ga0495621_0108963 | 3300046539 | Bacteria | 1060 |
| 523 | Ga0495597_0054544 | 3300046542 | Bacteria | 1755 |
| 524 | Ga0495667_0054104 | 3300046559 | Bacteria | 2642 |
| 525 | Ga0495668_0058083 | 3300046616 | Bacteria | 2135 |
| 526 | Ga0495634_0010848 | 3300046642 | Bacteria | 6660 |
| 527 | Ga0495661_0007815 | 3300046665 | Bacteria | 7439 |
| 528 | Ga0495599_0544688 | 3300046678 | Bacteria | 680 |
| 529 | Ga0495647_0082717 | 3300046681 | Bacteria | 1304 |
| 530 | Ga0495658_0784968 | 3300046683 | Bacteria | 610 |
| 531 | Ga0495613_0006984 | 3300046689 | Bacteria | 8414 |
| 532 | Ga0495674_0170584 | 3300047319 | Bacteria | 1816 |
| 533 | Ga0495680_0079942 | 3300047322 | Unclassified | 2471 |
| 534 | Ga0495687_006968 | 3300047443 | Bacteria | 6789 |
| 535 | Ga0495675_0280600 | 3300047444 | Bacteria | 993 |
| 536 | Ga0495684_0053441 | 3300047471 | Bacteria | 3082 |
| 537 | Ga0495615_0056629 | 3300048090 | Bacteria | 1024 |
| 538 | Ga0495615_0268881 | 3300048090 | Bacteria | 545 |
| 539 | Ga0496104_1339741 | 3300048907 | Bacteria | 619 |
| 540 | Ga0496108_0955136 | 3300048911 | Bacteria | 734 |
| 541 | Ga0496109_0303147 | 3300048912 | Bacteria | 1507 |
| 542 | Ga0496109_0409720 | 3300048912 | Bacteria | 1281 |
| 543 | Ga0496112_0840173 | 3300048915 | Bacteria | 842 |
| 544 | Ga0501031_0000631 | 3300049568 | Bacteria | 20805 |
| 545 | Ga0501031_0049874 | 3300049568 | Unclassified | 2728 |
| 546 | Ga0501032_0000148 | 3300049569 | Bacteria | 57181 |
| 547 | Ga0501032_0002706 | 3300049569 | Bacteria | 13828 |
| 548 | Ga0501032_0140210 | 3300049569 | Unclassified | 1592 |
| 549 | Ga0501033_0003368 | 3300049570 | Bacteria | 13186 |
| 550 | Ga0501033_0034024 | 3300049570 | Bacteria | 3824 |
| 551 | Ga0501033_0057492 | 3300049570 | Bacteria | 2875 |
| 552 | Ga0501034_0156034 | 3300049571 | Bacteria | 2256 |
| 553 | Ga0501036_0448808 | 3300049572 | Bacteria | 1074 |
| 554 | Ga0501037_0101773 | 3300049573 | Bacteria | 2073 |
| 555 | Ga0501037_0183297 | 3300049573 | Unclassified | 1485 |
| 556 | Ga0501038_0033270 | 3300049574 | Bacteria | 4542 |
| 557 | Ga0501038_0145081 | 3300049574 | Bacteria | 1939 |
| 558 | Ga0501038_0700898 | 3300049574 | Bacteria | 759 |
| 559 | Ga0501039_0095339 | 3300049575 | Unclassified | 2320 |
| 560 | Ga0501039_0294199 | 3300049575 | Bacteria | 1276 |
| 561 | Ga0501040_0108555 | 3300049576 | Bacteria | 1940 |
| 562 | Ga0501042_0163154 | 3300049578 | Bacteria | 1608 |
| 563 | Ga0501042_0502304 | 3300049578 | Bacteria | 881 |
| 564 | Ga0501042_0608144 | 3300049578 | Bacteria | 795 |
| 565 | Ga0501043_0152387 | 3300049579 | Bacteria | 1809 |
| 566 | Ga0501043_0345472 | 3300049579 | Bacteria | 1131 |
| 567 | Ga0501043_0545397 | 3300049579 | Bacteria | 862 |
| 568 | Ga0501046_0009935 | 3300049580 | Bacteria | 8198 |
| 569 | Ga0501046_0055377 | 3300049580 | Bacteria | 3117 |
| 570 | Ga0501047_0000909 | 3300049581 | Bacteria | 30250 |
| 571 | Ga0501047_0066763 | 3300049581 | Bacteria | 3468 |
| 572 | Ga0501047_0201263 | 3300049581 | Bacteria | 1852 |
| 573 | Ga0501047_0203284 | 3300049581 | Bacteria | 1841 |
| 574 | Ga0501047_0365332 | 3300049581 | Bacteria | 1279 |
| 575 | Ga0501048_0298524 | 3300049582 | Bacteria | 1146 |
| 576 | Ga0501048_0627722 | 3300049582 | Bacteria | 771 |
| 577 | Ga0501048_0906802 | 3300049582 | Bacteria | 634 |
| 578 | Ga0501067_0102532 | 3300049583 | Bacteria | 1590 |
| 579 | Ga0501068_0042370 | 3300049584 | Bacteria | 2738 |
| 580 | Ga0501068_0216012 | 3300049584 | Bacteria | 1218 |
| 581 | Ga0501069_0020517 | 3300049585 | Bacteria | 3581 |
| 582 | Ga0501069_0098424 | 3300049585 | Bacteria | 1659 |
| 583 | Ga0501070_0006216 | 3300049586 | Bacteria | 10166 |
| 584 | Ga0501070_0051481 | 3300049586 | Bacteria | 3418 |
| 585 | Ga0501071_0176569 | 3300049587 | Bacteria | 1600 |
| 586 | Ga0501071_0754992 | 3300049587 | Bacteria | 749 |
| 587 | Ga0501072_0166695 | 3300049588 | Bacteria | 1758 |
| 588 | Ga0501072_0228777 | 3300049588 | Bacteria | 1481 |
| 589 | Ga0501072_0487980 | 3300049588 | Bacteria | 975 |
| 590 | Ga0501073_0082404 | 3300049589 | Bacteria | 2238 |
| 591 | Ga0501073_0203462 | 3300049589 | Bacteria | 1369 |
| 592 | Ga0501073_0282951 | 3300049589 | Bacteria | 1144 |
| 593 | Ga0501074_0005852 | 3300049590 | Bacteria | 8870 |
| 594 | Ga0501074_0106334 | 3300049590 | Bacteria | 2009 |
| 595 | Ga0501074_0271256 | 3300049590 | Bacteria | 1206 |
| 596 | Ga0501074_0538933 | 3300049590 | Unclassified | 826 |
| 597 | Ga0501075_0323306 | 3300049591 | Bacteria | 1175 |
| 598 | Ga0501076_0026248 | 3300049592 | Bacteria | 4510 |
| 599 | Ga0501076_0522250 | 3300049592 | Bacteria | 979 |
| 600 | Ga0501077_0152362 | 3300049593 | Bacteria | 1467 |
| 601 | Ga0501077_0773897 | 3300049593 | Bacteria | 617 |
| 602 | Ga0501079_0022932 | 3300049741 | Bacteria | 4793 |
| 603 | Ga0501079_0096703 | 3300049741 | Bacteria | 2289 |
| 604 | Ga0501079_1000871 | 3300049741 | Bacteria | 658 |
| 605 | Ga0501080_0146967 | 3300049742 | Bacteria | 2179 |
| 606 | Ga0501080_0167459 | 3300049742 | Bacteria | 2027 |
| 607 | Ga0501080_0358473 | 3300049742 | Bacteria | 1316 |
| 608 | Ga0501080_0632198 | 3300049742 | Bacteria | 948 |
| 609 | Ga0501081_0192703 | 3300049743 | Bacteria | 1476 |
| 610 | Ga0501035_0027702 | 3300049822 | Bacteria | 5179 |
| 611 | Ga0501035_0057958 | 3300049822 | Bacteria | 3452 |
| 612 | Ga0501044_0000268 | 3300049823 | Bacteria | 66050 |
| 613 | Ga0501044_0000442 | 3300049823 | Bacteria | 50741 |
| 614 | Ga0501044_0006715 | 3300049823 | Bacteria | 12682 |
| 615 | Ga0501044_0223050 | 3300049823 | Bacteria | 1835 |
| 616 | Ga0501044_0350512 | 3300049823 | Bacteria | 1396 |
| 617 | Ga0501045_0132239 | 3300049824 | Bacteria | 1855 |
| 618 | Ga0501045_0773257 | 3300049824 | Bacteria | 707 |
| 619 | nmdc:mga03683_285916_c1 | 3300050489 | Bacteria | 771 |
| 620 | nmdc:mga0k408_20281_c1 | 3300050493 | Bacteria | 3722 |
| 621 | nmdc:mga05p37_100422_c1 | 3300050507 | Bacteria | 3564 |
| 622 | nmdc:mga05p37_1488656_c1 | 3300050507 | Bacteria | 675 |
| 623 | nmdc:mga05p37_2034756_c1 | 3300050507 | Bacteria | 542 |
| 624 | nmdc:mga05p37_237205_c1 | 3300050507 | Bacteria | 2195 |
| 625 | nmdc:mga05p37_368604_c1 | 3300050507 | Bacteria | 1686 |
| 626 | nmdc:mga05p37_48070_c1 | 3300050507 | Bacteria | 5247 |
| 627 | nmdc:mga05p37_639_c1 | 3300050507 | Bacteria | 38794 |
| 628 | nmdc:mga05p37_693605_c1 | 3300050507 | Unclassified | 1133 |
| 629 | nmdc:mga05p37_9412_c1 | 3300050507 | Bacteria | 11566 |
| 630 | nmdc:mga09592_18418_c1 | 3300050508 | Bacteria | 5728 |
| 631 | nmdc:mga09592_298966_c1 | 3300050508 | Bacteria | 1396 |
| 632 | nmdc:mga09592_688361_c1 | 3300050508 | Unclassified | 871 |
| 633 | nmdc:mga09592_77365_c1 | 3300050508 | Bacteria | 2830 |
| 634 | nmdc:mga0qj67_169204_c1 | 3300050509 | Bacteria | 1774 |
| 635 | nmdc:mga0qj67_61221_c1 | 3300050509 | Bacteria | 2988 |
| 636 | nmdc:mga0qj67_75438_c1 | 3300050509 | Bacteria | 2695 |
| 637 | nmdc:mga06r32_1071_c1 | 3300050510 | Bacteria | 6048 |
| 638 | nmdc:mga06r32_415554_c1 | 3300050510 | Bacteria | 554 |
| 639 | nmdc:mga06r32_423676_c1 | 3300050510 | Unclassified | 1312 |
| 640 | nmdc:mga06r32_456177_c1 | 3300050510 | Bacteria | 1258 |
| 641 | nmdc:mga06r32_591106_c1 | 3300050510 | Bacteria | 1081 |
| 642 | nmdc:mga08y16_2027684_c1 | 3300050511 | Bacteria | 524 |
| 643 | nmdc:mga08y16_789807_c1 | 3300050511 | Bacteria | 943 |
| 644 | nmdc:mga08y16_845572_c1 | 3300050511 | Bacteria | 905 |
| 645 | nmdc:mga08y16_948676_c1 | 3300050511 | Bacteria | 843 |
| 646 | nmdc:mga0n895_1322660_c1 | 3300050512 | Bacteria | 691 |
| 647 | nmdc:mga0n895_1597249_c1 | 3300050512 | Bacteria | 617 |
| 648 | nmdc:mga0n895_27412_c1 | 3300050512 | Bacteria | 5413 |
| 649 | nmdc:mga0n895_558486_c1 | 3300050512 | Bacteria | 1150 |
| 650 | nmdc:mga0n895_83406_c1 | 3300050512 | Bacteria | 3188 |
| 651 | nmdc:mga0rr50_1114364_c1 | 3300050513 | Bacteria | 671 |
| 652 | nmdc:mga0rr50_1282879_c1 | 3300050513 | Bacteria | 621 |
| 653 | nmdc:mga0rr50_1766787_c1 | 3300050513 | Bacteria | 521 |
| 654 | nmdc:mga0rr50_530763_c1 | 3300050513 | Bacteria | 1002 |
| 655 | nmdc:mga0rr50_7612_c1 | 3300050513 | Bacteria | 6696 |
| 656 | nmdc:mga08x19_458659_c1 | 3300050514 | Bacteria | 897 |
| 657 | nmdc:mga08x19_506466_c1 | 3300050514 | Bacteria | 853 |
| 658 | nmdc:mga08x19_882294_c1 | 3300050514 | Bacteria | 635 |
| 659 | nmdc:mga0a205_212288_c1 | 3300050515 | Bacteria | 1823 |
| 660 | nmdc:mga0a205_625855_c1 | 3300050515 | Bacteria | 928 |
| 661 | nmdc:mga0a205_73683_c1 | 3300050515 | Bacteria | 3299 |
| 662 | nmdc:mga0a205_746217_c1 | 3300050515 | Bacteria | 828 |
| 663 | Ga0495601_0061455 | 3300053077 | Unclassified | 2385 |
| 664 | Ga0495601_0324159 | 3300053077 | Bacteria | 1003 |
| 665 | Ga0501084_0056030 | 3300054114 | Bacteria | 3298 |
| 666 | Ga0501084_0170957 | 3300054114 | Bacteria | 1834 |
| 667 | Ga0501084_1487873 | 3300054114 | Bacteria | 567 |
| 668 | Ga0501084_1560849 | 3300054114 | Bacteria | 552 |
| 669 | Ga0530510_0024902 | 3300061734 | Bacteria | 4276 |
| 670 | Ga0530510_0586565 | 3300061734 | Bacteria | 847 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026121 | Ga0207683_10766097 | Ga0207683_107660971 | 122 |
| 2 | 3300006844 | Ga0075428_101836071 | Ga0075428_1018360712 | 125 |
| 3 | 3300005341 | Ga0070691_10011578 | Ga0070691_100115781 | 130 |
| 4 | 3300009094 | Ga0111539_10152367 | Ga0111539_101523673 | 131 |
| 5 | 3300050511 | nmdc:mga08y16_789807_c1 | nmdc:mga08y16_789807_c1_37_450 | 131 |
| 6 | 3300049581 | Ga0501047_0365332 | Ga0501047_0365332_30_440 | 132 |
| 7 | 3300005354 | Ga0070675_102000350 | Ga0070675_1020003501 | 133 |
| 8 | 3300005444 | Ga0070694_100796156 | Ga0070694_1007961561 | 133 |
| 9 | 3300013308 | Ga0157375_13247026 | Ga0157375_132470261 | 133 |
| 10 | 3300026142 | Ga0207698_11121233 | Ga0207698_111212331 | 133 |
| 11 | 3300048911 | Ga0496108_0955136 | Ga0496108_0955136_284_703 | 133 |
| 12 | 3300005338 | Ga0068868_100454666 | Ga0068868_1004546662 | 134 |
| 13 | 3300005546 | Ga0070696_100496446 | Ga0070696_1004964462 | 134 |
| 14 | 3300005548 | Ga0070665_100224024 | Ga0070665_1002240243 | 134 |
| 15 | 3300005578 | Ga0068854_101520972 | Ga0068854_1015209722 | 134 |
| 16 | 3300005718 | Ga0068866_11044219 | Ga0068866_110442192 | 134 |
| 17 | 3300005981 | Ga0081538_10021530 | Ga0081538_100215302 | 134 |
| 18 | 3300006177 | Ga0075362_10253828 | Ga0075362_102538282 | 134 |
| 19 | 3300006844 | Ga0075428_100879519 | Ga0075428_1008795192 | 134 |
| 20 | 3300009093 | Ga0105240_10527188 | Ga0105240_105271882 | 134 |
| 21 | 3300009094 | Ga0111539_10448084 | Ga0111539_104480842 | 134 |
| 22 | 3300009147 | Ga0114129_10002853 | Ga0114129_100028534 | 134 |
| 23 | 3300009147 | Ga0114129_11334113 | Ga0114129_113341131 | 134 |
| 24 | 3300010375 | Ga0105239_12367018 | Ga0105239_123670182 | 134 |
| 25 | 3300013104 | Ga0157370_10138398 | Ga0157370_101383982 | 134 |
| 26 | 3300025910 | Ga0207684_10490460 | Ga0207684_104904602 | 134 |
| 27 | 3300025913 | Ga0207695_10046527 | Ga0207695_100465278 | 134 |
| 28 | 3300025981 | Ga0207640_10922796 | Ga0207640_109227962 | 134 |
| 29 | 3300026023 | Ga0207677_11386508 | Ga0207677_113865081 | 134 |
| 30 | 3300027907 | Ga0207428_10497186 | Ga0207428_104971862 | 134 |
| 31 | 3300028379 | Ga0268266_10404554 | Ga0268266_104045542 | 134 |
| 32 | 3300035111 | Ga0373923_0352098 | Ga0373923_0352098_66_482 | 134 |
| 33 | 3300036401 | Ga0373937_0082838 | Ga0373937_0082838_1848_2264 | 134 |
| 34 | 3300045051 | Ga0451576_0062672 | Ga0451576_0062672_1974_2402 | 134 |
| 35 | 3300050489 | nmdc:mga03683_285916_c1 | nmdc:mga03683_285916_c1_193_597 | 134 |
| 36 | 3300050507 | nmdc:mga05p37_1488656_c1 | nmdc:mga05p37_1488656_c1_93_497 | 134 |
| 37 | 3300050507 | nmdc:mga05p37_9412_c1 | nmdc:mga05p37_9412_c1_10993_11430 | 134 |
| 38 | 3300050511 | nmdc:mga08y16_845572_c1 | nmdc:mga08y16_845572_c1_147_551 | 134 |
| 39 | 3300050513 | nmdc:mga0rr50_1766787_c1 | nmdc:mga0rr50_1766787_c1_22_459 | 134 |
| 40 | 3300054114 | Ga0501084_1560849 | Ga0501084_1560849_88_492 | 134 |
| 41 | 3300005340 | Ga0070689_100502165 | Ga0070689_1005021652 | 135 |
| 42 | 3300005436 | Ga0070713_100713031 | Ga0070713_1007130311 | 135 |
| 43 | 3300005535 | Ga0070684_101413003 | Ga0070684_1014130031 | 135 |
| 44 | 3300005548 | Ga0070665_100581028 | Ga0070665_1005810283 | 135 |
| 45 | 3300005563 | Ga0068855_100416113 | Ga0068855_1004161132 | 135 |
| 46 | 3300005617 | Ga0068859_100520746 | Ga0068859_1005207462 | 135 |
| 47 | 3300005843 | Ga0068860_100065520 | Ga0068860_1000655201 | 135 |
| 48 | 3300005844 | Ga0068862_101252450 | Ga0068862_1012524501 | 135 |
| 49 | 3300006931 | Ga0097620_100520704 | Ga0097620_1005207042 | 135 |
| 50 | 3300013296 | Ga0157374_10210725 | Ga0157374_102107254 | 135 |
| 51 | 3300028380 | Ga0268265_10754321 | Ga0268265_107543211 | 135 |
| 52 | 3300032002 | Ga0307416_102103371 | Ga0307416_1021033712 | 135 |
| 53 | 3300035111 | Ga0373923_0286571 | Ga0373923_0286571_149_586 | 135 |
| 54 | 3300035116 | Ga0373945_0255923 | Ga0373945_0255923_47_484 | 135 |
| 55 | 3300035171 | Ga0373946_0080081 | Ga0373946_0080081_729_1166 | 135 |
| 56 | 3300035692 | Ga0373935_0017087 | Ga0373935_0017087_2575_3012 | 135 |
| 57 | 3300035695 | Ga0373927_0023279 | Ga0373927_0023279_2916_3353 | 135 |
| 58 | 3300035725 | Ga0373947_0006717 | Ga0373947_0006717_5834_6271 | 135 |
| 59 | 3300037068 | Ga0373925_0002783 | Ga0373925_0002783_6812_7249 | 135 |
| 60 | 3300046511 | Ga0495608_0514362 | Ga0495608_0514362_98_505 | 135 |
| 61 | 3300046517 | Ga0495630_0040776 | Ga0495630_0040776_232_669 | 135 |
| 62 | 3300046526 | Ga0495666_0282539 | Ga0495666_0282539_199_636 | 135 |
| 63 | 3300050511 | nmdc:mga08y16_2027684_c1 | nmdc:mga08y16_2027684_c1_21_467 | 135 |
| 64 | 3300005327 | Ga0070658_11985808 | Ga0070658_119858081 | 136 |
| 65 | 3300005329 | Ga0070683_100057726 | Ga0070683_1000577263 | 136 |
| 66 | 3300005329 | Ga0070683_100670578 | Ga0070683_1006705782 | 136 |
| 67 | 3300005336 | Ga0070680_101132707 | Ga0070680_1011327071 | 136 |
| 68 | 3300005338 | Ga0068868_100996147 | Ga0068868_1009961471 | 136 |
| 69 | 3300005345 | Ga0070692_10062733 | Ga0070692_100627333 | 136 |
| 70 | 3300005365 | Ga0070688_101673864 | Ga0070688_1016738641 | 136 |
| 71 | 3300005434 | Ga0070709_10813712 | Ga0070709_108137121 | 136 |
| 72 | 3300005445 | Ga0070708_100750149 | Ga0070708_1007501492 | 136 |
| 73 | 3300005458 | Ga0070681_10099661 | Ga0070681_100996612 | 136 |
| 74 | 3300005471 | Ga0070698_100605363 | Ga0070698_1006053632 | 136 |
| 75 | 3300005518 | Ga0070699_100801640 | Ga0070699_1008016402 | 136 |
| 76 | 3300005530 | Ga0070679_100289260 | Ga0070679_1002892601 | 136 |
| 77 | 3300005530 | Ga0070679_100442045 | Ga0070679_1004420452 | 136 |
| 78 | 3300005536 | Ga0070697_100476468 | Ga0070697_1004764682 | 136 |
| 79 | 3300005539 | Ga0068853_101518488 | Ga0068853_1015184881 | 136 |
| 80 | 3300005545 | Ga0070695_100689810 | Ga0070695_1006898102 | 136 |
| 81 | 3300005548 | Ga0070665_100000213 | Ga0070665_10000021365 | 136 |
| 82 | 3300005563 | Ga0068855_101117399 | Ga0068855_1011173992 | 136 |
| 83 | 3300005614 | Ga0068856_100046850 | Ga0068856_1000468504 | 136 |
| 84 | 3300005616 | Ga0068852_100468748 | Ga0068852_1004687481 | 136 |
| 85 | 3300005617 | Ga0068859_100065189 | Ga0068859_1000651892 | 136 |
| 86 | 3300005834 | Ga0068851_10692184 | Ga0068851_106921842 | 136 |
| 87 | 3300005841 | Ga0068863_102259039 | Ga0068863_1022590391 | 136 |
| 88 | 3300005937 | Ga0081455_10254376 | Ga0081455_102543763 | 136 |
| 89 | 3300006048 | Ga0075363_100308751 | Ga0075363_1003087512 | 136 |
| 90 | 3300006173 | Ga0070716_100063940 | Ga0070716_1000639404 | 136 |
| 91 | 3300006844 | Ga0075428_101163997 | Ga0075428_1011639972 | 136 |
| 92 | 3300006846 | Ga0075430_100034821 | Ga0075430_1000348213 | 136 |
| 93 | 3300006847 | Ga0075431_100021493 | Ga0075431_10002149313 | 136 |
| 94 | 3300006871 | Ga0075434_100176498 | Ga0075434_1001764984 | 136 |
| 95 | 3300006880 | Ga0075429_101360632 | Ga0075429_1013606321 | 136 |
| 96 | 3300006880 | Ga0075429_101615048 | Ga0075429_1016150481 | 136 |
| 97 | 3300006931 | Ga0097620_100065193 | Ga0097620_1000651935 | 136 |
| 98 | 3300009147 | Ga0114129_11604281 | Ga0114129_116042812 | 136 |
| 99 | 3300009147 | Ga0114129_12283945 | Ga0114129_122839451 | 136 |
| 100 | 3300009147 | Ga0114129_13108299 | Ga0114129_131082991 | 136 |
| 101 | 3300009174 | Ga0105241_10965480 | Ga0105241_109654801 | 136 |
| 102 | 3300009551 | Ga0105238_10018245 | Ga0105238_100182456 | 136 |
| 103 | 3300010375 | Ga0105239_10160510 | Ga0105239_101605103 | 136 |
| 104 | 3300010375 | Ga0105239_11120665 | Ga0105239_111206652 | 136 |
| 105 | 3300011119 | Ga0105246_11284024 | Ga0105246_112840242 | 136 |
| 106 | 3300013105 | Ga0157369_10125280 | Ga0157369_101252802 | 136 |
| 107 | 3300013307 | Ga0157372_10013791 | Ga0157372_100137916 | 136 |
| 108 | 3300013307 | Ga0157372_10105472 | Ga0157372_101054723 | 136 |
| 109 | 3300025321 | Ga0207656_10564555 | Ga0207656_105645552 | 136 |
| 110 | 3300025905 | Ga0207685_10201061 | Ga0207685_102010612 | 136 |
| 111 | 3300025910 | Ga0207684_11356458 | Ga0207684_113564582 | 136 |
| 112 | 3300025911 | Ga0207654_10747114 | Ga0207654_107471142 | 136 |
| 113 | 3300025921 | Ga0207652_10370143 | Ga0207652_103701431 | 136 |
| 114 | 3300025922 | Ga0207646_11251808 | Ga0207646_112518081 | 136 |
| 115 | 3300025924 | Ga0207694_10053367 | Ga0207694_100533673 | 136 |
| 116 | 3300025939 | Ga0207665_10386809 | Ga0207665_103868092 | 136 |
| 117 | 3300025944 | Ga0207661_10041605 | Ga0207661_100416052 | 136 |
| 118 | 3300025944 | Ga0207661_10170911 | Ga0207661_101709112 | 136 |
| 119 | 3300025972 | Ga0207668_11247361 | Ga0207668_112473611 | 136 |
| 120 | 3300026067 | Ga0207678_10913400 | Ga0207678_109134002 | 136 |
| 121 | 3300026078 | Ga0207702_10135629 | Ga0207702_101356294 | 136 |
| 122 | 3300026142 | Ga0207698_11904645 | Ga0207698_119046452 | 136 |
| 123 | 3300028379 | Ga0268266_10000235 | Ga0268266_1000023568 | 136 |
| 124 | 3300028800 | Ga0265338_10003888 | Ga0265338_100038883 | 136 |
| 125 | 3300028800 | Ga0265338_10822887 | Ga0265338_108228871 | 136 |
| 126 | 3300031238 | Ga0265332_10073987 | Ga0265332_100739873 | 136 |
| 127 | 3300031241 | Ga0265325_10004125 | Ga0265325_100041257 | 136 |
| 128 | 3300031249 | Ga0265339_10003464 | Ga0265339_100034644 | 136 |
| 129 | 3300031249 | Ga0265339_10324857 | Ga0265339_103248571 | 136 |
| 130 | 3300031250 | Ga0265331_10001550 | Ga0265331_1000155011 | 136 |
| 131 | 3300031251 | Ga0265327_10098150 | Ga0265327_100981502 | 136 |
| 132 | 3300031251 | Ga0265327_10139810 | Ga0265327_101398102 | 136 |
| 133 | 3300031344 | Ga0265316_10104668 | Ga0265316_101046683 | 136 |
| 134 | 3300031595 | Ga0265313_10003585 | Ga0265313_100035859 | 136 |
| 135 | 3300031616 | Ga0307508_10000191 | Ga0307508_1000019130 | 136 |
| 136 | 3300031711 | Ga0265314_10000948 | Ga0265314_100009487 | 136 |
| 137 | 3300031712 | Ga0265342_10060308 | Ga0265342_100603082 | 136 |
| 138 | 3300031911 | Ga0307412_12283486 | Ga0307412_122834861 | 136 |
| 139 | 3300034819 | Ga0373958_0122844 | Ga0373958_0122844_110_562 | 136 |
| 140 | 3300035083 | Ga0373926_0221978 | Ga0373926_0221978_62_502 | 136 |
| 141 | 3300035113 | Ga0373936_0047766 | Ga0373936_0047766_394_834 | 136 |
| 142 | 3300035114 | Ga0373939_0059637 | Ga0373939_0059637_32_484 | 136 |
| 143 | 3300035692 | Ga0373935_0145270 | Ga0373935_0145270_166_606 | 136 |
| 144 | 3300035725 | Ga0373947_1262779 | Ga0373947_1262779_39_485 | 136 |
| 145 | 3300036401 | Ga0373937_1483469 | Ga0373937_1483469_16_444 | 136 |
| 146 | 3300037068 | Ga0373925_0013259 | Ga0373925_0013259_1219_1659 | 136 |
| 147 | 3300042001 | Ga0439441_034999 | Ga0439441_034999_142_585 | 136 |
| 148 | 3300042001 | Ga0439441_062713 | Ga0439441_062713_156_599 | 136 |
| 149 | 3300044712 | Ga0453684_0000511 | Ga0453684_0000511_57450_57896 | 136 |
| 150 | 3300045051 | Ga0451576_1342421 | Ga0451576_1342421_293_724 | 136 |
| 151 | 3300046499 | Ga0495594_0507739 | Ga0495594_0507739_176_610 | 136 |
| 152 | 3300046514 | Ga0495618_0423461 | Ga0495618_0423461_342_770 | 136 |
| 153 | 3300046522 | Ga0495643_0010957 | Ga0495643_0010957_1622_2047 | 136 |
| 154 | 3300046526 | Ga0495666_0455475 | Ga0495666_0455475_12_458 | 136 |
| 155 | 3300046528 | Ga0495642_0054389 | Ga0495642_0054389_840_1265 | 136 |
| 156 | 3300046528 | Ga0495642_0265037 | Ga0495642_0265037_261_674 | 136 |
| 157 | 3300046537 | Ga0495598_0016727 | Ga0495598_0016727_99_515 | 136 |
| 158 | 3300046539 | Ga0495621_0108963 | Ga0495621_0108963_367_783 | 136 |
| 159 | 3300046542 | Ga0495597_0054544 | Ga0495597_0054544_827_1252 | 136 |
| 160 | 3300046616 | Ga0495668_0058083 | Ga0495668_0058083_1255_1680 | 136 |
| 161 | 3300046665 | Ga0495661_0007815 | Ga0495661_0007815_3269_3694 | 136 |
| 162 | 3300047443 | Ga0495687_006968 | Ga0495687_006968_3620_4045 | 136 |
| 163 | 3300048090 | Ga0495615_0056629 | Ga0495615_0056629_65_481 | 136 |
| 164 | 3300048912 | Ga0496109_0303147 | Ga0496109_0303147_617_1033 | 136 |
| 165 | 3300049569 | Ga0501032_0000148 | Ga0501032_0000148_9966_10394 | 136 |
| 166 | 3300049574 | Ga0501038_0700898 | Ga0501038_0700898_93_521 | 136 |
| 167 | 3300049580 | Ga0501046_0009935 | Ga0501046_0009935_2773_3201 | 136 |
| 168 | 3300049581 | Ga0501047_0000909 | Ga0501047_0000909_29351_29779 | 136 |
| 169 | 3300049581 | Ga0501047_0201263 | Ga0501047_0201263_1220_1648 | 136 |
| 170 | 3300049582 | Ga0501048_0298524 | Ga0501048_0298524_129_557 | 136 |
| 171 | 3300049587 | Ga0501071_0176569 | Ga0501071_0176569_316_726 | 136 |
| 172 | 3300049588 | Ga0501072_0166695 | Ga0501072_0166695_695_1105 | 136 |
| 173 | 3300049742 | Ga0501080_0632198 | Ga0501080_0632198_24_452 | 136 |
| 174 | 3300049822 | Ga0501035_0057958 | Ga0501035_0057958_472_900 | 136 |
| 175 | 3300049823 | Ga0501044_0000268 | Ga0501044_0000268_54779_55207 | 136 |
| 176 | 3300049823 | Ga0501044_0350512 | Ga0501044_0350512_953_1366 | 136 |
| 177 | 3300050507 | nmdc:mga05p37_2034756_c1 | nmdc:mga05p37_2034756_c1_45_455 | 136 |
| 178 | 3300050507 | nmdc:mga05p37_693605_c1 | nmdc:mga05p37_693605_c1_45_455 | 136 |
| 179 | 3300050508 | nmdc:mga09592_18418_c1 | nmdc:mga09592_18418_c1_2742_3152 | 136 |
| 180 | 3300050508 | nmdc:mga09592_688361_c1 | nmdc:mga09592_688361_c1_48_458 | 136 |
| 181 | 3300050509 | nmdc:mga0qj67_169204_c1 | nmdc:mga0qj67_169204_c1_1318_1728 | 136 |
| 182 | 3300050510 | nmdc:mga06r32_456177_c1 | nmdc:mga06r32_456177_c1_199_609 | 136 |
| 183 | 3300050513 | nmdc:mga0rr50_1282879_c1 | nmdc:mga0rr50_1282879_c1_168_578 | 136 |
| 184 | 3300050514 | nmdc:mga08x19_882294_c1 | nmdc:mga08x19_882294_c1_70_480 | 136 |
| 185 | 3300053077 | Ga0495601_0324159 | Ga0495601_0324159_415_834 | 136 |
| 186 | 2162886007 | SwRhRL2b_contig_3656236 | SwRhRL2b_0976.00004030 | 137 |
| 187 | 2162886012 | MBSR1b_contig_13185514 | MBSR1b_0751.00003070 | 137 |
| 188 | 3300002155 | JGI24033J26618_1027880 | JGI24033J26618_10278801 | 137 |
| 189 | 3300003320 | rootH2_10179150 | rootH2_101791501 | 137 |
| 190 | 3300005288 | Ga0065714_10282279 | Ga0065714_102822791 | 137 |
| 191 | 3300005289 | Ga0065704_10137463 | Ga0065704_101374632 | 137 |
| 192 | 3300005295 | Ga0065707_10097886 | Ga0065707_100978863 | 137 |
| 193 | 3300005328 | Ga0070676_10006697 | Ga0070676_100066977 | 137 |
| 194 | 3300005328 | Ga0070676_10460829 | Ga0070676_104608291 | 137 |
| 195 | 3300005329 | Ga0070683_101492597 | Ga0070683_1014925972 | 137 |
| 196 | 3300005330 | Ga0070690_100103505 | Ga0070690_1001035052 | 137 |
| 197 | 3300005330 | Ga0070690_100673285 | Ga0070690_1006732851 | 137 |
| 198 | 3300005330 | Ga0070690_100770067 | Ga0070690_1007700671 | 137 |
| 199 | 3300005331 | Ga0070670_100254993 | Ga0070670_1002549931 | 137 |
| 200 | 3300005331 | Ga0070670_100446621 | Ga0070670_1004466212 | 137 |
| 201 | 3300005333 | Ga0070677_10005945 | Ga0070677_100059452 | 137 |
| 202 | 3300005333 | Ga0070677_10245231 | Ga0070677_102452311 | 137 |
| 203 | 3300005334 | Ga0068869_100006593 | Ga0068869_1000065938 | 137 |
| 204 | 3300005335 | Ga0070666_10021060 | Ga0070666_100210602 | 137 |
| 205 | 3300005336 | Ga0070680_100307228 | Ga0070680_1003072283 | 137 |
| 206 | 3300005338 | Ga0068868_100051356 | Ga0068868_1000513562 | 137 |
| 207 | 3300005338 | Ga0068868_102013559 | Ga0068868_1020135591 | 137 |
| 208 | 3300005340 | Ga0070689_100104977 | Ga0070689_1001049774 | 137 |
| 209 | 3300005340 | Ga0070689_101337257 | Ga0070689_1013372571 | 137 |
| 210 | 3300005343 | Ga0070687_100451693 | Ga0070687_1004516933 | 137 |
| 211 | 3300005343 | Ga0070687_100600573 | Ga0070687_1006005731 | 137 |
| 212 | 3300005345 | Ga0070692_10548203 | Ga0070692_105482031 | 137 |
| 213 | 3300005347 | Ga0070668_101279098 | Ga0070668_1012790982 | 137 |
| 214 | 3300005353 | Ga0070669_100171774 | Ga0070669_1001717744 | 137 |
| 215 | 3300005353 | Ga0070669_100284802 | Ga0070669_1002848021 | 137 |
| 216 | 3300005354 | Ga0070675_100191262 | Ga0070675_1001912622 | 137 |
| 217 | 3300005354 | Ga0070675_100517451 | Ga0070675_1005174511 | 137 |
| 218 | 3300005355 | Ga0070671_100028460 | Ga0070671_1000284607 | 137 |
| 219 | 3300005355 | Ga0070671_100075823 | Ga0070671_1000758232 | 137 |
| 220 | 3300005355 | Ga0070671_100255328 | Ga0070671_1002553282 | 137 |
| 221 | 3300005355 | Ga0070671_100761636 | Ga0070671_1007616362 | 137 |
| 222 | 3300005356 | Ga0070674_100113001 | Ga0070674_1001130013 | 137 |
| 223 | 3300005356 | Ga0070674_100113445 | Ga0070674_1001134453 | 137 |
| 224 | 3300005364 | Ga0070673_100465860 | Ga0070673_1004658602 | 137 |
| 225 | 3300005365 | Ga0070688_100269385 | Ga0070688_1002693852 | 137 |
| 226 | 3300005366 | Ga0070659_101128373 | Ga0070659_1011283731 | 137 |
| 227 | 3300005367 | Ga0070667_100280869 | Ga0070667_1002808691 | 137 |
| 228 | 3300005367 | Ga0070667_100737629 | Ga0070667_1007376292 | 137 |
| 229 | 3300005367 | Ga0070667_101257158 | Ga0070667_1012571582 | 137 |
| 230 | 3300005406 | Ga0070703_10129479 | Ga0070703_101294792 | 137 |
| 231 | 3300005434 | Ga0070709_10455873 | Ga0070709_104558731 | 137 |
| 232 | 3300005435 | Ga0070714_100004720 | Ga0070714_1000047209 | 137 |
| 233 | 3300005435 | Ga0070714_100191167 | Ga0070714_1001911672 | 137 |
| 234 | 3300005435 | Ga0070714_100956092 | Ga0070714_1009560922 | 137 |
| 235 | 3300005435 | Ga0070714_101262542 | Ga0070714_1012625422 | 137 |
| 236 | 3300005436 | Ga0070713_101811134 | Ga0070713_1018111341 | 137 |
| 237 | 3300005437 | Ga0070710_10076220 | Ga0070710_100762201 | 137 |
| 238 | 3300005438 | Ga0070701_10577749 | Ga0070701_105777492 | 137 |
| 239 | 3300005438 | Ga0070701_10584205 | Ga0070701_105842052 | 137 |
| 240 | 3300005439 | Ga0070711_100160343 | Ga0070711_1001603431 | 137 |
| 241 | 3300005440 | Ga0070705_100015637 | Ga0070705_1000156373 | 137 |
| 242 | 3300005441 | Ga0070700_100251410 | Ga0070700_1002514101 | 137 |
| 243 | 3300005441 | Ga0070700_100302460 | Ga0070700_1003024601 | 137 |
| 244 | 3300005445 | Ga0070708_100041235 | Ga0070708_1000412353 | 137 |
| 245 | 3300005445 | Ga0070708_100341698 | Ga0070708_1003416982 | 137 |
| 246 | 3300005455 | Ga0070663_100711116 | Ga0070663_1007111162 | 137 |
| 247 | 3300005456 | Ga0070678_100134872 | Ga0070678_1001348723 | 137 |
| 248 | 3300005456 | Ga0070678_100349560 | Ga0070678_1003495602 | 137 |
| 249 | 3300005456 | Ga0070678_101315180 | Ga0070678_1013151801 | 137 |
| 250 | 3300005457 | Ga0070662_100169171 | Ga0070662_1001691713 | 137 |
| 251 | 3300005457 | Ga0070662_100228439 | Ga0070662_1002284392 | 137 |
| 252 | 3300005457 | Ga0070662_100252671 | Ga0070662_1002526713 | 137 |
| 253 | 3300005458 | Ga0070681_10545646 | Ga0070681_105456461 | 137 |
| 254 | 3300005458 | Ga0070681_10972983 | Ga0070681_109729831 | 137 |
| 255 | 3300005459 | Ga0068867_100039383 | Ga0068867_1000393834 | 137 |
| 256 | 3300005459 | Ga0068867_100120300 | Ga0068867_1001203002 | 137 |
| 257 | 3300005459 | Ga0068867_100162813 | Ga0068867_1001628132 | 137 |
| 258 | 3300005466 | Ga0070685_10247387 | Ga0070685_102473872 | 137 |
| 259 | 3300005467 | Ga0070706_100108905 | Ga0070706_1001089053 | 137 |
| 260 | 3300005467 | Ga0070706_100154369 | Ga0070706_1001543692 | 137 |
| 261 | 3300005468 | Ga0070707_100029338 | Ga0070707_1000293382 | 137 |
| 262 | 3300005468 | Ga0070707_100082110 | Ga0070707_1000821104 | 137 |
| 263 | 3300005468 | Ga0070707_101571094 | Ga0070707_1015710941 | 137 |
| 264 | 3300005471 | Ga0070698_100010681 | Ga0070698_1000106816 | 137 |
| 265 | 3300005471 | Ga0070698_100407519 | Ga0070698_1004075192 | 137 |
| 266 | 3300005536 | Ga0070697_100048365 | Ga0070697_1000483655 | 137 |
| 267 | 3300005543 | Ga0070672_100042667 | Ga0070672_1000426672 | 137 |
| 268 | 3300005543 | Ga0070672_100064861 | Ga0070672_1000648613 | 137 |
| 269 | 3300005544 | Ga0070686_100049183 | Ga0070686_1000491833 | 137 |
| 270 | 3300005545 | Ga0070695_101092125 | Ga0070695_1010921252 | 137 |
| 271 | 3300005546 | Ga0070696_100405936 | Ga0070696_1004059362 | 137 |
| 272 | 3300005546 | Ga0070696_100560636 | Ga0070696_1005606362 | 137 |
| 273 | 3300005547 | Ga0070693_100154340 | Ga0070693_1001543401 | 137 |
| 274 | 3300005547 | Ga0070693_100665073 | Ga0070693_1006650732 | 137 |
| 275 | 3300005548 | Ga0070665_100270395 | Ga0070665_1002703953 | 137 |
| 276 | 3300005549 | Ga0070704_100122532 | Ga0070704_1001225322 | 137 |
| 277 | 3300005549 | Ga0070704_100165672 | Ga0070704_1001656722 | 137 |
| 278 | 3300005549 | Ga0070704_100845743 | Ga0070704_1008457431 | 137 |
| 279 | 3300005564 | Ga0070664_100354320 | Ga0070664_1003543202 | 137 |
| 280 | 3300005564 | Ga0070664_100785045 | Ga0070664_1007850451 | 137 |
| 281 | 3300005577 | Ga0068857_101221424 | Ga0068857_1012214241 | 137 |
| 282 | 3300005615 | Ga0070702_100009578 | Ga0070702_1000095785 | 137 |
| 283 | 3300005616 | Ga0068852_101723331 | Ga0068852_1017233311 | 137 |
| 284 | 3300005617 | Ga0068859_100399868 | Ga0068859_1003998682 | 137 |
| 285 | 3300005618 | Ga0068864_100129379 | Ga0068864_1001293792 | 137 |
| 286 | 3300005618 | Ga0068864_100570896 | Ga0068864_1005708962 | 137 |
| 287 | 3300005718 | Ga0068866_10262125 | Ga0068866_102621252 | 137 |
| 288 | 3300005718 | Ga0068866_11147425 | Ga0068866_111474251 | 137 |
| 289 | 3300005719 | Ga0068861_100093020 | Ga0068861_1000930202 | 137 |
| 290 | 3300005834 | Ga0068851_10859940 | Ga0068851_108599402 | 137 |
| 291 | 3300005840 | Ga0068870_10084739 | Ga0068870_100847392 | 137 |
| 292 | 3300005841 | Ga0068863_100008248 | Ga0068863_10000824812 | 137 |
| 293 | 3300005841 | Ga0068863_100059673 | Ga0068863_1000596732 | 137 |
| 294 | 3300005842 | Ga0068858_100050595 | Ga0068858_1000505953 | 137 |
| 295 | 3300005844 | Ga0068862_100324760 | Ga0068862_1003247602 | 137 |
| 296 | 3300005844 | Ga0068862_101102400 | Ga0068862_1011024002 | 137 |
| 297 | 3300005937 | Ga0081455_10001038 | Ga0081455_1000103822 | 137 |
| 298 | 3300005981 | Ga0081538_10005463 | Ga0081538_1000546311 | 137 |
| 299 | 3300005981 | Ga0081538_10335284 | Ga0081538_103352841 | 137 |
| 300 | 3300005983 | Ga0081540_1138026 | Ga0081540_11380262 | 137 |
| 301 | 3300006028 | Ga0070717_10021015 | Ga0070717_100210152 | 137 |
| 302 | 3300006194 | Ga0075427_10025225 | Ga0075427_100252251 | 137 |
| 303 | 3300006195 | Ga0075366_10026233 | Ga0075366_100262333 | 137 |
| 304 | 3300006195 | Ga0075366_10074178 | Ga0075366_100741782 | 137 |
| 305 | 3300006237 | Ga0097621_100107358 | Ga0097621_1001073584 | 137 |
| 306 | 3300006237 | Ga0097621_100622818 | Ga0097621_1006228182 | 137 |
| 307 | 3300006358 | Ga0068871_100890579 | Ga0068871_1008905792 | 137 |
| 308 | 3300006844 | Ga0075428_100033970 | Ga0075428_1000339702 | 137 |
| 309 | 3300006844 | Ga0075428_100146614 | Ga0075428_1001466144 | 137 |
| 310 | 3300006844 | Ga0075428_100333119 | Ga0075428_1003331193 | 137 |
| 311 | 3300006846 | Ga0075430_100086200 | Ga0075430_1000862002 | 137 |
| 312 | 3300006846 | Ga0075430_100104588 | Ga0075430_1001045883 | 137 |
| 313 | 3300006847 | Ga0075431_100004030 | Ga0075431_10000403011 | 137 |
| 314 | 3300006847 | Ga0075431_100716502 | Ga0075431_1007165022 | 137 |
| 315 | 3300006847 | Ga0075431_101231338 | Ga0075431_1012313381 | 137 |
| 316 | 3300006852 | Ga0075433_10000563 | Ga0075433_100005632 | 137 |
| 317 | 3300006852 | Ga0075433_10335548 | Ga0075433_103355482 | 137 |
| 318 | 3300006852 | Ga0075433_10344199 | Ga0075433_103441992 | 137 |
| 319 | 3300006852 | Ga0075433_11686332 | Ga0075433_116863321 | 137 |
| 320 | 3300006871 | Ga0075434_100007123 | Ga0075434_10000712312 | 137 |
| 321 | 3300006871 | Ga0075434_100027156 | Ga0075434_1000271567 | 137 |
| 322 | 3300006871 | Ga0075434_100686298 | Ga0075434_1006862982 | 137 |
| 323 | 3300006871 | Ga0075434_100901216 | Ga0075434_1009012162 | 137 |
| 324 | 3300006880 | Ga0075429_100028261 | Ga0075429_1000282615 | 137 |
| 325 | 3300006880 | Ga0075429_101109440 | Ga0075429_1011094402 | 137 |
| 326 | 3300006880 | Ga0075429_101337146 | Ga0075429_1013371461 | 137 |
| 327 | 3300006881 | Ga0068865_100056205 | Ga0068865_1000562052 | 137 |
| 328 | 3300006881 | Ga0068865_100082112 | Ga0068865_1000821123 | 137 |
| 329 | 3300006881 | Ga0068865_101395657 | Ga0068865_1013956572 | 137 |
| 330 | 3300006914 | Ga0075436_100086008 | Ga0075436_1000860082 | 137 |
| 331 | 3300006914 | Ga0075436_100192897 | Ga0075436_1001928973 | 137 |
| 332 | 3300006914 | Ga0075436_100284912 | Ga0075436_1002849122 | 137 |
| 333 | 3300006931 | Ga0097620_100399868 | Ga0097620_1003998682 | 137 |
| 334 | 3300007076 | Ga0075435_100074197 | Ga0075435_1000741974 | 137 |
| 335 | 3300007076 | Ga0075435_100136640 | Ga0075435_1001366403 | 137 |
| 336 | 3300007076 | Ga0075435_100153599 | Ga0075435_1001535993 | 137 |
| 337 | 3300009094 | Ga0111539_10506146 | Ga0111539_105061462 | 137 |
| 338 | 3300009094 | Ga0111539_11064073 | Ga0111539_110640732 | 137 |
| 339 | 3300009094 | Ga0111539_12854796 | Ga0111539_128547961 | 137 |
| 340 | 3300009098 | Ga0105245_10353838 | Ga0105245_103538381 | 137 |
| 341 | 3300009098 | Ga0105245_11854281 | Ga0105245_118542811 | 137 |
| 342 | 3300009101 | Ga0105247_10293878 | Ga0105247_102938782 | 137 |
| 343 | 3300009101 | Ga0105247_11414443 | Ga0105247_114144431 | 137 |
| 344 | 3300009147 | Ga0114129_10001057 | Ga0114129_100010576 | 137 |
| 345 | 3300009147 | Ga0114129_10064442 | Ga0114129_100644426 | 137 |
| 346 | 3300009147 | Ga0114129_10389415 | Ga0114129_103894151 | 137 |
| 347 | 3300009147 | Ga0114129_10833197 | Ga0114129_108331972 | 137 |
| 348 | 3300009147 | Ga0114129_11398260 | Ga0114129_113982602 | 137 |
| 349 | 3300009147 | Ga0114129_12128998 | Ga0114129_121289982 | 137 |
| 350 | 3300009148 | Ga0105243_10302239 | Ga0105243_103022393 | 137 |
| 351 | 3300009148 | Ga0105243_10660660 | Ga0105243_106606602 | 137 |
| 352 | 3300009176 | Ga0105242_10124258 | Ga0105242_101242583 | 137 |
| 353 | 3300009176 | Ga0105242_10182571 | Ga0105242_101825711 | 137 |
| 354 | 3300009177 | Ga0105248_10011418 | Ga0105248_1001141811 | 137 |
| 355 | 3300009177 | Ga0105248_10105975 | Ga0105248_101059755 | 137 |
| 356 | 3300009553 | Ga0105249_10118923 | Ga0105249_101189233 | 137 |
| 357 | 3300009553 | Ga0105249_10189724 | Ga0105249_101897244 | 137 |
| 358 | 3300009553 | Ga0105249_12300166 | Ga0105249_123001661 | 137 |
| 359 | 3300010159 | Ga0099796_10080296 | Ga0099796_100802962 | 137 |
| 360 | 3300010159 | Ga0099796_10299585 | Ga0099796_102995851 | 137 |
| 361 | 3300011119 | Ga0105246_10070025 | Ga0105246_100700254 | 137 |
| 362 | 3300011119 | Ga0105246_10237977 | Ga0105246_102379772 | 137 |
| 363 | 3300013296 | Ga0157374_10165330 | Ga0157374_101653302 | 137 |
| 364 | 3300013296 | Ga0157374_10225191 | Ga0157374_102251912 | 137 |
| 365 | 3300013296 | Ga0157374_10438900 | Ga0157374_104389003 | 137 |
| 366 | 3300013297 | Ga0157378_10030129 | Ga0157378_100301295 | 137 |
| 367 | 3300013297 | Ga0157378_10113850 | Ga0157378_101138504 | 137 |
| 368 | 3300013297 | Ga0157378_10847352 | Ga0157378_108473522 | 137 |
| 369 | 3300013308 | Ga0157375_10000111 | Ga0157375_1000011121 | 137 |
| 370 | 3300013308 | Ga0157375_10048135 | Ga0157375_100481352 | 137 |
| 371 | 3300013308 | Ga0157375_10078285 | Ga0157375_100782854 | 137 |
| 372 | 3300013308 | Ga0157375_10117523 | Ga0157375_101175233 | 137 |
| 373 | 3300013308 | Ga0157375_10493520 | Ga0157375_104935202 | 137 |
| 374 | 3300014325 | Ga0163163_10789135 | Ga0163163_107891352 | 137 |
| 375 | 3300014325 | Ga0163163_11189296 | Ga0163163_111892962 | 137 |
| 376 | 3300014968 | Ga0157379_10015814 | Ga0157379_100158147 | 137 |
| 377 | 3300014968 | Ga0157379_10457428 | Ga0157379_104574282 | 137 |
| 378 | 3300014969 | Ga0157376_10449346 | Ga0157376_104493462 | 137 |
| 379 | 3300017792 | Ga0163161_10405754 | Ga0163161_104057542 | 137 |
| 380 | 3300017792 | Ga0163161_10451046 | Ga0163161_104510462 | 137 |
| 381 | 3300025315 | Ga0207697_10324372 | Ga0207697_103243721 | 137 |
| 382 | 3300025893 | Ga0207682_10056075 | Ga0207682_100560752 | 137 |
| 383 | 3300025901 | Ga0207688_10010225 | Ga0207688_100102259 | 137 |
| 384 | 3300025903 | Ga0207680_10010143 | Ga0207680_100101433 | 137 |
| 385 | 3300025905 | Ga0207685_10438866 | Ga0207685_104388661 | 137 |
| 386 | 3300025907 | Ga0207645_10004849 | Ga0207645_100048492 | 137 |
| 387 | 3300025908 | Ga0207643_10060709 | Ga0207643_100607093 | 137 |
| 388 | 3300025908 | Ga0207643_10093008 | Ga0207643_100930082 | 137 |
| 389 | 3300025910 | Ga0207684_10099871 | Ga0207684_100998712 | 137 |
| 390 | 3300025910 | Ga0207684_10153184 | Ga0207684_101531842 | 137 |
| 391 | 3300025912 | Ga0207707_10285019 | Ga0207707_102850191 | 137 |
| 392 | 3300025915 | Ga0207693_10062934 | Ga0207693_100629342 | 137 |
| 393 | 3300025917 | Ga0207660_10277645 | Ga0207660_102776452 | 137 |
| 394 | 3300025918 | Ga0207662_10277776 | Ga0207662_102777762 | 137 |
| 395 | 3300025918 | Ga0207662_10728406 | Ga0207662_107284061 | 137 |
| 396 | 3300025918 | Ga0207662_10911090 | Ga0207662_109110902 | 137 |
| 397 | 3300025920 | Ga0207649_11621418 | Ga0207649_116214181 | 137 |
| 398 | 3300025922 | Ga0207646_10040212 | Ga0207646_100402126 | 137 |
| 399 | 3300025922 | Ga0207646_10065229 | Ga0207646_100652292 | 137 |
| 400 | 3300025925 | Ga0207650_10003791 | Ga0207650_100037918 | 137 |
| 401 | 3300025925 | Ga0207650_10126538 | Ga0207650_101265382 | 137 |
| 402 | 3300025926 | Ga0207659_10038703 | Ga0207659_100387034 | 137 |
| 403 | 3300025926 | Ga0207659_10155406 | Ga0207659_101554062 | 137 |
| 404 | 3300025926 | Ga0207659_10265962 | Ga0207659_102659622 | 137 |
| 405 | 3300025927 | Ga0207687_10364018 | Ga0207687_103640182 | 137 |
| 406 | 3300025927 | Ga0207687_11272338 | Ga0207687_112723381 | 137 |
| 407 | 3300025928 | Ga0207700_11011003 | Ga0207700_110110031 | 137 |
| 408 | 3300025929 | Ga0207664_10003657 | Ga0207664_100036572 | 137 |
| 409 | 3300025929 | Ga0207664_10451878 | Ga0207664_104518782 | 137 |
| 410 | 3300025929 | Ga0207664_11091830 | Ga0207664_110918301 | 137 |
| 411 | 3300025931 | Ga0207644_10014819 | Ga0207644_100148199 | 137 |
| 412 | 3300025931 | Ga0207644_10054631 | Ga0207644_100546314 | 137 |
| 413 | 3300025931 | Ga0207644_10074166 | Ga0207644_100741664 | 137 |
| 414 | 3300025933 | Ga0207706_10350969 | Ga0207706_103509692 | 137 |
| 415 | 3300025933 | Ga0207706_10504641 | Ga0207706_105046412 | 137 |
| 416 | 3300025934 | Ga0207686_10004561 | Ga0207686_100045616 | 137 |
| 417 | 3300025936 | Ga0207670_10116145 | Ga0207670_101161452 | 137 |
| 418 | 3300025936 | Ga0207670_10352971 | Ga0207670_103529712 | 137 |
| 419 | 3300025936 | Ga0207670_11943425 | Ga0207670_119434251 | 137 |
| 420 | 3300025937 | Ga0207669_10155085 | Ga0207669_101550852 | 137 |
| 421 | 3300025937 | Ga0207669_10297584 | Ga0207669_102975843 | 137 |
| 422 | 3300025938 | Ga0207704_10010162 | Ga0207704_100101625 | 137 |
| 423 | 3300025938 | Ga0207704_10248624 | Ga0207704_102486242 | 137 |
| 424 | 3300025940 | Ga0207691_10045532 | Ga0207691_100455324 | 137 |
| 425 | 3300025940 | Ga0207691_10103612 | Ga0207691_101036122 | 137 |
| 426 | 3300025940 | Ga0207691_10407093 | Ga0207691_104070932 | 137 |
| 427 | 3300025941 | Ga0207711_10011139 | Ga0207711_100111393 | 137 |
| 428 | 3300025941 | Ga0207711_10473394 | Ga0207711_104733942 | 137 |
| 429 | 3300025942 | Ga0207689_10086096 | Ga0207689_100860964 | 137 |
| 430 | 3300025944 | Ga0207661_10861483 | Ga0207661_108614832 | 137 |
| 431 | 3300025945 | Ga0207679_10807060 | Ga0207679_108070602 | 137 |
| 432 | 3300025960 | Ga0207651_10361960 | Ga0207651_103619602 | 137 |
| 433 | 3300025960 | Ga0207651_10369113 | Ga0207651_103691132 | 137 |
| 434 | 3300025961 | Ga0207712_10242359 | Ga0207712_102423592 | 137 |
| 435 | 3300025961 | Ga0207712_11718799 | Ga0207712_117187991 | 137 |
| 436 | 3300025986 | Ga0207658_10039086 | Ga0207658_100390862 | 137 |
| 437 | 3300025986 | Ga0207658_10146762 | Ga0207658_101467622 | 137 |
| 438 | 3300025986 | Ga0207658_10680917 | Ga0207658_106809172 | 137 |
| 439 | 3300025986 | Ga0207658_11366225 | Ga0207658_113662252 | 137 |
| 440 | 3300025986 | Ga0207658_11868426 | Ga0207658_118684261 | 137 |
| 441 | 3300026023 | Ga0207677_10036461 | Ga0207677_100364613 | 137 |
| 442 | 3300026023 | Ga0207677_10497984 | Ga0207677_104979842 | 137 |
| 443 | 3300026035 | Ga0207703_10617354 | Ga0207703_106173542 | 137 |
| 444 | 3300026067 | Ga0207678_10227492 | Ga0207678_102274923 | 137 |
| 445 | 3300026067 | Ga0207678_11165037 | Ga0207678_111650372 | 137 |
| 446 | 3300026075 | Ga0207708_10054534 | Ga0207708_100545346 | 137 |
| 447 | 3300026075 | Ga0207708_10149509 | Ga0207708_101495093 | 137 |
| 448 | 3300026088 | Ga0207641_10015592 | Ga0207641_100155923 | 137 |
| 449 | 3300026088 | Ga0207641_10037704 | Ga0207641_100377042 | 137 |
| 450 | 3300026088 | Ga0207641_10040804 | Ga0207641_100408044 | 137 |
| 451 | 3300026089 | Ga0207648_10020832 | Ga0207648_100208328 | 137 |
| 452 | 3300026089 | Ga0207648_10050253 | Ga0207648_100502532 | 137 |
| 453 | 3300026089 | Ga0207648_10095534 | Ga0207648_100955341 | 137 |
| 454 | 3300026095 | Ga0207676_10002193 | Ga0207676_1000219312 | 137 |
| 455 | 3300026095 | Ga0207676_10461096 | Ga0207676_104610962 | 137 |
| 456 | 3300026095 | Ga0207676_10519004 | Ga0207676_105190042 | 137 |
| 457 | 3300026095 | Ga0207676_10782828 | Ga0207676_107828282 | 137 |
| 458 | 3300026118 | Ga0207675_100458575 | Ga0207675_1004585752 | 137 |
| 459 | 3300026121 | Ga0207683_10009965 | Ga0207683_1000996511 | 137 |
| 460 | 3300026121 | Ga0207683_10498849 | Ga0207683_104988492 | 137 |
| 461 | 3300026142 | Ga0207698_11199623 | Ga0207698_111996232 | 137 |
| 462 | 3300027907 | Ga0207428_10619363 | Ga0207428_106193631 | 137 |
| 463 | 3300028379 | Ga0268266_10095516 | Ga0268266_100955163 | 137 |
| 464 | 3300028379 | Ga0268266_10228718 | Ga0268266_102287183 | 137 |
| 465 | 3300028379 | Ga0268266_10356960 | Ga0268266_103569602 | 137 |
| 466 | 3300028379 | Ga0268266_10397223 | Ga0268266_103972232 | 137 |
| 467 | 3300028379 | Ga0268266_11949731 | Ga0268266_119497311 | 137 |
| 468 | 3300028380 | Ga0268265_11062208 | Ga0268265_110622082 | 137 |
| 469 | 3300028381 | Ga0268264_10189181 | Ga0268264_101891813 | 137 |
| 470 | 3300028381 | Ga0268264_11839185 | Ga0268264_118391851 | 137 |
| 471 | 3300028573 | Ga0265334_10099086 | Ga0265334_100990862 | 137 |
| 472 | 3300028577 | Ga0265318_10030913 | Ga0265318_100309134 | 137 |
| 473 | 3300028653 | Ga0265323_10012238 | Ga0265323_100122384 | 137 |
| 474 | 3300028666 | Ga0265336_10147173 | Ga0265336_101471732 | 137 |
| 475 | 3300028800 | Ga0265338_10006496 | Ga0265338_1000649611 | 137 |
| 476 | 3300028800 | Ga0265338_10031473 | Ga0265338_100314733 | 137 |
| 477 | 3300028800 | Ga0265338_10231801 | Ga0265338_102318012 | 137 |
| 478 | 3300028800 | Ga0265338_10237743 | Ga0265338_102377432 | 137 |
| 479 | 3300031235 | Ga0265330_10008764 | Ga0265330_100087641 | 137 |
| 480 | 3300031239 | Ga0265328_10004615 | Ga0265328_100046154 | 137 |
| 481 | 3300031239 | Ga0265328_10005251 | Ga0265328_100052512 | 137 |
| 482 | 3300031240 | Ga0265320_10091412 | Ga0265320_100914122 | 137 |
| 483 | 3300031242 | Ga0265329_10073748 | Ga0265329_100737482 | 137 |
| 484 | 3300031249 | Ga0265339_10183160 | Ga0265339_101831602 | 137 |
| 485 | 3300031250 | Ga0265331_10013174 | Ga0265331_100131742 | 137 |
| 486 | 3300031344 | Ga0265316_10171011 | Ga0265316_101710113 | 137 |
| 487 | 3300031548 | Ga0307408_100237898 | Ga0307408_1002378983 | 137 |
| 488 | 3300031548 | Ga0307408_100676921 | Ga0307408_1006769212 | 137 |
| 489 | 3300031595 | Ga0265313_10017323 | Ga0265313_100173237 | 137 |
| 490 | 3300031665 | Ga0316575_10079749 | Ga0316575_100797492 | 137 |
| 491 | 3300031712 | Ga0265342_10033300 | Ga0265342_100333005 | 137 |
| 492 | 3300031712 | Ga0265342_10080744 | Ga0265342_100807443 | 137 |
| 493 | 3300031731 | Ga0307405_10013515 | Ga0307405_100135153 | 137 |
| 494 | 3300031852 | Ga0307410_10121511 | Ga0307410_101215114 | 137 |
| 495 | 3300031901 | Ga0307406_10016265 | Ga0307406_100162653 | 137 |
| 496 | 3300031903 | Ga0307407_10073603 | Ga0307407_100736034 | 137 |
| 497 | 3300031995 | Ga0307409_100090527 | Ga0307409_1000905272 | 137 |
| 498 | 3300031995 | Ga0307409_100223826 | Ga0307409_1002238264 | 137 |
| 499 | 3300032002 | Ga0307416_100021690 | Ga0307416_1000216907 | 137 |
| 500 | 3300032002 | Ga0307416_100072122 | Ga0307416_1000721223 | 137 |
| 501 | 3300032004 | Ga0307414_10358594 | Ga0307414_103585942 | 137 |
| 502 | 3300032005 | Ga0307411_10069496 | Ga0307411_100694965 | 137 |
| 503 | 3300032126 | Ga0307415_100023898 | Ga0307415_1000238984 | 137 |
| 504 | 3300032126 | Ga0307415_102317834 | Ga0307415_1023178341 | 137 |
| 505 | 3300035117 | Ga0373953_0242552 | Ga0373953_0242552_55_498 | 137 |
| 506 | 3300035118 | Ga0373954_0034522 | Ga0373954_0034522_592_1035 | 137 |
| 507 | 3300035119 | Ga0373956_0021865 | Ga0373956_0021865_927_1370 | 137 |
| 508 | 3300035171 | Ga0373946_0359939 | Ga0373946_0359939_211_624 | 137 |
| 509 | 3300035172 | Ga0373955_0211557 | Ga0373955_0211557_154_588 | 137 |
| 510 | 3300035410 | Ga0373924_0099196 | Ga0373924_0099196_527_970 | 137 |
| 511 | 3300035410 | Ga0373924_0404555 | Ga0373924_0404555_22_468 | 137 |
| 512 | 3300035695 | Ga0373927_1010937 | Ga0373927_1010937_109_522 | 137 |
| 513 | 3300035724 | Ga0373933_0056585 | Ga0373933_0056585_1013_1456 | 137 |
| 514 | 3300035725 | Ga0373947_0357300 | Ga0373947_0357300_405_818 | 137 |
| 515 | 3300036401 | Ga0373937_0198114 | Ga0373937_0198114_1059_1559 | 137 |
| 516 | 3300036401 | Ga0373937_0377890 | Ga0373937_0377890_76_522 | 137 |
| 517 | 3300036401 | Ga0373937_1136852 | Ga0373937_1136852_56_478 | 137 |
| 518 | 3300037068 | Ga0373925_0178458 | Ga0373925_0178458_423_836 | 137 |
| 519 | 3300037068 | Ga0373925_1374995 | Ga0373925_1374995_54_500 | 137 |
| 520 | 3300037312 | Ga0395899_0000570 | Ga0395899_0000570_22857_23270 | 137 |
| 521 | 3300037312 | Ga0395899_0002181 | Ga0395899_0002181_1356_1769 | 137 |
| 522 | 3300037312 | Ga0395899_0726312 | Ga0395899_0726312_156_602 | 137 |
| 523 | 3300037418 | Ga0395900_0205304 | Ga0395900_0205304_1415_1828 | 137 |
| 524 | 3300037418 | Ga0395900_0450626 | Ga0395900_0450626_388_804 | 137 |
| 525 | 3300037418 | Ga0395900_0680672 | Ga0395900_0680672_365_811 | 137 |
| 526 | 3300037466 | Ga0395898_0021031 | Ga0395898_0021031_5308_5721 | 137 |
| 527 | 3300037471 | Ga0395905_0004846 | Ga0395905_0004846_4533_4946 | 137 |
| 528 | 3300037471 | Ga0395905_1122908 | Ga0395905_1122908_154_567 | 137 |
| 529 | 3300038443 | Ga0395901_0125606 | Ga0395901_0125606_1276_1689 | 137 |
| 530 | 3300038443 | Ga0395901_0182121 | Ga0395901_0182121_1336_1749 | 137 |
| 531 | 3300038443 | Ga0395901_0449362 | Ga0395901_0449362_12_458 | 137 |
| 532 | 3300039437 | Ga0436365_1502616 | Ga0436365_1502616_63_530 | 137 |
| 533 | 3300042876 | Ga0451577_0012047 | Ga0451577_0012047_6495_6908 | 137 |
| 534 | 3300044673 | Ga0453683_0373036 | Ga0453683_0373036_54_467 | 137 |
| 535 | 3300044712 | Ga0453684_0040410 | Ga0453684_0040410_509_937 | 137 |
| 536 | 3300044712 | Ga0453684_0167635 | Ga0453684_0167635_1383_1796 | 137 |
| 537 | 3300045051 | Ga0451576_0088056 | Ga0451576_0088056_658_1104 | 137 |
| 538 | 3300045051 | Ga0451576_0268675 | Ga0451576_0268675_806_1258 | 137 |
| 539 | 3300045051 | Ga0451576_0957971 | Ga0451576_0957971_354_800 | 137 |
| 540 | 3300045051 | Ga0451576_1116925 | Ga0451576_1116925_358_804 | 137 |
| 541 | 3300045051 | Ga0451576_1200430 | Ga0451576_1200430_134_571 | 137 |
| 542 | 3300045051 | Ga0451576_1630420 | Ga0451576_1630420_71_517 | 137 |
| 543 | 3300045051 | Ga0451576_2457465 | Ga0451576_2457465_65_478 | 137 |
| 544 | 3300045976 | Ga0466967_0441981 | Ga0466967_0441981_822_1238 | 137 |
| 545 | 3300045976 | Ga0466967_0553257 | Ga0466967_0553257_550_1014 | 137 |
| 546 | 3300046459 | Ga0495629_0503611 | Ga0495629_0503611_76_519 | 137 |
| 547 | 3300046472 | Ga0495580_0002914 | Ga0495580_0002914_11214_11627 | 137 |
| 548 | 3300046472 | Ga0495580_0464753 | Ga0495580_0464753_240_740 | 137 |
| 549 | 3300046473 | Ga0495582_0493483 | Ga0495582_0493483_67_480 | 137 |
| 550 | 3300046475 | Ga0495639_0074003 | Ga0495639_0074003_881_1324 | 137 |
| 551 | 3300046499 | Ga0495594_0604976 | Ga0495594_0604976_134_580 | 137 |
| 552 | 3300046514 | Ga0495618_0014600 | Ga0495618_0014600_3604_4047 | 137 |
| 553 | 3300046517 | Ga0495630_0026387 | Ga0495630_0026387_600_1043 | 137 |
| 554 | 3300046517 | Ga0495630_1528137 | Ga0495630_1528137_46_480 | 137 |
| 555 | 3300046526 | Ga0495666_0431747 | Ga0495666_0431747_21_467 | 137 |
| 556 | 3300046530 | Ga0495654_0179994 | Ga0495654_0179994_129_542 | 137 |
| 557 | 3300046535 | Ga0495586_0008895 | Ga0495586_0008895_3691_4134 | 137 |
| 558 | 3300046537 | Ga0495598_0133134 | Ga0495598_0133134_93_506 | 137 |
| 559 | 3300046539 | Ga0495621_0083098 | Ga0495621_0083098_360_773 | 137 |
| 560 | 3300046559 | Ga0495667_0054104 | Ga0495667_0054104_1034_1477 | 137 |
| 561 | 3300046642 | Ga0495634_0010848 | Ga0495634_0010848_1295_1738 | 137 |
| 562 | 3300046678 | Ga0495599_0544688 | Ga0495599_0544688_118_558 | 137 |
| 563 | 3300046681 | Ga0495647_0082717 | Ga0495647_0082717_419_862 | 137 |
| 564 | 3300046683 | Ga0495658_0784968 | Ga0495658_0784968_123_569 | 137 |
| 565 | 3300046689 | Ga0495613_0006984 | Ga0495613_0006984_5073_5516 | 137 |
| 566 | 3300047319 | Ga0495674_0170584 | Ga0495674_0170584_1169_1612 | 137 |
| 567 | 3300047322 | Ga0495680_0079942 | Ga0495680_0079942_1012_1455 | 137 |
| 568 | 3300047444 | Ga0495675_0280600 | Ga0495675_0280600_373_822 | 137 |
| 569 | 3300047471 | Ga0495684_0053441 | Ga0495684_0053441_161_604 | 137 |
| 570 | 3300048090 | Ga0495615_0268881 | Ga0495615_0268881_62_493 | 137 |
| 571 | 3300048907 | Ga0496104_1339741 | Ga0496104_1339741_74_487 | 137 |
| 572 | 3300048912 | Ga0496109_0409720 | Ga0496109_0409720_335_751 | 137 |
| 573 | 3300048915 | Ga0496112_0840173 | Ga0496112_0840173_368_781 | 137 |
| 574 | 3300049568 | Ga0501031_0000631 | Ga0501031_0000631_8162_8596 | 137 |
| 575 | 3300049568 | Ga0501031_0049874 | Ga0501031_0049874_1485_1925 | 137 |
| 576 | 3300049569 | Ga0501032_0002706 | Ga0501032_0002706_10241_10675 | 137 |
| 577 | 3300049569 | Ga0501032_0140210 | Ga0501032_0140210_706_1146 | 137 |
| 578 | 3300049570 | Ga0501033_0003368 | Ga0501033_0003368_8262_8696 | 137 |
| 579 | 3300049570 | Ga0501033_0034024 | Ga0501033_0034024_2199_2639 | 137 |
| 580 | 3300049570 | Ga0501033_0057492 | Ga0501033_0057492_1027_1452 | 137 |
| 581 | 3300049571 | Ga0501034_0156034 | Ga0501034_0156034_685_1101 | 137 |
| 582 | 3300049572 | Ga0501036_0448808 | Ga0501036_0448808_140_565 | 137 |
| 583 | 3300049573 | Ga0501037_0101773 | Ga0501037_0101773_754_1179 | 137 |
| 584 | 3300049573 | Ga0501037_0183297 | Ga0501037_0183297_871_1311 | 137 |
| 585 | 3300049574 | Ga0501038_0033270 | Ga0501038_0033270_3891_4316 | 137 |
| 586 | 3300049574 | Ga0501038_0145081 | Ga0501038_0145081_558_974 | 137 |
| 587 | 3300049575 | Ga0501039_0095339 | Ga0501039_0095339_187_612 | 137 |
| 588 | 3300049575 | Ga0501039_0294199 | Ga0501039_0294199_313_738 | 137 |
| 589 | 3300049576 | Ga0501040_0108555 | Ga0501040_0108555_791_1216 | 137 |
| 590 | 3300049578 | Ga0501042_0163154 | Ga0501042_0163154_1015_1431 | 137 |
| 591 | 3300049578 | Ga0501042_0502304 | Ga0501042_0502304_352_777 | 137 |
| 592 | 3300049578 | Ga0501042_0608144 | Ga0501042_0608144_223_636 | 137 |
| 593 | 3300049579 | Ga0501043_0152387 | Ga0501043_0152387_1234_1668 | 137 |
| 594 | 3300049579 | Ga0501043_0345472 | Ga0501043_0345472_237_662 | 137 |
| 595 | 3300049579 | Ga0501043_0545397 | Ga0501043_0545397_91_507 | 137 |
| 596 | 3300049580 | Ga0501046_0055377 | Ga0501046_0055377_2276_2710 | 137 |
| 597 | 3300049581 | Ga0501047_0066763 | Ga0501047_0066763_1187_1603 | 137 |
| 598 | 3300049581 | Ga0501047_0203284 | Ga0501047_0203284_1028_1468 | 137 |
| 599 | 3300049582 | Ga0501048_0627722 | Ga0501048_0627722_304_729 | 137 |
| 600 | 3300049582 | Ga0501048_0906802 | Ga0501048_0906802_46_468 | 137 |
| 601 | 3300049583 | Ga0501067_0102532 | Ga0501067_0102532_1128_1544 | 137 |
| 602 | 3300049584 | Ga0501068_0042370 | Ga0501068_0042370_709_1134 | 137 |
| 603 | 3300049584 | Ga0501068_0216012 | Ga0501068_0216012_186_602 | 137 |
| 604 | 3300049585 | Ga0501069_0020517 | Ga0501069_0020517_253_669 | 137 |
| 605 | 3300049585 | Ga0501069_0098424 | Ga0501069_0098424_396_809 | 137 |
| 606 | 3300049586 | Ga0501070_0006216 | Ga0501070_0006216_3272_3685 | 137 |
| 607 | 3300049586 | Ga0501070_0051481 | Ga0501070_0051481_2800_3213 | 137 |
| 608 | 3300049587 | Ga0501071_0754992 | Ga0501071_0754992_179_604 | 137 |
| 609 | 3300049588 | Ga0501072_0228777 | Ga0501072_0228777_778_1203 | 137 |
| 610 | 3300049588 | Ga0501072_0487980 | Ga0501072_0487980_146_559 | 137 |
| 611 | 3300049589 | Ga0501073_0082404 | Ga0501073_0082404_574_1017 | 137 |
| 612 | 3300049589 | Ga0501073_0203462 | Ga0501073_0203462_666_1082 | 137 |
| 613 | 3300049589 | Ga0501073_0282951 | Ga0501073_0282951_617_1060 | 137 |
| 614 | 3300049590 | Ga0501074_0005852 | Ga0501074_0005852_1667_2080 | 137 |
| 615 | 3300049590 | Ga0501074_0106334 | Ga0501074_0106334_535_960 | 137 |
| 616 | 3300049590 | Ga0501074_0271256 | Ga0501074_0271256_711_1127 | 137 |
| 617 | 3300049590 | Ga0501074_0538933 | Ga0501074_0538933_354_779 | 137 |
| 618 | 3300049591 | Ga0501075_0323306 | Ga0501075_0323306_731_1156 | 137 |
| 619 | 3300049592 | Ga0501076_0026248 | Ga0501076_0026248_2263_2688 | 137 |
| 620 | 3300049592 | Ga0501076_0522250 | Ga0501076_0522250_337_750 | 137 |
| 621 | 3300049593 | Ga0501077_0152362 | Ga0501077_0152362_1014_1439 | 137 |
| 622 | 3300049593 | Ga0501077_0773897 | Ga0501077_0773897_84_497 | 137 |
| 623 | 3300049741 | Ga0501079_0022932 | Ga0501079_0022932_3546_3971 | 137 |
| 624 | 3300049741 | Ga0501079_0096703 | Ga0501079_0096703_1492_1917 | 137 |
| 625 | 3300049741 | Ga0501079_1000871 | Ga0501079_1000871_47_463 | 137 |
| 626 | 3300049742 | Ga0501080_0146967 | Ga0501080_0146967_633_1046 | 137 |
| 627 | 3300049742 | Ga0501080_0167459 | Ga0501080_0167459_74_490 | 137 |
| 628 | 3300049742 | Ga0501080_0358473 | Ga0501080_0358473_212_655 | 137 |
| 629 | 3300049743 | Ga0501081_0192703 | Ga0501081_0192703_913_1338 | 137 |
| 630 | 3300049822 | Ga0501035_0027702 | Ga0501035_0027702_900_1334 | 137 |
| 631 | 3300049823 | Ga0501044_0000442 | Ga0501044_0000442_38377_38811 | 137 |
| 632 | 3300049823 | Ga0501044_0006715 | Ga0501044_0006715_1942_2382 | 137 |
| 633 | 3300049823 | Ga0501044_0223050 | Ga0501044_0223050_862_1278 | 137 |
| 634 | 3300049824 | Ga0501045_0132239 | Ga0501045_0132239_581_1006 | 137 |
| 635 | 3300049824 | Ga0501045_0773257 | Ga0501045_0773257_212_625 | 137 |
| 636 | 3300050493 | nmdc:mga0k408_20281_c1 | nmdc:mga0k408_20281_c1_1629_2057 | 137 |
| 637 | 3300050507 | nmdc:mga05p37_100422_c1 | nmdc:mga05p37_100422_c1_873_1292 | 137 |
| 638 | 3300050507 | nmdc:mga05p37_237205_c1 | nmdc:mga05p37_237205_c1_394_807 | 137 |
| 639 | 3300050507 | nmdc:mga05p37_368604_c1 | nmdc:mga05p37_368604_c1_167_586 | 137 |
| 640 | 3300050507 | nmdc:mga05p37_48070_c1 | nmdc:mga05p37_48070_c1_3421_3834 | 137 |
| 641 | 3300050507 | nmdc:mga05p37_639_c1 | nmdc:mga05p37_639_c1_37677_38096 | 137 |
| 642 | 3300050508 | nmdc:mga09592_298966_c1 | nmdc:mga09592_298966_c1_454_867 | 137 |
| 643 | 3300050508 | nmdc:mga09592_77365_c1 | nmdc:mga09592_77365_c1_1576_1995 | 137 |
| 644 | 3300050509 | nmdc:mga0qj67_61221_c1 | nmdc:mga0qj67_61221_c1_2063_2482 | 137 |
| 645 | 3300050509 | nmdc:mga0qj67_75438_c1 | nmdc:mga0qj67_75438_c1_2231_2644 | 137 |
| 646 | 3300050510 | nmdc:mga06r32_1071_c1 | nmdc:mga06r32_1071_c1_5502_5921 | 137 |
| 647 | 3300050510 | nmdc:mga06r32_415554_c1 | nmdc:mga06r32_415554_c1_71_484 | 137 |
| 648 | 3300050510 | nmdc:mga06r32_423676_c1 | nmdc:mga06r32_423676_c1_60_521 | 137 |
| 649 | 3300050510 | nmdc:mga06r32_591106_c1 | nmdc:mga06r32_591106_c1_485_898 | 137 |
| 650 | 3300050511 | nmdc:mga08y16_948676_c1 | nmdc:mga08y16_948676_c1_199_645 | 137 |
| 651 | 3300050512 | nmdc:mga0n895_1322660_c1 | nmdc:mga0n895_1322660_c1_143_556 | 137 |
| 652 | 3300050512 | nmdc:mga0n895_1597249_c1 | nmdc:mga0n895_1597249_c1_179_592 | 137 |
| 653 | 3300050512 | nmdc:mga0n895_27412_c1 | nmdc:mga0n895_27412_c1_4459_4872 | 137 |
| 654 | 3300050512 | nmdc:mga0n895_558486_c1 | nmdc:mga0n895_558486_c1_563_976 | 137 |
| 655 | 3300050512 | nmdc:mga0n895_83406_c1 | nmdc:mga0n895_83406_c1_2158_2571 | 137 |
| 656 | 3300050513 | nmdc:mga0rr50_1114364_c1 | nmdc:mga0rr50_1114364_c1_244_657 | 137 |
| 657 | 3300050513 | nmdc:mga0rr50_530763_c1 | nmdc:mga0rr50_530763_c1_551_964 | 137 |
| 658 | 3300050513 | nmdc:mga0rr50_7612_c1 | nmdc:mga0rr50_7612_c1_3478_3891 | 137 |
| 659 | 3300050514 | nmdc:mga08x19_458659_c1 | nmdc:mga08x19_458659_c1_249_665 | 137 |
| 660 | 3300050514 | nmdc:mga08x19_506466_c1 | nmdc:mga08x19_506466_c1_145_558 | 137 |
| 661 | 3300050515 | nmdc:mga0a205_212288_c1 | nmdc:mga0a205_212288_c1_539_952 | 137 |
| 662 | 3300050515 | nmdc:mga0a205_625855_c1 | nmdc:mga0a205_625855_c1_122_535 | 137 |
| 663 | 3300050515 | nmdc:mga0a205_73683_c1 | nmdc:mga0a205_73683_c1_315_728 | 137 |
| 664 | 3300050515 | nmdc:mga0a205_746217_c1 | nmdc:mga0a205_746217_c1_253_666 | 137 |
| 665 | 3300053077 | Ga0495601_0061455 | Ga0495601_0061455_1480_1896 | 137 |
| 666 | 3300054114 | Ga0501084_0056030 | Ga0501084_0056030_1702_2127 | 137 |
| 667 | 3300054114 | Ga0501084_0170957 | Ga0501084_0170957_1151_1576 | 137 |
| 668 | 3300054114 | Ga0501084_1487873 | Ga0501084_1487873_125_541 | 137 |
| 669 | 3300061734 | Ga0530510_0024902 | Ga0530510_0024902_3722_4147 | 137 |
| 670 | 3300061734 | Ga0530510_0586565 | Ga0530510_0586565_243_668 | 137 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1u6l-assembly1.cif.gz_B | crystal structure of protein pa1353 from pseudomonas aeruginosa | 0.8992 | 1 | 136 |
| 1u6l-assembly1.cif.gz_B | crystal structure of protein pa1353 from pseudomonas aeruginosa | 0.8738 | 1 | 136 |
| 3oms-assembly1.cif.gz_A-2 | putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. | 0.8484 | 1 | 136 |
| 3oms-assembly1.cif.gz_A-2 | putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. | 0.8423 | 1 | 136 |
| 1u69-assembly2.cif.gz_D | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.8349 | 1 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1U2_73_132_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9517 | 80 | 135 | 3.30.720.110 |
| 3omsA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9218 | 78 | 136 | 3.30.720.110 |
| af_P16681_7_147_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9108 | 11 | 137 | 3.10.180.10 |
| 3omsA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9072 | 78 | 136 | 3.30.720.110 |
| af_Q2G1U2_73_132_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8772 | 80 | 135 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1J5SNH6-F1-model_v4 | Uncharacterized protein | 0.9977 | 2 | 137 |
|
| AF-A0A536UDD0-F1-model_v4 | VOC family protein | 0.9939 | 1 | 137 |
|
| AF-A1VUF7-F1-model_v4 | 3-demethylubiquinone-9 3-methyltransferase | 0.9933 | 1 | 137 |
GO:0008168
GO:0032259 |
| AF-A0A1Y6BHF6-F1-model_v4 | PhnB protein | 0.9928 | 1 | 137 |
|
| AF-A0A534STB7-F1-model_v4 | VOC family protein | 0.9917 | 1 | 136 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar