F474089
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 670 | 288 | 670 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300025926|Ga0207659_10348047|Ga0207659_103480471 |
| Length | 151 |
| Sequence | VRQAIATDQAPKAIGPYSQAITAGSLLYCSGQIPLDPATGALVQGDLAAQTRRVLDNVGAILAAAGTSFDRVVKTTVFLADMNDFAAMNEVYATYFTSPAPARSTVAAAGLPKGARIEIEGFGELHQQGRRKWPLIALHQIEIAWRDCQHF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 116 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 117 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 186 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 200 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 201 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 202 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 203 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 204 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 205 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 206 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 222 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 223 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 224 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 225 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 226 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 227 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 231 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 235 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 236 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 264 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 265 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 266 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 271 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 272 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 273 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.76 |
| Rhizosphere | 91.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_551986 | 2162886011 | Bacteria | 1745 |
| 2 | LJQas_1000046 | 3300000549 | Bacteria | 19569 |
| 3 | JGI24751J29686_10039302 | 3300002459 | Bacteria | 979 |
| 4 | JGI24751J29686_10083194 | 3300002459 | Unclassified | 664 |
| 5 | JGI25406J46586_10017975 | 3300003203 | Bacteria | 2912 |
| 6 | JGI25406J46586_10101567 | 3300003203 | Bacteria | 857 |
| 7 | Ga0065712_10000329 | 3300005290 | Bacteria | 17463 |
| 8 | Ga0065712_10004655 | 3300005290 | Bacteria | 6705 |
| 9 | Ga0065715_10001890 | 3300005293 | Bacteria | 7149 |
| 10 | Ga0065715_10126324 | 3300005293 | Bacteria | 2111 |
| 11 | Ga0065715_10181738 | 3300005293 | Bacteria | 1472 |
| 12 | Ga0065707_10166691 | 3300005295 | Bacteria | 1517 |
| 13 | Ga0065707_10383896 | 3300005295 | Bacteria | 873 |
| 14 | Ga0070676_10007361 | 3300005328 | Bacteria | 5906 |
| 15 | Ga0070676_10103048 | 3300005328 | Bacteria | 1766 |
| 16 | Ga0070676_10595593 | 3300005328 | Bacteria | 797 |
| 17 | Ga0070683_101354420 | 3300005329 | Bacteria | 684 |
| 18 | Ga0070690_100307618 | 3300005330 | Bacteria | 1138 |
| 19 | Ga0070690_100773823 | 3300005330 | Bacteria | 743 |
| 20 | Ga0070670_100000040 | 3300005331 | Bacteria | 149939 |
| 21 | Ga0070670_100000177 | 3300005331 | Bacteria | 57701 |
| 22 | Ga0070670_100002961 | 3300005331 | Bacteria | 14061 |
| 23 | Ga0070670_100008026 | 3300005331 | Bacteria | 8980 |
| 24 | Ga0070670_100075366 | 3300005331 | Bacteria | 2899 |
| 25 | Ga0068869_100710809 | 3300005334 | Bacteria | 858 |
| 26 | Ga0068869_101943091 | 3300005334 | Bacteria | 527 |
| 27 | Ga0070680_101371364 | 3300005336 | Bacteria | 612 |
| 28 | Ga0070682_101666982 | 3300005337 | Bacteria | 553 |
| 29 | Ga0068868_100179457 | 3300005338 | Bacteria | 1756 |
| 30 | Ga0068868_100433762 | 3300005338 | Bacteria | 1140 |
| 31 | Ga0070689_100056898 | 3300005340 | Bacteria | 3034 |
| 32 | Ga0070689_100231183 | 3300005340 | Bacteria | 1520 |
| 33 | Ga0070689_100808792 | 3300005340 | Bacteria | 825 |
| 34 | Ga0070691_10003956 | 3300005341 | Bacteria | 6703 |
| 35 | Ga0070691_10724514 | 3300005341 | Bacteria | 599 |
| 36 | Ga0070687_100492089 | 3300005343 | Bacteria | 824 |
| 37 | Ga0070687_100760963 | 3300005343 | Bacteria | 682 |
| 38 | Ga0070692_10276731 | 3300005345 | Bacteria | 1015 |
| 39 | Ga0070692_10462046 | 3300005345 | Unclassified | 815 |
| 40 | Ga0070668_100015638 | 3300005347 | Bacteria | 5673 |
| 41 | Ga0070669_100051607 | 3300005353 | Bacteria | 3007 |
| 42 | Ga0070669_100211602 | 3300005353 | Bacteria | 1530 |
| 43 | Ga0070669_100385179 | 3300005353 | Unclassified | 1144 |
| 44 | Ga0070675_100049947 | 3300005354 | Bacteria | 3434 |
| 45 | Ga0070675_100085282 | 3300005354 | Bacteria | 2638 |
| 46 | Ga0070675_100486313 | 3300005354 | Bacteria | 1111 |
| 47 | Ga0070675_100554867 | 3300005354 | Bacteria | 1039 |
| 48 | Ga0070671_100033098 | 3300005355 | Bacteria | 4274 |
| 49 | Ga0070671_100224742 | 3300005355 | Bacteria | 1593 |
| 50 | Ga0070671_100809206 | 3300005355 | Bacteria | 816 |
| 51 | Ga0070674_100002662 | 3300005356 | Bacteria | 9894 |
| 52 | Ga0070674_100005767 | 3300005356 | Bacteria | 7185 |
| 53 | Ga0070674_100075290 | 3300005356 | Bacteria | 2397 |
| 54 | Ga0070673_100163106 | 3300005364 | Bacteria | 1897 |
| 55 | Ga0070673_100168830 | 3300005364 | Bacteria | 1866 |
| 56 | Ga0070673_100425051 | 3300005364 | Unclassified | 1192 |
| 57 | Ga0070673_100609210 | 3300005364 | Bacteria | 997 |
| 58 | Ga0070688_100008752 | 3300005365 | Bacteria | 5505 |
| 59 | Ga0070688_100010798 | 3300005365 | Bacteria | 5048 |
| 60 | Ga0070688_100459181 | 3300005365 | Bacteria | 954 |
| 61 | Ga0070659_100088747 | 3300005366 | Bacteria | 2476 |
| 62 | Ga0070667_100316736 | 3300005367 | Bacteria | 1407 |
| 63 | Ga0070667_100398187 | 3300005367 | Bacteria | 1253 |
| 64 | Ga0070703_10048321 | 3300005406 | Bacteria | 1351 |
| 65 | Ga0070709_10248779 | 3300005434 | Bacteria | 1280 |
| 66 | Ga0070701_10022642 | 3300005438 | Bacteria | 3014 |
| 67 | Ga0070701_10151103 | 3300005438 | Bacteria | 1337 |
| 68 | Ga0070705_100006397 | 3300005440 | Bacteria | 5774 |
| 69 | Ga0070705_100029428 | 3300005440 | Bacteria | 3021 |
| 70 | Ga0070705_100458119 | 3300005440 | Bacteria | 958 |
| 71 | Ga0070700_100009994 | 3300005441 | Bacteria | 5223 |
| 72 | Ga0070700_100011679 | 3300005441 | Bacteria | 4872 |
| 73 | Ga0070700_100026025 | 3300005441 | Bacteria | 3450 |
| 74 | Ga0070700_100436678 | 3300005441 | Unclassified | 993 |
| 75 | Ga0070700_100665313 | 3300005441 | Bacteria | 824 |
| 76 | Ga0070694_100058835 | 3300005444 | Bacteria | 2616 |
| 77 | Ga0070694_100786013 | 3300005444 | Bacteria | 779 |
| 78 | Ga0070708_100005220 | 3300005445 | Bacteria | 10287 |
| 79 | Ga0070708_100015034 | 3300005445 | Archaea | 6384 |
| 80 | Ga0070708_100184211 | 3300005445 | Archaea | 1952 |
| 81 | Ga0070708_101067551 | 3300005445 | Bacteria | 757 |
| 82 | Ga0070678_100096650 | 3300005456 | Bacteria | 2279 |
| 83 | Ga0070678_100187374 | 3300005456 | Bacteria | 1698 |
| 84 | Ga0070662_100714127 | 3300005457 | Bacteria | 848 |
| 85 | Ga0070681_10364398 | 3300005458 | Unclassified | 1355 |
| 86 | Ga0068867_100017807 | 3300005459 | Bacteria | 5045 |
| 87 | Ga0068867_100145891 | 3300005459 | Bacteria | 1855 |
| 88 | Ga0068867_100178754 | 3300005459 | Bacteria | 1686 |
| 89 | Ga0068867_100460233 | 3300005459 | Unclassified | 1086 |
| 90 | Ga0068867_100677151 | 3300005459 | Bacteria | 908 |
| 91 | Ga0068867_101016165 | 3300005459 | Bacteria | 753 |
| 92 | Ga0070685_10011459 | 3300005466 | Bacteria | 4640 |
| 93 | Ga0070685_10024892 | 3300005466 | Bacteria | 3292 |
| 94 | Ga0070685_10045911 | 3300005466 | Bacteria | 2507 |
| 95 | Ga0070706_100000223 | 3300005467 | Bacteria | 69475 |
| 96 | Ga0070706_100021405 | 3300005467 | Bacteria | 5956 |
| 97 | Ga0070706_100061416 | 3300005467 | Bacteria | 3470 |
| 98 | Ga0070706_100338406 | 3300005467 | Bacteria | 1403 |
| 99 | Ga0070707_100000030 | 3300005468 | Unclassified | 122924 |
| 100 | Ga0070707_100083777 | 3300005468 | Archaea | 3081 |
| 101 | Ga0070707_100244169 | 3300005468 | Bacteria | 1747 |
| 102 | Ga0070707_100367042 | 3300005468 | Bacteria | 1398 |
| 103 | Ga0070707_100413735 | 3300005468 | Unclassified | 1309 |
| 104 | Ga0070698_100004458 | 3300005471 | Bacteria | 15388 |
| 105 | Ga0074259_10176926 | 3300005507 | Bacteria | 855 |
| 106 | Ga0070699_100372459 | 3300005518 | Bacteria | 1288 |
| 107 | Ga0070699_100650597 | 3300005518 | Bacteria | 962 |
| 108 | Ga0070699_101443933 | 3300005518 | Bacteria | 631 |
| 109 | Ga0070684_100171712 | 3300005535 | Bacteria | 1969 |
| 110 | Ga0070684_100176135 | 3300005535 | Bacteria | 1944 |
| 111 | Ga0070684_100633334 | 3300005535 | Unclassified | 995 |
| 112 | Ga0070684_100804320 | 3300005535 | Bacteria | 879 |
| 113 | Ga0070697_100130966 | 3300005536 | Archaea | 2103 |
| 114 | Ga0070697_100131712 | 3300005536 | Bacteria | 2098 |
| 115 | Ga0070697_101336689 | 3300005536 | Bacteria | 639 |
| 116 | Ga0068853_100176180 | 3300005539 | Bacteria | 1937 |
| 117 | Ga0068853_101394995 | 3300005539 | Bacteria | 677 |
| 118 | Ga0070672_100004106 | 3300005543 | Bacteria | 9506 |
| 119 | Ga0070672_100551720 | 3300005543 | Bacteria | 1001 |
| 120 | Ga0070672_100671494 | 3300005543 | Bacteria | 906 |
| 121 | Ga0070672_101368958 | 3300005543 | Bacteria | 633 |
| 122 | Ga0070686_100008839 | 3300005544 | Bacteria | 5645 |
| 123 | Ga0070686_100100640 | 3300005544 | Bacteria | 1952 |
| 124 | Ga0070686_100167064 | 3300005544 | Bacteria | 1553 |
| 125 | Ga0070695_100009270 | 3300005545 | Bacteria | 5851 |
| 126 | Ga0070695_100157247 | 3300005545 | Bacteria | 1592 |
| 127 | Ga0070696_100004210 | 3300005546 | Bacteria | 9582 |
| 128 | Ga0070696_100269509 | 3300005546 | Bacteria | 1294 |
| 129 | Ga0070665_100011544 | 3300005548 | Bacteria | 8928 |
| 130 | Ga0070665_100518880 | 3300005548 | Bacteria | 1203 |
| 131 | Ga0070704_100006282 | 3300005549 | Bacteria | 6993 |
| 132 | Ga0070704_100545869 | 3300005549 | Bacteria | 1012 |
| 133 | Ga0070704_100923341 | 3300005549 | Bacteria | 786 |
| 134 | Ga0068855_100930783 | 3300005563 | Bacteria | 917 |
| 135 | Ga0068855_101356614 | 3300005563 | Bacteria | 734 |
| 136 | Ga0070664_100465160 | 3300005564 | Bacteria | 1162 |
| 137 | Ga0068854_100005336 | 3300005578 | Bacteria | 8112 |
| 138 | Ga0068854_100024287 | 3300005578 | Unclassified | 4148 |
| 139 | Ga0068854_100326574 | 3300005578 | Bacteria | 1249 |
| 140 | Ga0068854_100612274 | 3300005578 | Unclassified | 931 |
| 141 | Ga0068854_100751779 | 3300005578 | Unclassified | 846 |
| 142 | Ga0068856_100053873 | 3300005614 | Bacteria | 3967 |
| 143 | Ga0068856_100997029 | 3300005614 | Bacteria | 856 |
| 144 | Ga0070702_100008040 | 3300005615 | Bacteria | 5089 |
| 145 | Ga0070702_100134791 | 3300005615 | Bacteria | 1565 |
| 146 | Ga0068852_100841993 | 3300005616 | Bacteria | 933 |
| 147 | Ga0068852_102779818 | 3300005616 | Bacteria | 508 |
| 148 | Ga0068859_100075274 | 3300005617 | Bacteria | 3416 |
| 149 | Ga0068859_100231920 | 3300005617 | Bacteria | 1934 |
| 150 | Ga0068859_100423725 | 3300005617 | Bacteria | 1427 |
| 151 | Ga0068859_102414827 | 3300005617 | Bacteria | 579 |
| 152 | Ga0068864_100057981 | 3300005618 | Bacteria | 3346 |
| 153 | Ga0068864_100160576 | 3300005618 | Bacteria | 2043 |
| 154 | Ga0068866_10039141 | 3300005718 | Bacteria | 2340 |
| 155 | Ga0068866_10111378 | 3300005718 | Bacteria | 1528 |
| 156 | Ga0068866_10132054 | 3300005718 | Bacteria | 1422 |
| 157 | Ga0068866_10179224 | 3300005718 | Bacteria | 1250 |
| 158 | Ga0068866_10205655 | 3300005718 | Bacteria | 1179 |
| 159 | Ga0068861_100306023 | 3300005719 | Bacteria | 1379 |
| 160 | Ga0068861_101245452 | 3300005719 | Unclassified | 721 |
| 161 | Ga0068851_10993439 | 3300005834 | Bacteria | 529 |
| 162 | Ga0068870_10000685 | 3300005840 | Bacteria | 12965 |
| 163 | Ga0068870_10166252 | 3300005840 | Bacteria | 1313 |
| 164 | Ga0068870_10203436 | 3300005840 | Bacteria | 1202 |
| 165 | Ga0068863_100043250 | 3300005841 | Bacteria | 4277 |
| 166 | Ga0068863_100048593 | 3300005841 | Bacteria | 4023 |
| 167 | Ga0068858_100548654 | 3300005842 | Bacteria | 1119 |
| 168 | Ga0068858_100604918 | 3300005842 | Bacteria | 1063 |
| 169 | Ga0068860_100151563 | 3300005843 | Unclassified | 2233 |
| 170 | Ga0068860_100847786 | 3300005843 | Bacteria | 928 |
| 171 | Ga0068860_100950722 | 3300005843 | Unclassified | 876 |
| 172 | Ga0068860_101168907 | 3300005843 | Bacteria | 789 |
| 173 | Ga0068862_100244414 | 3300005844 | Bacteria | 1633 |
| 174 | Ga0068862_100874656 | 3300005844 | Bacteria | 882 |
| 175 | Ga0068862_101138925 | 3300005844 | Unclassified | 777 |
| 176 | Ga0081538_10052075 | 3300005981 | Bacteria | 2450 |
| 177 | Ga0081539_10000041 | 3300005985 | Bacteria | 292660 |
| 178 | Ga0081539_10010708 | 3300005985 | Bacteria | 7393 |
| 179 | Ga0070717_11659735 | 3300006028 | Bacteria | 579 |
| 180 | Ga0070716_100064759 | 3300006173 | Bacteria | 2126 |
| 181 | Ga0070716_100151662 | 3300006173 | Bacteria | 1491 |
| 182 | Ga0070716_101140262 | 3300006173 | Bacteria | 624 |
| 183 | Ga0070712_100522929 | 3300006175 | Bacteria | 997 |
| 184 | Ga0097621_100007602 | 3300006237 | Bacteria | 7766 |
| 185 | Ga0097621_100214551 | 3300006237 | Bacteria | 1675 |
| 186 | Ga0097621_100240940 | 3300006237 | Unclassified | 1581 |
| 187 | Ga0068871_100051751 | 3300006358 | Bacteria | 3325 |
| 188 | Ga0068871_100095394 | 3300006358 | Bacteria | 2484 |
| 189 | Ga0068871_101652148 | 3300006358 | Unclassified | 607 |
| 190 | Ga0068871_101768044 | 3300006358 | Bacteria | 587 |
| 191 | Ga0075428_100107143 | 3300006844 | Bacteria | 3046 |
| 192 | Ga0075430_100687286 | 3300006846 | Bacteria | 843 |
| 193 | Ga0075431_100092902 | 3300006847 | Bacteria | 3114 |
| 194 | Ga0075434_100060885 | 3300006871 | Bacteria | 3755 |
| 195 | Ga0068865_100399369 | 3300006881 | Bacteria | 1126 |
| 196 | Ga0068865_100665003 | 3300006881 | Bacteria | 887 |
| 197 | Ga0068865_100943391 | 3300006881 | Bacteria | 753 |
| 198 | Ga0075436_100030397 | 3300006914 | Bacteria | 3718 |
| 199 | Ga0075436_100179751 | 3300006914 | Bacteria | 1495 |
| 200 | Ga0075436_100797866 | 3300006914 | Bacteria | 703 |
| 201 | Ga0097620_100075280 | 3300006931 | Bacteria | 3416 |
| 202 | Ga0097620_100231937 | 3300006931 | Bacteria | 1934 |
| 203 | Ga0097620_100423749 | 3300006931 | Bacteria | 1427 |
| 204 | Ga0097620_102415603 | 3300006931 | Bacteria | 579 |
| 205 | Ga0075435_100033994 | 3300007076 | Bacteria | 4036 |
| 206 | Ga0075435_100832320 | 3300007076 | Bacteria | 804 |
| 207 | Ga0075435_101292226 | 3300007076 | Bacteria | 639 |
| 208 | Ga0099794_10003801 | 3300007265 | Archaea | 5828 |
| 209 | Ga0099794_10045626 | 3300007265 | Archaea | 2097 |
| 210 | Ga0099794_10071376 | 3300007265 | Archaea | 1701 |
| 211 | Ga0099794_10548685 | 3300007265 | Unclassified | 610 |
| 212 | Ga0105240_10662715 | 3300009093 | Bacteria | 1142 |
| 213 | Ga0105240_11205569 | 3300009093 | Unclassified | 801 |
| 214 | Ga0105240_11662143 | 3300009093 | Bacteria | 667 |
| 215 | Ga0111539_10024118 | 3300009094 | Bacteria | 7470 |
| 216 | Ga0111539_10071959 | 3300009094 | Bacteria | 4079 |
| 217 | Ga0111539_10275055 | 3300009094 | Bacteria | 1960 |
| 218 | Ga0105245_10049106 | 3300009098 | Bacteria | 3777 |
| 219 | Ga0105245_10085806 | 3300009098 | Bacteria | 2886 |
| 220 | Ga0105245_10107876 | 3300009098 | Bacteria | 2585 |
| 221 | Ga0105245_10156900 | 3300009098 | Unclassified | 2156 |
| 222 | Ga0105245_10369223 | 3300009098 | Bacteria | 1426 |
| 223 | Ga0105245_12283323 | 3300009098 | Bacteria | 595 |
| 224 | Ga0105247_10062295 | 3300009101 | Bacteria | 2314 |
| 225 | Ga0105247_10065435 | 3300009101 | Bacteria | 2261 |
| 226 | Ga0105247_10354561 | 3300009101 | Bacteria | 1033 |
| 227 | Ga0105247_10548011 | 3300009101 | Unclassified | 850 |
| 228 | Ga0114129_10032907 | 3300009147 | Bacteria | 7326 |
| 229 | Ga0114129_10662521 | 3300009147 | Bacteria | 1346 |
| 230 | Ga0114129_12040153 | 3300009147 | Bacteria | 693 |
| 231 | Ga0114129_13401282 | 3300009147 | Unclassified | 512 |
| 232 | Ga0105243_10048809 | 3300009148 | Bacteria | 3338 |
| 233 | Ga0105243_10133199 | 3300009148 | Bacteria | 2111 |
| 234 | Ga0105243_10482566 | 3300009148 | Bacteria | 1170 |
| 235 | Ga0105243_10986333 | 3300009148 | Bacteria | 844 |
| 236 | Ga0105241_10037969 | 3300009174 | Bacteria | 3631 |
| 237 | Ga0105241_10729206 | 3300009174 | Bacteria | 907 |
| 238 | Ga0105241_11187614 | 3300009174 | Bacteria | 722 |
| 239 | Ga0105242_10078817 | 3300009176 | Bacteria | 2750 |
| 240 | Ga0105242_10087129 | 3300009176 | Bacteria | 2622 |
| 241 | Ga0105248_10023640 | 3300009177 | Bacteria | 6828 |
| 242 | Ga0105248_10125076 | 3300009177 | Bacteria | 2901 |
| 243 | Ga0105248_10203480 | 3300009177 | Bacteria | 2231 |
| 244 | Ga0105248_10721139 | 3300009177 | Bacteria | 1125 |
| 245 | Ga0105237_10294931 | 3300009545 | Bacteria | 1624 |
| 246 | Ga0105237_10313901 | 3300009545 | Bacteria | 1571 |
| 247 | Ga0105237_10557922 | 3300009545 | Bacteria | 1152 |
| 248 | Ga0105238_10420704 | 3300009551 | Unclassified | 1331 |
| 249 | Ga0105249_11195378 | 3300009553 | Bacteria | 831 |
| 250 | Ga0105249_11457354 | 3300009553 | Bacteria | 757 |
| 251 | Ga0105239_10066883 | 3300010375 | Bacteria | 3947 |
| 252 | Ga0105239_10105613 | 3300010375 | Bacteria | 3119 |
| 253 | Ga0105239_10149616 | 3300010375 | Bacteria | 2605 |
| 254 | Ga0105239_11223802 | 3300010375 | Unclassified | 865 |
| 255 | Ga0105239_12765785 | 3300010375 | Unclassified | 573 |
| 256 | Ga0105246_10012343 | 3300011119 | Bacteria | 5328 |
| 257 | Ga0105246_10014513 | 3300011119 | Bacteria | 4955 |
| 258 | Ga0105246_10235892 | 3300011119 | Bacteria | 1443 |
| 259 | Ga0105246_10241382 | 3300011119 | Bacteria | 1428 |
| 260 | Ga0105246_10470315 | 3300011119 | Bacteria | 1061 |
| 261 | Ga0105246_11064072 | 3300011119 | Bacteria | 736 |
| 262 | Ga0105246_12195017 | 3300011119 | Bacteria | 537 |
| 263 | Ga0157325_1011236 | 3300012485 | Unclassified | 671 |
| 264 | Ga0157373_10582196 | 3300013100 | Unclassified | 814 |
| 265 | Ga0157374_10000021 | 3300013296 | Bacteria | 272840 |
| 266 | Ga0157374_10564085 | 3300013296 | Bacteria | 1147 |
| 267 | Ga0157378_10680324 | 3300013297 | Bacteria | 1047 |
| 268 | Ga0157378_11122521 | 3300013297 | Bacteria | 824 |
| 269 | Ga0163162_10046559 | 3300013306 | Bacteria | 4347 |
| 270 | Ga0163162_10260284 | 3300013306 | Bacteria | 1867 |
| 271 | Ga0163162_11219563 | 3300013306 | Unclassified | 854 |
| 272 | Ga0157372_10039849 | 3300013307 | Bacteria | 5187 |
| 273 | Ga0157372_11154790 | 3300013307 | Unclassified | 895 |
| 274 | Ga0157375_10007205 | 3300013308 | Bacteria | 9724 |
| 275 | Ga0157375_10243171 | 3300013308 | Bacteria | 1959 |
| 276 | Ga0157375_10531628 | 3300013308 | Bacteria | 1338 |
| 277 | Ga0157375_10623568 | 3300013308 | Bacteria | 1236 |
| 278 | Ga0163163_10000275 | 3300014325 | Bacteria | 51570 |
| 279 | Ga0163163_10034702 | 3300014325 | Bacteria | 4888 |
| 280 | Ga0163163_10034994 | 3300014325 | Bacteria | 4869 |
| 281 | Ga0163163_10159998 | 3300014325 | Bacteria | 2297 |
| 282 | Ga0163163_10201557 | 3300014325 | Bacteria | 2038 |
| 283 | Ga0163163_10503686 | 3300014325 | Unclassified | 1273 |
| 284 | Ga0163163_10691785 | 3300014325 | Unclassified | 1083 |
| 285 | Ga0157380_10015409 | 3300014326 | Bacteria | 5619 |
| 286 | Ga0157380_10500316 | 3300014326 | Bacteria | 1180 |
| 287 | Ga0157380_10879268 | 3300014326 | Bacteria | 920 |
| 288 | Ga0157377_10000023 | 3300014745 | Bacteria | 146600 |
| 289 | Ga0157377_10038673 | 3300014745 | Bacteria | 2635 |
| 290 | Ga0157379_10083735 | 3300014968 | Bacteria | 2859 |
| 291 | Ga0157379_10382350 | 3300014968 | Bacteria | 1292 |
| 292 | Ga0157379_10390799 | 3300014968 | Bacteria | 1277 |
| 293 | Ga0157379_10457255 | 3300014968 | Bacteria | 1179 |
| 294 | Ga0157379_10634312 | 3300014968 | Unclassified | 999 |
| 295 | Ga0157376_10000006 | 3300014969 | Bacteria | 368549 |
| 296 | Ga0157376_10227683 | 3300014969 | Unclassified | 1730 |
| 297 | Ga0157376_10404916 | 3300014969 | Unclassified | 1320 |
| 298 | Ga0157376_10426217 | 3300014969 | Bacteria | 1288 |
| 299 | Ga0157376_10900718 | 3300014969 | Bacteria | 903 |
| 300 | Ga0157376_11139343 | 3300014969 | Bacteria | 807 |
| 301 | Ga0163161_10003469 | 3300017792 | Bacteria | 11049 |
| 302 | Ga0163161_10655606 | 3300017792 | Bacteria | 870 |
| 303 | Ga0206350_10676508 | 3300020080 | Unclassified | 574 |
| 304 | Ga0213872_10131334 | 3300021361 | Unclassified | 1103 |
| 305 | Ga0213872_10212946 | 3300021361 | Unclassified | 825 |
| 306 | Ga0213872_10432780 | 3300021361 | Unclassified | 530 |
| 307 | Ga0213871_10119803 | 3300021441 | Bacteria | 784 |
| 308 | Ga0207666_1013868 | 3300025271 | Bacteria | 1134 |
| 309 | Ga0207697_10163975 | 3300025315 | Unclassified | 970 |
| 310 | Ga0207656_10524668 | 3300025321 | Bacteria | 602 |
| 311 | Ga0207653_10030087 | 3300025885 | Bacteria | 1751 |
| 312 | Ga0207682_10086507 | 3300025893 | Bacteria | 1352 |
| 313 | Ga0207642_10325624 | 3300025899 | Bacteria | 899 |
| 314 | Ga0207642_10529486 | 3300025899 | Unclassified | 725 |
| 315 | Ga0207642_10558153 | 3300025899 | Bacteria | 708 |
| 316 | Ga0207710_10002045 | 3300025900 | Bacteria | 9583 |
| 317 | Ga0207710_10029486 | 3300025900 | Bacteria | 2388 |
| 318 | Ga0207688_10018235 | 3300025901 | Bacteria | 3821 |
| 319 | Ga0207688_10037933 | 3300025901 | Bacteria | 2674 |
| 320 | Ga0207688_10477918 | 3300025901 | Bacteria | 779 |
| 321 | Ga0207680_10333288 | 3300025903 | Bacteria | 1063 |
| 322 | Ga0207647_10190651 | 3300025904 | Unclassified | 1188 |
| 323 | Ga0207699_10413225 | 3300025906 | Bacteria | 963 |
| 324 | Ga0207645_10005026 | 3300025907 | Bacteria | 9690 |
| 325 | Ga0207645_10065785 | 3300025907 | Bacteria | 2317 |
| 326 | Ga0207645_10135881 | 3300025907 | Bacteria | 1601 |
| 327 | Ga0207643_10111670 | 3300025908 | Bacteria | 1611 |
| 328 | Ga0207684_10000312 | 3300025910 | Bacteria | 68977 |
| 329 | Ga0207684_10080379 | 3300025910 | Bacteria | 2773 |
| 330 | Ga0207684_10133471 | 3300025910 | Unclassified | 2131 |
| 331 | Ga0207684_10352001 | 3300025910 | Bacteria | 1268 |
| 332 | Ga0207654_10518770 | 3300025911 | Bacteria | 843 |
| 333 | Ga0207671_10146994 | 3300025914 | Unclassified | 1819 |
| 334 | Ga0207671_10430405 | 3300025914 | Bacteria | 1050 |
| 335 | Ga0207693_10028023 | 3300025915 | Bacteria | 4452 |
| 336 | Ga0207662_10263518 | 3300025918 | Bacteria | 1135 |
| 337 | Ga0207662_10486974 | 3300025918 | Bacteria | 848 |
| 338 | Ga0207652_10128962 | 3300025921 | Bacteria | 2255 |
| 339 | Ga0207646_10019484 | 3300025922 | Archaea | 6305 |
| 340 | Ga0207646_10034164 | 3300025922 | Bacteria | 4596 |
| 341 | Ga0207646_10078224 | 3300025922 | Archaea | 2956 |
| 342 | Ga0207646_10079498 | 3300025922 | Unclassified | 2932 |
| 343 | Ga0207646_10574687 | 3300025922 | Bacteria | 1012 |
| 344 | Ga0207681_10011395 | 3300025923 | Bacteria | 5464 |
| 345 | Ga0207681_10209415 | 3300025923 | Unclassified | 1502 |
| 346 | Ga0207681_10388212 | 3300025923 | Bacteria | 1125 |
| 347 | Ga0207681_10742380 | 3300025923 | Bacteria | 818 |
| 348 | Ga0207681_11350182 | 3300025923 | Unclassified | 598 |
| 349 | Ga0207681_11622475 | 3300025923 | Bacteria | 541 |
| 350 | Ga0207694_10497689 | 3300025924 | Bacteria | 1020 |
| 351 | Ga0207694_10549947 | 3300025924 | Unclassified | 969 |
| 352 | Ga0207650_10000067 | 3300025925 | Bacteria | 140196 |
| 353 | Ga0207650_10000103 | 3300025925 | Bacteria | 111316 |
| 354 | Ga0207650_10006716 | 3300025925 | Bacteria | 7845 |
| 355 | Ga0207650_10015003 | 3300025925 | Bacteria | 5389 |
| 356 | Ga0207650_10120620 | 3300025925 | Unclassified | 2041 |
| 357 | Ga0207650_10503493 | 3300025925 | Bacteria | 1012 |
| 358 | Ga0207659_10068554 | 3300025926 | Bacteria | 2580 |
| 359 | Ga0207659_10083627 | 3300025926 | Bacteria | 2366 |
| 360 | Ga0207659_10348047 | 3300025926 | Bacteria | 1229 |
| 361 | Ga0207659_10390551 | 3300025926 | Bacteria | 1162 |
| 362 | Ga0207659_11526563 | 3300025926 | Bacteria | 571 |
| 363 | Ga0207687_10128182 | 3300025927 | Bacteria | 1908 |
| 364 | Ga0207687_10143218 | 3300025927 | Bacteria | 1816 |
| 365 | Ga0207687_11499587 | 3300025927 | Bacteria | 579 |
| 366 | Ga0207644_10323117 | 3300025931 | Bacteria | 1248 |
| 367 | Ga0207644_10355837 | 3300025931 | Bacteria | 1190 |
| 368 | Ga0207690_10148341 | 3300025932 | Bacteria | 1736 |
| 369 | Ga0207706_10479861 | 3300025933 | Bacteria | 1074 |
| 370 | Ga0207706_10722503 | 3300025933 | Bacteria | 850 |
| 371 | Ga0207686_10108384 | 3300025934 | Bacteria | 1868 |
| 372 | Ga0207686_10237658 | 3300025934 | Bacteria | 1324 |
| 373 | Ga0207686_10271122 | 3300025934 | Unclassified | 1248 |
| 374 | Ga0207709_10019408 | 3300025935 | Bacteria | 3822 |
| 375 | Ga0207709_10191138 | 3300025935 | Bacteria | 1454 |
| 376 | Ga0207709_10979494 | 3300025935 | Bacteria | 690 |
| 377 | Ga0207670_10047558 | 3300025936 | Bacteria | 2858 |
| 378 | Ga0207670_10199170 | 3300025936 | Bacteria | 1520 |
| 379 | Ga0207669_10030208 | 3300025937 | Bacteria | 3008 |
| 380 | Ga0207669_10069304 | 3300025937 | Bacteria | 2206 |
| 381 | Ga0207669_10261068 | 3300025937 | Bacteria | 1295 |
| 382 | Ga0207669_11013689 | 3300025937 | Unclassified | 698 |
| 383 | Ga0207704_10011319 | 3300025938 | Bacteria | 4387 |
| 384 | Ga0207704_10034219 | 3300025938 | Bacteria | 2897 |
| 385 | Ga0207704_10072914 | 3300025938 | Bacteria | 2185 |
| 386 | Ga0207704_10233189 | 3300025938 | Bacteria | 1370 |
| 387 | Ga0207704_10330907 | 3300025938 | Bacteria | 1179 |
| 388 | Ga0207665_10021847 | 3300025939 | Bacteria | 4208 |
| 389 | Ga0207665_10041424 | 3300025939 | Bacteria | 3075 |
| 390 | Ga0207691_10007479 | 3300025940 | Bacteria | 10518 |
| 391 | Ga0207691_10125850 | 3300025940 | Bacteria | 2268 |
| 392 | Ga0207711_10327928 | 3300025941 | Bacteria | 1415 |
| 393 | Ga0207711_10526478 | 3300025941 | Bacteria | 1102 |
| 394 | Ga0207711_11173436 | 3300025941 | Bacteria | 709 |
| 395 | Ga0207689_10999873 | 3300025942 | Bacteria | 705 |
| 396 | Ga0207661_10109710 | 3300025944 | Bacteria | 2331 |
| 397 | Ga0207679_10188165 | 3300025945 | Bacteria | 1714 |
| 398 | Ga0207651_10043046 | 3300025960 | Bacteria | 3011 |
| 399 | Ga0207651_10194795 | 3300025960 | Unclassified | 1619 |
| 400 | Ga0207651_10314678 | 3300025960 | Bacteria | 1307 |
| 401 | Ga0207651_10384322 | 3300025960 | Bacteria | 1190 |
| 402 | Ga0207651_10584314 | 3300025960 | Bacteria | 975 |
| 403 | Ga0207712_10073452 | 3300025961 | Bacteria | 2467 |
| 404 | Ga0207712_11961938 | 3300025961 | Bacteria | 524 |
| 405 | Ga0207668_10244302 | 3300025972 | Unclassified | 1454 |
| 406 | Ga0207668_10267487 | 3300025972 | Bacteria | 1396 |
| 407 | Ga0207640_10007968 | 3300025981 | Bacteria | 5851 |
| 408 | Ga0207640_10019319 | 3300025981 | Unclassified | 4023 |
| 409 | Ga0207640_10350171 | 3300025981 | Bacteria | 1186 |
| 410 | Ga0207677_10000133 | 3300026023 | Bacteria | 61065 |
| 411 | Ga0207703_10083922 | 3300026035 | Bacteria | 2663 |
| 412 | Ga0207703_10917590 | 3300026035 | Bacteria | 839 |
| 413 | Ga0207678_10201190 | 3300026067 | Bacteria | 1703 |
| 414 | Ga0207678_10898447 | 3300026067 | Bacteria | 783 |
| 415 | Ga0207708_10006686 | 3300026075 | Bacteria | 8528 |
| 416 | Ga0207708_10007652 | 3300026075 | Bacteria | 7994 |
| 417 | Ga0207708_10013419 | 3300026075 | Bacteria | 6124 |
| 418 | Ga0207702_10039109 | 3300026078 | Bacteria | 3973 |
| 419 | Ga0207702_10357580 | 3300026078 | Bacteria | 1399 |
| 420 | Ga0207641_10934651 | 3300026088 | Bacteria | 862 |
| 421 | Ga0207648_10051776 | 3300026089 | Bacteria | 3589 |
| 422 | Ga0207648_10092720 | 3300026089 | Bacteria | 2641 |
| 423 | Ga0207648_10331115 | 3300026089 | Bacteria | 1370 |
| 424 | Ga0207648_11377492 | 3300026089 | Bacteria | 663 |
| 425 | Ga0207676_10109275 | 3300026095 | Bacteria | 2310 |
| 426 | Ga0207676_10179075 | 3300026095 | Bacteria | 1855 |
| 427 | Ga0207674_10215514 | 3300026116 | Bacteria | 1868 |
| 428 | Ga0207674_10794427 | 3300026116 | Unclassified | 913 |
| 429 | Ga0207674_11843915 | 3300026116 | Bacteria | 571 |
| 430 | Ga0207675_100072115 | 3300026118 | Bacteria | 3230 |
| 431 | Ga0207675_101046825 | 3300026118 | Bacteria | 835 |
| 432 | Ga0207683_10006229 | 3300026121 | Bacteria | 10227 |
| 433 | Ga0207683_10020589 | 3300026121 | Bacteria | 5645 |
| 434 | Ga0207683_10059685 | 3300026121 | Bacteria | 3350 |
| 435 | Ga0207698_10734104 | 3300026142 | Bacteria | 985 |
| 436 | Ga0207698_11832572 | 3300026142 | Bacteria | 622 |
| 437 | Ga0209588_1000238 | 3300027671 | Archaea | 14657 |
| 438 | Ga0209588_1047006 | 3300027671 | Archaea | 1396 |
| 439 | Ga0207428_10009852 | 3300027907 | Bacteria | 8558 |
| 440 | Ga0268266_10402154 | 3300028379 | Bacteria | 1295 |
| 441 | Ga0268266_10456364 | 3300028379 | Bacteria | 1215 |
| 442 | Ga0268265_10144917 | 3300028380 | Bacteria | 1994 |
| 443 | Ga0268265_10554095 | 3300028380 | Bacteria | 1092 |
| 444 | Ga0268264_10403726 | 3300028381 | Bacteria | 1314 |
| 445 | Ga0268264_10416415 | 3300028381 | Bacteria | 1295 |
| 446 | Ga0268264_10804358 | 3300028381 | Unclassified | 939 |
| 447 | Ga0268264_12282400 | 3300028381 | Bacteria | 548 |
| 448 | Ga0265338_10115093 | 3300028800 | Bacteria | 2157 |
| 449 | Ga0307413_10035146 | 3300031824 | Bacteria | 2872 |
| 450 | Ga0307410_10858678 | 3300031852 | Bacteria | 775 |
| 451 | Ga0307410_10906010 | 3300031852 | Bacteria | 756 |
| 452 | Ga0307406_10117138 | 3300031901 | Bacteria | 1845 |
| 453 | Ga0307406_10554176 | 3300031901 | Unclassified | 941 |
| 454 | Ga0307407_10624064 | 3300031903 | Bacteria | 805 |
| 455 | Ga0307407_10948285 | 3300031903 | Unclassified | 662 |
| 456 | Ga0307412_10024972 | 3300031911 | Bacteria | 3695 |
| 457 | Ga0307412_10767293 | 3300031911 | Bacteria | 834 |
| 458 | Ga0307409_100177819 | 3300031995 | Bacteria | 1880 |
| 459 | Ga0307416_100097459 | 3300032002 | Bacteria | 2546 |
| 460 | Ga0307414_11274225 | 3300032004 | Bacteria | 681 |
| 461 | Ga0307411_10066794 | 3300032005 | Bacteria | 2417 |
| 462 | Ga0307415_100039511 | 3300032126 | Bacteria | 3119 |
| 463 | Ga0307415_100474814 | 3300032126 | Unclassified | 1087 |
| 464 | Ga0373944_0069616 | 3300035089 | Bacteria | 1144 |
| 465 | Ga0373944_0428100 | 3300035089 | Unclassified | 513 |
| 466 | Ga0373942_0017351 | 3300035207 | Bacteria | 1774 |
| 467 | Ga0373935_0099233 | 3300035692 | Unclassified | 1917 |
| 468 | Ga0373927_0957599 | 3300035695 | Unclassified | 565 |
| 469 | Ga0373937_0370826 | 3300036401 | Unclassified | 1357 |
| 470 | Ga0395899_0191732 | 3300037312 | Bacteria | 1430 |
| 471 | Ga0395900_0011556 | 3300037418 | Bacteria | 9034 |
| 472 | Ga0395898_0093106 | 3300037466 | Bacteria | 2897 |
| 473 | Ga0395905_0994154 | 3300037471 | Bacteria | 742 |
| 474 | Ga0436364_1249034 | 3300037853 | Unclassified | 1018 |
| 475 | Ga0395901_0025777 | 3300038443 | Bacteria | 6036 |
| 476 | Ga0395901_0113940 | 3300038443 | Bacteria | 2840 |
| 477 | Ga0395901_1401387 | 3300038443 | Bacteria | 657 |
| 478 | Ga0242422_01099 | 3300038699 | Unclassified | 1843 |
| 479 | Ga0436360_0253035 | 3300039438 | Bacteria | 3451 |
| 480 | Ga0436360_1260888 | 3300039438 | Bacteria | 4219 |
| 481 | Ga0436360_1270538 | 3300039438 | Bacteria | 1554 |
| 482 | Ga0436361_0317298 | 3300039447 | Bacteria | 929 |
| 483 | Ga0436361_0550221 | 3300039447 | Bacteria | 4543 |
| 484 | Ga0436361_0649317 | 3300039447 | Unclassified | 2275 |
| 485 | Ga0436361_0810969 | 3300039447 | Bacteria | 2124 |
| 486 | Ga0436361_0892360 | 3300039447 | Bacteria | 4928 |
| 487 | Ga0436361_0938542 | 3300039447 | Bacteria | 2663 |
| 488 | Ga0436362_0442172 | 3300039453 | Unclassified | 1097 |
| 489 | Ga0436362_0993857 | 3300039453 | Bacteria | 2356 |
| 490 | Ga0451853_1239964 | 3300041512 | Bacteria | 913 |
| 491 | Ga0439448_0117958 | 3300042005 | Unclassified | 910 |
| 492 | Ga0451576_0076316 | 3300045051 | Unclassified | 3488 |
| 493 | Ga0451576_0185677 | 3300045051 | Bacteria | 2171 |
| 494 | Ga0495653_0522741 | 3300046463 | Bacteria | 737 |
| 495 | Ga0495584_0315418 | 3300046491 | Unclassified | 794 |
| 496 | Ga0495594_0666203 | 3300046499 | Unclassified | 589 |
| 497 | Ga0495608_0216353 | 3300046511 | Unclassified | 1203 |
| 498 | Ga0495665_0143798 | 3300046531 | Bacteria | 1246 |
| 499 | Ga0495635_0574628 | 3300046663 | Unclassified | 737 |
| 500 | Ga0495646_0635665 | 3300046680 | Unclassified | 540 |
| 501 | Ga0495647_0188540 | 3300046681 | Unclassified | 900 |
| 502 | Ga0495658_0212891 | 3300046683 | Unclassified | 1208 |
| 503 | Ga0495613_0867479 | 3300046689 | Unclassified | 586 |
| 504 | Ga0495600_0262385 | 3300046809 | Bacteria | 1097 |
| 505 | Ga0495674_0187942 | 3300047319 | Unclassified | 1718 |
| 506 | Ga0495680_0313824 | 3300047322 | Unclassified | 1098 |
| 507 | Ga0496100_0608762 | 3300048903 | Bacteria | 849 |
| 508 | Ga0496100_1091623 | 3300048903 | Bacteria | 629 |
| 509 | Ga0496101_0042375 | 3300048904 | Unclassified | 3249 |
| 510 | Ga0496101_0498539 | 3300048904 | Bacteria | 962 |
| 511 | Ga0496102_0196665 | 3300048905 | Bacteria | 1900 |
| 512 | Ga0496102_0329723 | 3300048905 | Bacteria | 1438 |
| 513 | Ga0496102_0358305 | 3300048905 | Bacteria | 1373 |
| 514 | Ga0496103_0213205 | 3300048906 | Bacteria | 1242 |
| 515 | Ga0496104_0002907 | 3300048907 | Bacteria | 14760 |
| 516 | Ga0496104_0017375 | 3300048907 | Bacteria | 6549 |
| 517 | Ga0496104_0384309 | 3300048907 | Unclassified | 1316 |
| 518 | Ga0496105_0120171 | 3300048908 | Bacteria | 2167 |
| 519 | Ga0496105_0219377 | 3300048908 | Unclassified | 1548 |
| 520 | Ga0496105_0256244 | 3300048908 | Bacteria | 1416 |
| 521 | Ga0496106_0039270 | 3300048909 | Bacteria | 3545 |
| 522 | Ga0496106_0349194 | 3300048909 | Bacteria | 1188 |
| 523 | Ga0496106_0694468 | 3300048909 | Unclassified | 811 |
| 524 | Ga0496107_0142941 | 3300048910 | Bacteria | 1769 |
| 525 | Ga0496107_0164442 | 3300048910 | Bacteria | 1645 |
| 526 | Ga0496107_0876585 | 3300048910 | Bacteria | 655 |
| 527 | Ga0496108_0010864 | 3300048911 | Bacteria | 7392 |
| 528 | Ga0496108_0017366 | 3300048911 | Bacteria | 5887 |
| 529 | Ga0496108_0059111 | 3300048911 | Bacteria | 3224 |
| 530 | Ga0496108_0148234 | 3300048911 | Bacteria | 2024 |
| 531 | Ga0496108_1154686 | 3300048911 | Bacteria | 656 |
| 532 | Ga0496109_0004820 | 3300048912 | Bacteria | 11261 |
| 533 | Ga0496109_0166418 | 3300048912 | Bacteria | 2067 |
| 534 | Ga0496109_0563265 | 3300048912 | Unclassified | 1075 |
| 535 | Ga0496109_1032605 | 3300048912 | Unclassified | 759 |
| 536 | Ga0496109_1231207 | 3300048912 | Unclassified | 685 |
| 537 | Ga0496109_1688467 | 3300048912 | Bacteria | 567 |
| 538 | Ga0496109_2042789 | 3300048912 | Bacteria | 505 |
| 539 | Ga0496110_0031719 | 3300048913 | Bacteria | 4561 |
| 540 | Ga0496110_0210157 | 3300048913 | Bacteria | 1769 |
| 541 | Ga0496111_0238681 | 3300048914 | Bacteria | 1350 |
| 542 | Ga0496111_0247296 | 3300048914 | Bacteria | 1324 |
| 543 | Ga0496111_0459633 | 3300048914 | Bacteria | 939 |
| 544 | Ga0496112_0006980 | 3300048915 | Bacteria | 9969 |
| 545 | Ga0496112_0064157 | 3300048915 | Bacteria | 3624 |
| 546 | Ga0496112_0073850 | 3300048915 | Bacteria | 3371 |
| 547 | Ga0496112_0578529 | 3300048915 | Bacteria | 1056 |
| 548 | Ga0496112_0823680 | 3300048915 | Unclassified | 852 |
| 549 | Ga0496113_0016065 | 3300048916 | Bacteria | 5165 |
| 550 | Ga0496113_0181019 | 3300048916 | Bacteria | 1671 |
| 551 | Ga0496113_0388694 | 3300048916 | Bacteria | 1120 |
| 552 | Ga0496113_0643922 | 3300048916 | Unclassified | 848 |
| 553 | Ga0496114_0006946 | 3300048917 | Bacteria | 8917 |
| 554 | Ga0496114_0027544 | 3300048917 | Bacteria | 4656 |
| 555 | Ga0496114_0045450 | 3300048917 | Bacteria | 3648 |
| 556 | Ga0496114_0247522 | 3300048917 | Bacteria | 1568 |
| 557 | Ga0496115_0009463 | 3300048918 | Bacteria | 7238 |
| 558 | Ga0496115_0399072 | 3300048918 | Bacteria | 1116 |
| 559 | Ga0501299_003046 | 3300049522 | Bacteria | 2391 |
| 560 | Ga0501318_040946 | 3300049534 | Unclassified | 662 |
| 561 | Ga0501032_0002549 | 3300049569 | Bacteria | 14258 |
| 562 | Ga0501032_0432062 | 3300049569 | Bacteria | 844 |
| 563 | Ga0501034_0000096 | 3300049571 | Bacteria | 161155 |
| 564 | Ga0501034_0005171 | 3300049571 | Bacteria | 14311 |
| 565 | Ga0501036_0003288 | 3300049572 | Bacteria | 12889 |
| 566 | Ga0501036_0017391 | 3300049572 | Bacteria | 6011 |
| 567 | Ga0501037_0294212 | 3300049573 | Bacteria | 1129 |
| 568 | Ga0501038_0002622 | 3300049574 | Bacteria | 16807 |
| 569 | Ga0501038_0049975 | 3300049574 | Bacteria | 3613 |
| 570 | Ga0501038_0427269 | 3300049574 | Bacteria | 1021 |
| 571 | Ga0501039_0003272 | 3300049575 | Bacteria | 12110 |
| 572 | Ga0501040_0001492 | 3300049576 | Bacteria | 14846 |
| 573 | Ga0501040_0056405 | 3300049576 | Bacteria | 2696 |
| 574 | Ga0501041_0004752 | 3300049577 | Bacteria | 7883 |
| 575 | Ga0501041_0015708 | 3300049577 | Bacteria | 4496 |
| 576 | Ga0501041_0452402 | 3300049577 | Bacteria | 815 |
| 577 | Ga0501042_0000116 | 3300049578 | Bacteria | 33871 |
| 578 | Ga0501042_0018587 | 3300049578 | Bacteria | 4814 |
| 579 | Ga0501042_1197302 | 3300049578 | Bacteria | 554 |
| 580 | Ga0501043_0014740 | 3300049579 | Bacteria | 6120 |
| 581 | Ga0501043_0046599 | 3300049579 | Bacteria | 3409 |
| 582 | Ga0501046_0001229 | 3300049580 | Bacteria | 24836 |
| 583 | Ga0501046_0003365 | 3300049580 | Bacteria | 14690 |
| 584 | Ga0501046_0036243 | 3300049580 | Bacteria | 3971 |
| 585 | Ga0501047_0000008 | 3300049581 | Bacteria | 441758 |
| 586 | Ga0501048_0001070 | 3300049582 | Bacteria | 20523 |
| 587 | Ga0501048_0001118 | 3300049582 | Bacteria | 20134 |
| 588 | Ga0501048_0071263 | 3300049582 | Bacteria | 2453 |
| 589 | Ga0501067_0009814 | 3300049583 | Bacteria | 5299 |
| 590 | Ga0501067_0022554 | 3300049583 | Bacteria | 3484 |
| 591 | Ga0501067_0181840 | 3300049583 | Unclassified | 1171 |
| 592 | Ga0501068_0047850 | 3300049584 | Bacteria | 2580 |
| 593 | Ga0501068_1150993 | 3300049584 | Bacteria | 513 |
| 594 | Ga0501069_0002263 | 3300049585 | Bacteria | 9718 |
| 595 | Ga0501070_0002869 | 3300049586 | Bacteria | 15012 |
| 596 | Ga0501070_0011220 | 3300049586 | Bacteria | 7565 |
| 597 | Ga0501071_0002369 | 3300049587 | Bacteria | 11409 |
| 598 | Ga0501071_0030557 | 3300049587 | Bacteria | 3811 |
| 599 | Ga0501071_0214844 | 3300049587 | Bacteria | 1447 |
| 600 | Ga0501072_0000153 | 3300049588 | Bacteria | 51166 |
| 601 | Ga0501072_0003182 | 3300049588 | Bacteria | 12348 |
| 602 | Ga0501072_0307862 | 3300049588 | Bacteria | 1259 |
| 603 | Ga0501073_0007388 | 3300049589 | Bacteria | 8169 |
| 604 | Ga0501073_0022856 | 3300049589 | Bacteria | 4497 |
| 605 | Ga0501074_0001110 | 3300049590 | Bacteria | 17548 |
| 606 | Ga0501074_0002631 | 3300049590 | Bacteria | 12571 |
| 607 | Ga0501074_0023368 | 3300049590 | Bacteria | 4495 |
| 608 | Ga0501075_0001696 | 3300049591 | Bacteria | 14485 |
| 609 | Ga0501076_0008270 | 3300049592 | Bacteria | 7622 |
| 610 | Ga0501076_0047792 | 3300049592 | Bacteria | 3383 |
| 611 | Ga0501077_0000711 | 3300049593 | Bacteria | 20088 |
| 612 | Ga0501077_0037687 | 3300049593 | Bacteria | 3078 |
| 613 | Ga0501077_0154574 | 3300049593 | Bacteria | 1456 |
| 614 | Ga0501224_055617 | 3300049664 | Unclassified | 612 |
| 615 | Ga0501235_036898 | 3300049669 | Bacteria | 1112 |
| 616 | Ga0501221_038899 | 3300049704 | Unclassified | 1029 |
| 617 | Ga0501225_0181055 | 3300049705 | Unclassified | 659 |
| 618 | Ga0501234_005810 | 3300049707 | Viruses | 1928 |
| 619 | Ga0501079_0000084 | 3300049741 | Bacteria | 44872 |
| 620 | Ga0501079_0000221 | 3300049741 | Bacteria | 33871 |
| 621 | Ga0501079_0043637 | 3300049741 | Bacteria | 3461 |
| 622 | Ga0501079_0278575 | 3300049741 | Bacteria | 1308 |
| 623 | Ga0501079_0539601 | 3300049741 | Bacteria | 917 |
| 624 | Ga0501080_0002637 | 3300049742 | Bacteria | 15700 |
| 625 | Ga0501080_0024552 | 3300049742 | Bacteria | 5588 |
| 626 | Ga0501081_0000284 | 3300049743 | Bacteria | 26831 |
| 627 | Ga0501081_0017319 | 3300049743 | Bacteria | 4767 |
| 628 | Ga0501083_0006749 | 3300049744 | Bacteria | 8145 |
| 629 | Ga0501083_0041386 | 3300049744 | Bacteria | 3125 |
| 630 | Ga0501083_0058600 | 3300049744 | Bacteria | 2576 |
| 631 | Ga0501083_0300263 | 3300049744 | Bacteria | 1044 |
| 632 | Ga0501268_055212 | 3300049765 | Unclassified | 777 |
| 633 | Ga0501270_014917 | 3300049767 | Unclassified | 1102 |
| 634 | Ga0501283_013278 | 3300049779 | Bacteria | 1246 |
| 635 | Ga0501035_0032783 | 3300049822 | Bacteria | 4724 |
| 636 | Ga0501035_1002459 | 3300049822 | Bacteria | 657 |
| 637 | Ga0501044_0045490 | 3300049823 | Bacteria | 4546 |
| 638 | Ga0501045_0000729 | 3300049824 | Bacteria | 20961 |
| 639 | Ga0501045_0028445 | 3300049824 | Bacteria | 4032 |
| 640 | Ga0501045_0600822 | 3300049824 | Unclassified | 815 |
| 641 | nmdc:mga05p37_1036991_c1 | 3300050507 | Unclassified | 867 |
| 642 | nmdc:mga05p37_2275938_c1 | 3300050507 | Unclassified | 500 |
| 643 | nmdc:mga05p37_323935_c1 | 3300050507 | Unclassified | 1823 |
| 644 | nmdc:mga05p37_75706_c1 | 3300050507 | Bacteria | 4143 |
| 645 | nmdc:mga05p37_78549_c1 | 3300050507 | Bacteria | 4064 |
| 646 | nmdc:mga09592_1216049_c1 | 3300050508 | Bacteria | 622 |
| 647 | nmdc:mga09592_62030_c1 | 3300050508 | Bacteria | 3162 |
| 648 | nmdc:mga0qj67_302611_c1 | 3300050509 | Bacteria | 1295 |
| 649 | nmdc:mga06r32_691657_c1 | 3300050510 | Bacteria | 986 |
| 650 | nmdc:mga08y16_19023_c1 | 3300050511 | Bacteria | 7234 |
| 651 | nmdc:mga08y16_472940_c1 | 3300050511 | Unclassified | 1276 |
| 652 | nmdc:mga0rr50_1060058_c1 | 3300050513 | Bacteria | 690 |
| 653 | nmdc:mga0rr50_74809_c1 | 3300050513 | Bacteria | 2594 |
| 654 | nmdc:mga08x19_32336_c1 | 3300050514 | Bacteria | 3295 |
| 655 | nmdc:mga08x19_356378_c1 | 3300050514 | Bacteria | 1022 |
| 656 | nmdc:mga08x19_746418_c1 | 3300050514 | Bacteria | 695 |
| 657 | nmdc:mga08x19_93386_c1 | 3300050514 | Unclassified | 1988 |
| 658 | nmdc:mga0a205_16021_c1 | 3300050515 | Bacteria | 7016 |
| 659 | Ga0495601_0151470 | 3300053077 | Bacteria | 1514 |
| 660 | Ga0495612_0325431 | 3300053078 | Unclassified | 692 |
| 661 | Ga0501084_0000135 | 3300054114 | Bacteria | 56033 |
| 662 | Ga0501084_0003048 | 3300054114 | Bacteria | 13579 |
| 663 | Ga0501084_0068893 | 3300054114 | Bacteria | 2961 |
| 664 | Ga0501082_0001674 | 3300060353 | Bacteria | 19551 |
| 665 | Ga0501082_0003297 | 3300060353 | Bacteria | 14087 |
| 666 | Ga0501082_0039818 | 3300060353 | Bacteria | 4054 |
| 667 | Ga0530510_0002740 | 3300061734 | Bacteria | 12110 |
| 668 | Ga0530510_0036572 | 3300061734 | Bacteria | 3538 |
| 669 | Ga0530510_0308797 | 3300061734 | Bacteria | 1184 |
| 670 | Ga0530510_0947455 | 3300061734 | Bacteria | 658 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100015034 | Ga0070708_1000150344 | 111 |
| 2 | 3300005445 | Ga0070708_100184211 | Ga0070708_1001842112 | 111 |
| 3 | 3300005468 | Ga0070707_100083777 | Ga0070707_1000837774 | 111 |
| 4 | 3300007265 | Ga0099794_10071376 | Ga0099794_100713762 | 111 |
| 5 | 3300025922 | Ga0207646_10019484 | Ga0207646_100194842 | 111 |
| 6 | 3300005468 | Ga0070707_100000030 | Ga0070707_10000003081 | 122 |
| 7 | 3300005468 | Ga0070707_100367042 | Ga0070707_1003670422 | 122 |
| 8 | 3300005536 | Ga0070697_100130966 | Ga0070697_1001309663 | 122 |
| 9 | 3300007265 | Ga0099794_10003801 | Ga0099794_100038012 | 122 |
| 10 | 3300007265 | Ga0099794_10045626 | Ga0099794_100456263 | 122 |
| 11 | 3300007265 | Ga0099794_10548685 | Ga0099794_105486851 | 122 |
| 12 | 3300025922 | Ga0207646_10078224 | Ga0207646_100782242 | 122 |
| 13 | 3300025922 | Ga0207646_10079498 | Ga0207646_100794982 | 122 |
| 14 | 3300027671 | Ga0209588_1000238 | Ga0209588_10002383 | 122 |
| 15 | 3300027671 | Ga0209588_1047006 | Ga0209588_10470061 | 122 |
| 16 | 3300013308 | Ga0157375_10623568 | Ga0157375_106235682 | 123 |
| 17 | 3300005331 | Ga0070670_100000040 | Ga0070670_100000040125 | 124 |
| 18 | 3300005434 | Ga0070709_10248779 | Ga0070709_102487792 | 124 |
| 19 | 3300005440 | Ga0070705_100029428 | Ga0070705_1000294284 | 124 |
| 20 | 3300005445 | Ga0070708_100005220 | Ga0070708_1000052205 | 124 |
| 21 | 3300005458 | Ga0070681_10364398 | Ga0070681_103643982 | 124 |
| 22 | 3300005467 | Ga0070706_100021405 | Ga0070706_1000214055 | 124 |
| 23 | 3300005518 | Ga0070699_100372459 | Ga0070699_1003724592 | 124 |
| 24 | 3300005535 | Ga0070684_100171712 | Ga0070684_1001717122 | 124 |
| 25 | 3300005578 | Ga0068854_100005336 | Ga0068854_1000053362 | 124 |
| 26 | 3300005578 | Ga0068854_100024287 | Ga0068854_1000242871 | 124 |
| 27 | 3300006173 | Ga0070716_100151662 | Ga0070716_1001516622 | 124 |
| 28 | 3300006358 | Ga0068871_100095394 | Ga0068871_1000953943 | 124 |
| 29 | 3300013296 | Ga0157374_10000021 | Ga0157374_1000002120 | 124 |
| 30 | 3300014745 | Ga0157377_10000023 | Ga0157377_1000002319 | 124 |
| 31 | 3300014969 | Ga0157376_10000006 | Ga0157376_10000006125 | 124 |
| 32 | 3300025906 | Ga0207699_10413225 | Ga0207699_104132252 | 124 |
| 33 | 3300025910 | Ga0207684_10080379 | Ga0207684_100803795 | 124 |
| 34 | 3300025915 | Ga0207693_10028023 | Ga0207693_100280237 | 124 |
| 35 | 3300025922 | Ga0207646_10034164 | Ga0207646_100341644 | 124 |
| 36 | 3300025925 | Ga0207650_10000067 | Ga0207650_1000006769 | 124 |
| 37 | 3300025939 | Ga0207665_10041424 | Ga0207665_100414242 | 124 |
| 38 | 3300025981 | Ga0207640_10019319 | Ga0207640_100193192 | 124 |
| 39 | 3300025981 | Ga0207640_10350171 | Ga0207640_103501711 | 124 |
| 40 | 3300026023 | Ga0207677_10000133 | Ga0207677_100001332 | 124 |
| 41 | 3300031852 | Ga0307410_10858678 | Ga0307410_108586781 | 124 |
| 42 | 3300032004 | Ga0307414_11274225 | Ga0307414_112742251 | 124 |
| 43 | 3300035089 | Ga0373944_0069616 | Ga0373944_0069616_293_673 | 124 |
| 44 | 3300050514 | nmdc:mga08x19_356378_c1 | nmdc:mga08x19_356378_c1_345_722 | 124 |
| 45 | 2162886011 | MRS1b_contig_551986 | MRS1b_0010.00001620 | 125 |
| 46 | 3300000549 | LJQas_1000046 | LJQas_10000464 | 125 |
| 47 | 3300002459 | JGI24751J29686_10039302 | JGI24751J29686_100393022 | 125 |
| 48 | 3300002459 | JGI24751J29686_10083194 | JGI24751J29686_100831941 | 125 |
| 49 | 3300003203 | JGI25406J46586_10017975 | JGI25406J46586_100179753 | 125 |
| 50 | 3300003203 | JGI25406J46586_10101567 | JGI25406J46586_101015671 | 125 |
| 51 | 3300005290 | Ga0065712_10000329 | Ga0065712_1000032912 | 125 |
| 52 | 3300005290 | Ga0065712_10004655 | Ga0065712_100046556 | 125 |
| 53 | 3300005293 | Ga0065715_10001890 | Ga0065715_100018906 | 125 |
| 54 | 3300005293 | Ga0065715_10126324 | Ga0065715_101263243 | 125 |
| 55 | 3300005293 | Ga0065715_10181738 | Ga0065715_101817383 | 125 |
| 56 | 3300005295 | Ga0065707_10166691 | Ga0065707_101666912 | 125 |
| 57 | 3300005295 | Ga0065707_10383896 | Ga0065707_103838962 | 125 |
| 58 | 3300005328 | Ga0070676_10007361 | Ga0070676_100073613 | 125 |
| 59 | 3300005328 | Ga0070676_10103048 | Ga0070676_101030482 | 125 |
| 60 | 3300005328 | Ga0070676_10595593 | Ga0070676_105955932 | 125 |
| 61 | 3300005329 | Ga0070683_101354420 | Ga0070683_1013544202 | 125 |
| 62 | 3300005330 | Ga0070690_100307618 | Ga0070690_1003076182 | 125 |
| 63 | 3300005330 | Ga0070690_100773823 | Ga0070690_1007738231 | 125 |
| 64 | 3300005331 | Ga0070670_100000177 | Ga0070670_10000017712 | 125 |
| 65 | 3300005331 | Ga0070670_100002961 | Ga0070670_1000029615 | 125 |
| 66 | 3300005331 | Ga0070670_100008026 | Ga0070670_10000802610 | 125 |
| 67 | 3300005331 | Ga0070670_100075366 | Ga0070670_1000753662 | 125 |
| 68 | 3300005334 | Ga0068869_100710809 | Ga0068869_1007108092 | 125 |
| 69 | 3300005334 | Ga0068869_101943091 | Ga0068869_1019430911 | 125 |
| 70 | 3300005336 | Ga0070680_101371364 | Ga0070680_1013713641 | 125 |
| 71 | 3300005337 | Ga0070682_101666982 | Ga0070682_1016669821 | 125 |
| 72 | 3300005338 | Ga0068868_100179457 | Ga0068868_1001794573 | 125 |
| 73 | 3300005338 | Ga0068868_100433762 | Ga0068868_1004337622 | 125 |
| 74 | 3300005340 | Ga0070689_100056898 | Ga0070689_1000568982 | 125 |
| 75 | 3300005340 | Ga0070689_100231183 | Ga0070689_1002311833 | 125 |
| 76 | 3300005340 | Ga0070689_100808792 | Ga0070689_1008087921 | 125 |
| 77 | 3300005341 | Ga0070691_10003956 | Ga0070691_100039566 | 125 |
| 78 | 3300005341 | Ga0070691_10724514 | Ga0070691_107245141 | 125 |
| 79 | 3300005343 | Ga0070687_100492089 | Ga0070687_1004920891 | 125 |
| 80 | 3300005343 | Ga0070687_100760963 | Ga0070687_1007609632 | 125 |
| 81 | 3300005345 | Ga0070692_10276731 | Ga0070692_102767312 | 125 |
| 82 | 3300005345 | Ga0070692_10462046 | Ga0070692_104620462 | 125 |
| 83 | 3300005347 | Ga0070668_100015638 | Ga0070668_1000156387 | 125 |
| 84 | 3300005353 | Ga0070669_100051607 | Ga0070669_1000516072 | 125 |
| 85 | 3300005353 | Ga0070669_100211602 | Ga0070669_1002116022 | 125 |
| 86 | 3300005353 | Ga0070669_100385179 | Ga0070669_1003851792 | 125 |
| 87 | 3300005354 | Ga0070675_100049947 | Ga0070675_1000499473 | 125 |
| 88 | 3300005354 | Ga0070675_100085282 | Ga0070675_1000852823 | 125 |
| 89 | 3300005354 | Ga0070675_100486313 | Ga0070675_1004863131 | 125 |
| 90 | 3300005354 | Ga0070675_100554867 | Ga0070675_1005548672 | 125 |
| 91 | 3300005355 | Ga0070671_100033098 | Ga0070671_1000330983 | 125 |
| 92 | 3300005355 | Ga0070671_100224742 | Ga0070671_1002247422 | 125 |
| 93 | 3300005355 | Ga0070671_100809206 | Ga0070671_1008092062 | 125 |
| 94 | 3300005356 | Ga0070674_100002662 | Ga0070674_10000266210 | 125 |
| 95 | 3300005356 | Ga0070674_100005767 | Ga0070674_1000057672 | 125 |
| 96 | 3300005356 | Ga0070674_100075290 | Ga0070674_1000752903 | 125 |
| 97 | 3300005364 | Ga0070673_100163106 | Ga0070673_1001631064 | 125 |
| 98 | 3300005364 | Ga0070673_100168830 | Ga0070673_1001688303 | 125 |
| 99 | 3300005364 | Ga0070673_100425051 | Ga0070673_1004250512 | 125 |
| 100 | 3300005364 | Ga0070673_100609210 | Ga0070673_1006092102 | 125 |
| 101 | 3300005365 | Ga0070688_100008752 | Ga0070688_1000087524 | 125 |
| 102 | 3300005365 | Ga0070688_100010798 | Ga0070688_1000107982 | 125 |
| 103 | 3300005365 | Ga0070688_100459181 | Ga0070688_1004591813 | 125 |
| 104 | 3300005366 | Ga0070659_100088747 | Ga0070659_1000887472 | 125 |
| 105 | 3300005367 | Ga0070667_100316736 | Ga0070667_1003167363 | 125 |
| 106 | 3300005367 | Ga0070667_100398187 | Ga0070667_1003981873 | 125 |
| 107 | 3300005406 | Ga0070703_10048321 | Ga0070703_100483212 | 125 |
| 108 | 3300005438 | Ga0070701_10022642 | Ga0070701_100226422 | 125 |
| 109 | 3300005438 | Ga0070701_10151103 | Ga0070701_101511032 | 125 |
| 110 | 3300005440 | Ga0070705_100006397 | Ga0070705_1000063972 | 125 |
| 111 | 3300005440 | Ga0070705_100458119 | Ga0070705_1004581192 | 125 |
| 112 | 3300005441 | Ga0070700_100009994 | Ga0070700_1000099946 | 125 |
| 113 | 3300005441 | Ga0070700_100011679 | Ga0070700_1000116793 | 125 |
| 114 | 3300005441 | Ga0070700_100026025 | Ga0070700_1000260251 | 125 |
| 115 | 3300005441 | Ga0070700_100436678 | Ga0070700_1004366781 | 125 |
| 116 | 3300005441 | Ga0070700_100665313 | Ga0070700_1006653132 | 125 |
| 117 | 3300005444 | Ga0070694_100058835 | Ga0070694_1000588353 | 125 |
| 118 | 3300005444 | Ga0070694_100786013 | Ga0070694_1007860131 | 125 |
| 119 | 3300005445 | Ga0070708_101067551 | Ga0070708_1010675512 | 125 |
| 120 | 3300005456 | Ga0070678_100096650 | Ga0070678_1000966501 | 125 |
| 121 | 3300005456 | Ga0070678_100187374 | Ga0070678_1001873743 | 125 |
| 122 | 3300005457 | Ga0070662_100714127 | Ga0070662_1007141272 | 125 |
| 123 | 3300005459 | Ga0068867_100017807 | Ga0068867_1000178072 | 125 |
| 124 | 3300005459 | Ga0068867_100145891 | Ga0068867_1001458912 | 125 |
| 125 | 3300005459 | Ga0068867_100178754 | Ga0068867_1001787542 | 125 |
| 126 | 3300005459 | Ga0068867_100460233 | Ga0068867_1004602331 | 125 |
| 127 | 3300005459 | Ga0068867_100677151 | Ga0068867_1006771512 | 125 |
| 128 | 3300005459 | Ga0068867_101016165 | Ga0068867_1010161652 | 125 |
| 129 | 3300005466 | Ga0070685_10011459 | Ga0070685_100114594 | 125 |
| 130 | 3300005466 | Ga0070685_10024892 | Ga0070685_100248923 | 125 |
| 131 | 3300005466 | Ga0070685_10045911 | Ga0070685_100459112 | 125 |
| 132 | 3300005467 | Ga0070706_100000223 | Ga0070706_10000022335 | 125 |
| 133 | 3300005467 | Ga0070706_100061416 | Ga0070706_1000614162 | 125 |
| 134 | 3300005467 | Ga0070706_100338406 | Ga0070706_1003384062 | 125 |
| 135 | 3300005468 | Ga0070707_100244169 | Ga0070707_1002441692 | 125 |
| 136 | 3300005468 | Ga0070707_100413735 | Ga0070707_1004137353 | 125 |
| 137 | 3300005471 | Ga0070698_100004458 | Ga0070698_1000044583 | 125 |
| 138 | 3300005507 | Ga0074259_10176926 | Ga0074259_101769262 | 125 |
| 139 | 3300005518 | Ga0070699_100650597 | Ga0070699_1006505972 | 125 |
| 140 | 3300005518 | Ga0070699_101443933 | Ga0070699_1014439331 | 125 |
| 141 | 3300005535 | Ga0070684_100176135 | Ga0070684_1001761352 | 125 |
| 142 | 3300005535 | Ga0070684_100633334 | Ga0070684_1006333342 | 125 |
| 143 | 3300005535 | Ga0070684_100804320 | Ga0070684_1008043202 | 125 |
| 144 | 3300005536 | Ga0070697_100131712 | Ga0070697_1001317122 | 125 |
| 145 | 3300005536 | Ga0070697_101336689 | Ga0070697_1013366891 | 125 |
| 146 | 3300005539 | Ga0068853_100176180 | Ga0068853_1001761803 | 125 |
| 147 | 3300005539 | Ga0068853_101394995 | Ga0068853_1013949951 | 125 |
| 148 | 3300005543 | Ga0070672_100004106 | Ga0070672_1000041067 | 125 |
| 149 | 3300005543 | Ga0070672_100551720 | Ga0070672_1005517202 | 125 |
| 150 | 3300005543 | Ga0070672_100671494 | Ga0070672_1006714942 | 125 |
| 151 | 3300005543 | Ga0070672_101368958 | Ga0070672_1013689581 | 125 |
| 152 | 3300005544 | Ga0070686_100008839 | Ga0070686_1000088394 | 125 |
| 153 | 3300005544 | Ga0070686_100100640 | Ga0070686_1001006404 | 125 |
| 154 | 3300005544 | Ga0070686_100167064 | Ga0070686_1001670642 | 125 |
| 155 | 3300005545 | Ga0070695_100009270 | Ga0070695_1000092705 | 125 |
| 156 | 3300005545 | Ga0070695_100157247 | Ga0070695_1001572472 | 125 |
| 157 | 3300005546 | Ga0070696_100004210 | Ga0070696_1000042106 | 125 |
| 158 | 3300005546 | Ga0070696_100269509 | Ga0070696_1002695091 | 125 |
| 159 | 3300005548 | Ga0070665_100011544 | Ga0070665_10001154410 | 125 |
| 160 | 3300005548 | Ga0070665_100518880 | Ga0070665_1005188802 | 125 |
| 161 | 3300005549 | Ga0070704_100006282 | Ga0070704_1000062826 | 125 |
| 162 | 3300005549 | Ga0070704_100545869 | Ga0070704_1005458693 | 125 |
| 163 | 3300005549 | Ga0070704_100923341 | Ga0070704_1009233412 | 125 |
| 164 | 3300005563 | Ga0068855_100930783 | Ga0068855_1009307832 | 125 |
| 165 | 3300005563 | Ga0068855_101356614 | Ga0068855_1013566142 | 125 |
| 166 | 3300005564 | Ga0070664_100465160 | Ga0070664_1004651601 | 125 |
| 167 | 3300005578 | Ga0068854_100326574 | Ga0068854_1003265742 | 125 |
| 168 | 3300005578 | Ga0068854_100612274 | Ga0068854_1006122741 | 125 |
| 169 | 3300005578 | Ga0068854_100751779 | Ga0068854_1007517792 | 125 |
| 170 | 3300005614 | Ga0068856_100053873 | Ga0068856_1000538732 | 125 |
| 171 | 3300005614 | Ga0068856_100997029 | Ga0068856_1009970292 | 125 |
| 172 | 3300005615 | Ga0070702_100008040 | Ga0070702_1000080403 | 125 |
| 173 | 3300005615 | Ga0070702_100134791 | Ga0070702_1001347913 | 125 |
| 174 | 3300005616 | Ga0068852_100841993 | Ga0068852_1008419932 | 125 |
| 175 | 3300005616 | Ga0068852_102779818 | Ga0068852_1027798182 | 125 |
| 176 | 3300005617 | Ga0068859_100075274 | Ga0068859_1000752744 | 125 |
| 177 | 3300005617 | Ga0068859_100231920 | Ga0068859_1002319203 | 125 |
| 178 | 3300005617 | Ga0068859_100423725 | Ga0068859_1004237251 | 125 |
| 179 | 3300005617 | Ga0068859_102414827 | Ga0068859_1024148272 | 125 |
| 180 | 3300005618 | Ga0068864_100057981 | Ga0068864_1000579812 | 125 |
| 181 | 3300005618 | Ga0068864_100160576 | Ga0068864_1001605762 | 125 |
| 182 | 3300005718 | Ga0068866_10039141 | Ga0068866_100391412 | 125 |
| 183 | 3300005718 | Ga0068866_10111378 | Ga0068866_101113782 | 125 |
| 184 | 3300005718 | Ga0068866_10132054 | Ga0068866_101320542 | 125 |
| 185 | 3300005718 | Ga0068866_10179224 | Ga0068866_101792242 | 125 |
| 186 | 3300005718 | Ga0068866_10205655 | Ga0068866_102056552 | 125 |
| 187 | 3300005719 | Ga0068861_100306023 | Ga0068861_1003060232 | 125 |
| 188 | 3300005719 | Ga0068861_101245452 | Ga0068861_1012454522 | 125 |
| 189 | 3300005834 | Ga0068851_10993439 | Ga0068851_109934391 | 125 |
| 190 | 3300005840 | Ga0068870_10000685 | Ga0068870_100006853 | 125 |
| 191 | 3300005840 | Ga0068870_10166252 | Ga0068870_101662522 | 125 |
| 192 | 3300005840 | Ga0068870_10203436 | Ga0068870_102034362 | 125 |
| 193 | 3300005841 | Ga0068863_100043250 | Ga0068863_1000432505 | 125 |
| 194 | 3300005841 | Ga0068863_100048593 | Ga0068863_1000485933 | 125 |
| 195 | 3300005842 | Ga0068858_100548654 | Ga0068858_1005486542 | 125 |
| 196 | 3300005842 | Ga0068858_100604918 | Ga0068858_1006049182 | 125 |
| 197 | 3300005843 | Ga0068860_100151563 | Ga0068860_1001515633 | 125 |
| 198 | 3300005843 | Ga0068860_100847786 | Ga0068860_1008477861 | 125 |
| 199 | 3300005843 | Ga0068860_100950722 | Ga0068860_1009507222 | 125 |
| 200 | 3300005843 | Ga0068860_101168907 | Ga0068860_1011689071 | 125 |
| 201 | 3300005844 | Ga0068862_100244414 | Ga0068862_1002444142 | 125 |
| 202 | 3300005844 | Ga0068862_100874656 | Ga0068862_1008746561 | 125 |
| 203 | 3300005844 | Ga0068862_101138925 | Ga0068862_1011389252 | 125 |
| 204 | 3300005981 | Ga0081538_10052075 | Ga0081538_100520752 | 125 |
| 205 | 3300005985 | Ga0081539_10000041 | Ga0081539_10000041115 | 125 |
| 206 | 3300005985 | Ga0081539_10010708 | Ga0081539_100107085 | 125 |
| 207 | 3300006028 | Ga0070717_11659735 | Ga0070717_116597352 | 125 |
| 208 | 3300006173 | Ga0070716_100064759 | Ga0070716_1000647592 | 125 |
| 209 | 3300006173 | Ga0070716_101140262 | Ga0070716_1011402622 | 125 |
| 210 | 3300006175 | Ga0070712_100522929 | Ga0070712_1005229293 | 125 |
| 211 | 3300006237 | Ga0097621_100007602 | Ga0097621_1000076022 | 125 |
| 212 | 3300006237 | Ga0097621_100214551 | Ga0097621_1002145513 | 125 |
| 213 | 3300006237 | Ga0097621_100240940 | Ga0097621_1002409402 | 125 |
| 214 | 3300006358 | Ga0068871_100051751 | Ga0068871_1000517512 | 125 |
| 215 | 3300006358 | Ga0068871_101652148 | Ga0068871_1016521481 | 125 |
| 216 | 3300006358 | Ga0068871_101768044 | Ga0068871_1017680442 | 125 |
| 217 | 3300006844 | Ga0075428_100107143 | Ga0075428_1001071432 | 125 |
| 218 | 3300006846 | Ga0075430_100687286 | Ga0075430_1006872862 | 125 |
| 219 | 3300006847 | Ga0075431_100092902 | Ga0075431_1000929022 | 125 |
| 220 | 3300006871 | Ga0075434_100060885 | Ga0075434_1000608853 | 125 |
| 221 | 3300006881 | Ga0068865_100399369 | Ga0068865_1003993692 | 125 |
| 222 | 3300006881 | Ga0068865_100665003 | Ga0068865_1006650032 | 125 |
| 223 | 3300006881 | Ga0068865_100943391 | Ga0068865_1009433912 | 125 |
| 224 | 3300006914 | Ga0075436_100030397 | Ga0075436_1000303973 | 125 |
| 225 | 3300006914 | Ga0075436_100179751 | Ga0075436_1001797512 | 125 |
| 226 | 3300006914 | Ga0075436_100797866 | Ga0075436_1007978662 | 125 |
| 227 | 3300006931 | Ga0097620_100075280 | Ga0097620_1000752804 | 125 |
| 228 | 3300006931 | Ga0097620_100231937 | Ga0097620_1002319373 | 125 |
| 229 | 3300006931 | Ga0097620_100423749 | Ga0097620_1004237491 | 125 |
| 230 | 3300006931 | Ga0097620_102415603 | Ga0097620_1024156032 | 125 |
| 231 | 3300007076 | Ga0075435_100033994 | Ga0075435_1000339942 | 125 |
| 232 | 3300007076 | Ga0075435_100832320 | Ga0075435_1008323202 | 125 |
| 233 | 3300007076 | Ga0075435_101292226 | Ga0075435_1012922261 | 125 |
| 234 | 3300009093 | Ga0105240_10662715 | Ga0105240_106627152 | 125 |
| 235 | 3300009093 | Ga0105240_11205569 | Ga0105240_112055692 | 125 |
| 236 | 3300009093 | Ga0105240_11662143 | Ga0105240_116621432 | 125 |
| 237 | 3300009094 | Ga0111539_10024118 | Ga0111539_100241183 | 125 |
| 238 | 3300009094 | Ga0111539_10071959 | Ga0111539_100719594 | 125 |
| 239 | 3300009094 | Ga0111539_10275055 | Ga0111539_102750552 | 125 |
| 240 | 3300009098 | Ga0105245_10049106 | Ga0105245_100491063 | 125 |
| 241 | 3300009098 | Ga0105245_10085806 | Ga0105245_100858062 | 125 |
| 242 | 3300009098 | Ga0105245_10107876 | Ga0105245_101078762 | 125 |
| 243 | 3300009098 | Ga0105245_10156900 | Ga0105245_101569003 | 125 |
| 244 | 3300009098 | Ga0105245_10369223 | Ga0105245_103692233 | 125 |
| 245 | 3300009098 | Ga0105245_12283323 | Ga0105245_122833232 | 125 |
| 246 | 3300009101 | Ga0105247_10062295 | Ga0105247_100622952 | 125 |
| 247 | 3300009101 | Ga0105247_10065435 | Ga0105247_100654354 | 125 |
| 248 | 3300009101 | Ga0105247_10354561 | Ga0105247_103545611 | 125 |
| 249 | 3300009101 | Ga0105247_10548011 | Ga0105247_105480112 | 125 |
| 250 | 3300009147 | Ga0114129_10032907 | Ga0114129_1003290710 | 125 |
| 251 | 3300009147 | Ga0114129_10662521 | Ga0114129_106625212 | 125 |
| 252 | 3300009147 | Ga0114129_12040153 | Ga0114129_120401532 | 125 |
| 253 | 3300009147 | Ga0114129_13401282 | Ga0114129_134012822 | 125 |
| 254 | 3300009148 | Ga0105243_10048809 | Ga0105243_100488092 | 125 |
| 255 | 3300009148 | Ga0105243_10133199 | Ga0105243_101331992 | 125 |
| 256 | 3300009148 | Ga0105243_10482566 | Ga0105243_104825662 | 125 |
| 257 | 3300009148 | Ga0105243_10986333 | Ga0105243_109863332 | 125 |
| 258 | 3300009174 | Ga0105241_10037969 | Ga0105241_100379694 | 125 |
| 259 | 3300009174 | Ga0105241_10729206 | Ga0105241_107292061 | 125 |
| 260 | 3300009174 | Ga0105241_11187614 | Ga0105241_111876142 | 125 |
| 261 | 3300009176 | Ga0105242_10078817 | Ga0105242_100788173 | 125 |
| 262 | 3300009176 | Ga0105242_10087129 | Ga0105242_100871293 | 125 |
| 263 | 3300009177 | Ga0105248_10023640 | Ga0105248_100236402 | 125 |
| 264 | 3300009177 | Ga0105248_10125076 | Ga0105248_101250763 | 125 |
| 265 | 3300009177 | Ga0105248_10203480 | Ga0105248_102034803 | 125 |
| 266 | 3300009177 | Ga0105248_10721139 | Ga0105248_107211392 | 125 |
| 267 | 3300009545 | Ga0105237_10294931 | Ga0105237_102949312 | 125 |
| 268 | 3300009545 | Ga0105237_10313901 | Ga0105237_103139012 | 125 |
| 269 | 3300009545 | Ga0105237_10557922 | Ga0105237_105579221 | 125 |
| 270 | 3300009551 | Ga0105238_10420704 | Ga0105238_104207043 | 125 |
| 271 | 3300009553 | Ga0105249_11195378 | Ga0105249_111953782 | 125 |
| 272 | 3300009553 | Ga0105249_11457354 | Ga0105249_114573541 | 125 |
| 273 | 3300010375 | Ga0105239_10066883 | Ga0105239_100668831 | 125 |
| 274 | 3300010375 | Ga0105239_10105613 | Ga0105239_101056135 | 125 |
| 275 | 3300010375 | Ga0105239_10149616 | Ga0105239_101496164 | 125 |
| 276 | 3300010375 | Ga0105239_11223802 | Ga0105239_112238022 | 125 |
| 277 | 3300010375 | Ga0105239_12765785 | Ga0105239_127657851 | 125 |
| 278 | 3300011119 | Ga0105246_10012343 | Ga0105246_100123433 | 125 |
| 279 | 3300011119 | Ga0105246_10014513 | Ga0105246_100145134 | 125 |
| 280 | 3300011119 | Ga0105246_10235892 | Ga0105246_102358923 | 125 |
| 281 | 3300011119 | Ga0105246_10241382 | Ga0105246_102413821 | 125 |
| 282 | 3300011119 | Ga0105246_10470315 | Ga0105246_104703152 | 125 |
| 283 | 3300011119 | Ga0105246_11064072 | Ga0105246_110640721 | 125 |
| 284 | 3300011119 | Ga0105246_12195017 | Ga0105246_121950171 | 125 |
| 285 | 3300012485 | Ga0157325_1011236 | Ga0157325_10112361 | 125 |
| 286 | 3300013100 | Ga0157373_10582196 | Ga0157373_105821962 | 125 |
| 287 | 3300013296 | Ga0157374_10564085 | Ga0157374_105640853 | 125 |
| 288 | 3300013297 | Ga0157378_10680324 | Ga0157378_106803243 | 125 |
| 289 | 3300013297 | Ga0157378_11122521 | Ga0157378_111225212 | 125 |
| 290 | 3300013306 | Ga0163162_10046559 | Ga0163162_100465592 | 125 |
| 291 | 3300013306 | Ga0163162_10260284 | Ga0163162_102602842 | 125 |
| 292 | 3300013306 | Ga0163162_11219563 | Ga0163162_112195632 | 125 |
| 293 | 3300013307 | Ga0157372_10039849 | Ga0157372_100398492 | 125 |
| 294 | 3300013307 | Ga0157372_11154790 | Ga0157372_111547901 | 125 |
| 295 | 3300013308 | Ga0157375_10007205 | Ga0157375_100072053 | 125 |
| 296 | 3300013308 | Ga0157375_10243171 | Ga0157375_102431712 | 125 |
| 297 | 3300013308 | Ga0157375_10531628 | Ga0157375_105316283 | 125 |
| 298 | 3300014325 | Ga0163163_10000275 | Ga0163163_100002756 | 125 |
| 299 | 3300014325 | Ga0163163_10034702 | Ga0163163_100347023 | 125 |
| 300 | 3300014325 | Ga0163163_10034994 | Ga0163163_100349942 | 125 |
| 301 | 3300014325 | Ga0163163_10159998 | Ga0163163_101599983 | 125 |
| 302 | 3300014325 | Ga0163163_10201557 | Ga0163163_102015572 | 125 |
| 303 | 3300014325 | Ga0163163_10503686 | Ga0163163_105036863 | 125 |
| 304 | 3300014325 | Ga0163163_10691785 | Ga0163163_106917852 | 125 |
| 305 | 3300014326 | Ga0157380_10015409 | Ga0157380_100154095 | 125 |
| 306 | 3300014326 | Ga0157380_10500316 | Ga0157380_105003161 | 125 |
| 307 | 3300014326 | Ga0157380_10879268 | Ga0157380_108792682 | 125 |
| 308 | 3300014745 | Ga0157377_10038673 | Ga0157377_100386733 | 125 |
| 309 | 3300014968 | Ga0157379_10083735 | Ga0157379_100837352 | 125 |
| 310 | 3300014968 | Ga0157379_10382350 | Ga0157379_103823502 | 125 |
| 311 | 3300014968 | Ga0157379_10390799 | Ga0157379_103907993 | 125 |
| 312 | 3300014968 | Ga0157379_10457255 | Ga0157379_104572552 | 125 |
| 313 | 3300014968 | Ga0157379_10634312 | Ga0157379_106343121 | 125 |
| 314 | 3300014969 | Ga0157376_10227683 | Ga0157376_102276833 | 125 |
| 315 | 3300014969 | Ga0157376_10404916 | Ga0157376_104049162 | 125 |
| 316 | 3300014969 | Ga0157376_10426217 | Ga0157376_104262171 | 125 |
| 317 | 3300014969 | Ga0157376_10900718 | Ga0157376_109007182 | 125 |
| 318 | 3300014969 | Ga0157376_11139343 | Ga0157376_111393432 | 125 |
| 319 | 3300017792 | Ga0163161_10003469 | Ga0163161_100034696 | 125 |
| 320 | 3300017792 | Ga0163161_10655606 | Ga0163161_106556062 | 125 |
| 321 | 3300020080 | Ga0206350_10676508 | Ga0206350_106765082 | 125 |
| 322 | 3300021361 | Ga0213872_10131334 | Ga0213872_101313342 | 125 |
| 323 | 3300021361 | Ga0213872_10212946 | Ga0213872_102129462 | 125 |
| 324 | 3300021361 | Ga0213872_10432780 | Ga0213872_104327801 | 125 |
| 325 | 3300021441 | Ga0213871_10119803 | Ga0213871_101198031 | 125 |
| 326 | 3300025271 | Ga0207666_1013868 | Ga0207666_10138682 | 125 |
| 327 | 3300025315 | Ga0207697_10163975 | Ga0207697_101639753 | 125 |
| 328 | 3300025321 | Ga0207656_10524668 | Ga0207656_105246681 | 125 |
| 329 | 3300025885 | Ga0207653_10030087 | Ga0207653_100300872 | 125 |
| 330 | 3300025893 | Ga0207682_10086507 | Ga0207682_100865073 | 125 |
| 331 | 3300025899 | Ga0207642_10325624 | Ga0207642_103256242 | 125 |
| 332 | 3300025899 | Ga0207642_10529486 | Ga0207642_105294861 | 125 |
| 333 | 3300025899 | Ga0207642_10558153 | Ga0207642_105581532 | 125 |
| 334 | 3300025900 | Ga0207710_10002045 | Ga0207710_100020452 | 125 |
| 335 | 3300025900 | Ga0207710_10029486 | Ga0207710_100294864 | 125 |
| 336 | 3300025901 | Ga0207688_10018235 | Ga0207688_100182354 | 125 |
| 337 | 3300025901 | Ga0207688_10037933 | Ga0207688_100379334 | 125 |
| 338 | 3300025901 | Ga0207688_10477918 | Ga0207688_104779182 | 125 |
| 339 | 3300025903 | Ga0207680_10333288 | Ga0207680_103332882 | 125 |
| 340 | 3300025904 | Ga0207647_10190651 | Ga0207647_101906512 | 125 |
| 341 | 3300025907 | Ga0207645_10005026 | Ga0207645_100050268 | 125 |
| 342 | 3300025907 | Ga0207645_10065785 | Ga0207645_100657852 | 125 |
| 343 | 3300025907 | Ga0207645_10135881 | Ga0207645_101358812 | 125 |
| 344 | 3300025908 | Ga0207643_10111670 | Ga0207643_101116702 | 125 |
| 345 | 3300025910 | Ga0207684_10000312 | Ga0207684_1000031223 | 125 |
| 346 | 3300025910 | Ga0207684_10133471 | Ga0207684_101334712 | 125 |
| 347 | 3300025910 | Ga0207684_10352001 | Ga0207684_103520013 | 125 |
| 348 | 3300025911 | Ga0207654_10518770 | Ga0207654_105187702 | 125 |
| 349 | 3300025914 | Ga0207671_10146994 | Ga0207671_101469943 | 125 |
| 350 | 3300025914 | Ga0207671_10430405 | Ga0207671_104304053 | 125 |
| 351 | 3300025918 | Ga0207662_10263518 | Ga0207662_102635182 | 125 |
| 352 | 3300025918 | Ga0207662_10486974 | Ga0207662_104869742 | 125 |
| 353 | 3300025921 | Ga0207652_10128962 | Ga0207652_101289623 | 125 |
| 354 | 3300025922 | Ga0207646_10574687 | Ga0207646_105746872 | 125 |
| 355 | 3300025923 | Ga0207681_10011395 | Ga0207681_100113952 | 125 |
| 356 | 3300025923 | Ga0207681_10209415 | Ga0207681_102094152 | 125 |
| 357 | 3300025923 | Ga0207681_10388212 | Ga0207681_103882122 | 125 |
| 358 | 3300025923 | Ga0207681_10742380 | Ga0207681_107423802 | 125 |
| 359 | 3300025923 | Ga0207681_11350182 | Ga0207681_113501822 | 125 |
| 360 | 3300025923 | Ga0207681_11622475 | Ga0207681_116224751 | 125 |
| 361 | 3300025924 | Ga0207694_10497689 | Ga0207694_104976892 | 125 |
| 362 | 3300025924 | Ga0207694_10549947 | Ga0207694_105499472 | 125 |
| 363 | 3300025925 | Ga0207650_10000103 | Ga0207650_1000010365 | 125 |
| 364 | 3300025925 | Ga0207650_10006716 | Ga0207650_100067164 | 125 |
| 365 | 3300025925 | Ga0207650_10015003 | Ga0207650_100150033 | 125 |
| 366 | 3300025925 | Ga0207650_10120620 | Ga0207650_101206202 | 125 |
| 367 | 3300025925 | Ga0207650_10503493 | Ga0207650_105034932 | 125 |
| 368 | 3300025926 | Ga0207659_10068554 | Ga0207659_100685543 | 125 |
| 369 | 3300025926 | Ga0207659_10083627 | Ga0207659_100836272 | 125 |
| 370 | 3300025926 | Ga0207659_10348047 | Ga0207659_103480471 | 125 |
| 371 | 3300025926 | Ga0207659_10390551 | Ga0207659_103905512 | 125 |
| 372 | 3300025926 | Ga0207659_11526563 | Ga0207659_115265632 | 125 |
| 373 | 3300025927 | Ga0207687_10128182 | Ga0207687_101281823 | 125 |
| 374 | 3300025927 | Ga0207687_10143218 | Ga0207687_101432183 | 125 |
| 375 | 3300025927 | Ga0207687_11499587 | Ga0207687_114995871 | 125 |
| 376 | 3300025931 | Ga0207644_10323117 | Ga0207644_103231171 | 125 |
| 377 | 3300025931 | Ga0207644_10355837 | Ga0207644_103558372 | 125 |
| 378 | 3300025932 | Ga0207690_10148341 | Ga0207690_101483412 | 125 |
| 379 | 3300025933 | Ga0207706_10479861 | Ga0207706_104798611 | 125 |
| 380 | 3300025933 | Ga0207706_10722503 | Ga0207706_107225032 | 125 |
| 381 | 3300025934 | Ga0207686_10108384 | Ga0207686_101083842 | 125 |
| 382 | 3300025934 | Ga0207686_10237658 | Ga0207686_102376582 | 125 |
| 383 | 3300025934 | Ga0207686_10271122 | Ga0207686_102711222 | 125 |
| 384 | 3300025935 | Ga0207709_10019408 | Ga0207709_100194082 | 125 |
| 385 | 3300025935 | Ga0207709_10191138 | Ga0207709_101911383 | 125 |
| 386 | 3300025935 | Ga0207709_10979494 | Ga0207709_109794942 | 125 |
| 387 | 3300025936 | Ga0207670_10047558 | Ga0207670_100475584 | 125 |
| 388 | 3300025936 | Ga0207670_10199170 | Ga0207670_101991703 | 125 |
| 389 | 3300025937 | Ga0207669_10030208 | Ga0207669_100302082 | 125 |
| 390 | 3300025937 | Ga0207669_10069304 | Ga0207669_100693042 | 125 |
| 391 | 3300025937 | Ga0207669_10261068 | Ga0207669_102610682 | 125 |
| 392 | 3300025937 | Ga0207669_11013689 | Ga0207669_110136892 | 125 |
| 393 | 3300025938 | Ga0207704_10011319 | Ga0207704_100113192 | 125 |
| 394 | 3300025938 | Ga0207704_10034219 | Ga0207704_100342192 | 125 |
| 395 | 3300025938 | Ga0207704_10072914 | Ga0207704_100729143 | 125 |
| 396 | 3300025938 | Ga0207704_10233189 | Ga0207704_102331892 | 125 |
| 397 | 3300025938 | Ga0207704_10330907 | Ga0207704_103309072 | 125 |
| 398 | 3300025939 | Ga0207665_10021847 | Ga0207665_100218477 | 125 |
| 399 | 3300025940 | Ga0207691_10007479 | Ga0207691_100074798 | 125 |
| 400 | 3300025940 | Ga0207691_10125850 | Ga0207691_101258502 | 125 |
| 401 | 3300025941 | Ga0207711_10327928 | Ga0207711_103279282 | 125 |
| 402 | 3300025941 | Ga0207711_10526478 | Ga0207711_105264782 | 125 |
| 403 | 3300025941 | Ga0207711_11173436 | Ga0207711_111734362 | 125 |
| 404 | 3300025942 | Ga0207689_10999873 | Ga0207689_109998731 | 125 |
| 405 | 3300025944 | Ga0207661_10109710 | Ga0207661_101097103 | 125 |
| 406 | 3300025945 | Ga0207679_10188165 | Ga0207679_101881654 | 125 |
| 407 | 3300025960 | Ga0207651_10043046 | Ga0207651_100430462 | 125 |
| 408 | 3300025960 | Ga0207651_10194795 | Ga0207651_101947953 | 125 |
| 409 | 3300025960 | Ga0207651_10314678 | Ga0207651_103146782 | 125 |
| 410 | 3300025960 | Ga0207651_10384322 | Ga0207651_103843222 | 125 |
| 411 | 3300025960 | Ga0207651_10584314 | Ga0207651_105843142 | 125 |
| 412 | 3300025961 | Ga0207712_10073452 | Ga0207712_100734523 | 125 |
| 413 | 3300025961 | Ga0207712_11961938 | Ga0207712_119619381 | 125 |
| 414 | 3300025972 | Ga0207668_10244302 | Ga0207668_102443022 | 125 |
| 415 | 3300025972 | Ga0207668_10267487 | Ga0207668_102674873 | 125 |
| 416 | 3300025981 | Ga0207640_10007968 | Ga0207640_100079682 | 125 |
| 417 | 3300026035 | Ga0207703_10083922 | Ga0207703_100839222 | 125 |
| 418 | 3300026035 | Ga0207703_10917590 | Ga0207703_109175903 | 125 |
| 419 | 3300026067 | Ga0207678_10201190 | Ga0207678_102011902 | 125 |
| 420 | 3300026067 | Ga0207678_10898447 | Ga0207678_108984472 | 125 |
| 421 | 3300026075 | Ga0207708_10006686 | Ga0207708_100066862 | 125 |
| 422 | 3300026075 | Ga0207708_10007652 | Ga0207708_100076526 | 125 |
| 423 | 3300026075 | Ga0207708_10013419 | Ga0207708_100134192 | 125 |
| 424 | 3300026078 | Ga0207702_10039109 | Ga0207702_100391093 | 125 |
| 425 | 3300026078 | Ga0207702_10357580 | Ga0207702_103575802 | 125 |
| 426 | 3300026088 | Ga0207641_10934651 | Ga0207641_109346512 | 125 |
| 427 | 3300026089 | Ga0207648_10051776 | Ga0207648_100517764 | 125 |
| 428 | 3300026089 | Ga0207648_10092720 | Ga0207648_100927202 | 125 |
| 429 | 3300026089 | Ga0207648_10331115 | Ga0207648_103311152 | 125 |
| 430 | 3300026089 | Ga0207648_11377492 | Ga0207648_113774921 | 125 |
| 431 | 3300026095 | Ga0207676_10109275 | Ga0207676_101092753 | 125 |
| 432 | 3300026095 | Ga0207676_10179075 | Ga0207676_101790752 | 125 |
| 433 | 3300026116 | Ga0207674_10215514 | Ga0207674_102155141 | 125 |
| 434 | 3300026116 | Ga0207674_10794427 | Ga0207674_107944271 | 125 |
| 435 | 3300026116 | Ga0207674_11843915 | Ga0207674_118439151 | 125 |
| 436 | 3300026118 | Ga0207675_100072115 | Ga0207675_1000721152 | 125 |
| 437 | 3300026118 | Ga0207675_101046825 | Ga0207675_1010468252 | 125 |
| 438 | 3300026121 | Ga0207683_10006229 | Ga0207683_100062292 | 125 |
| 439 | 3300026121 | Ga0207683_10020589 | Ga0207683_100205892 | 125 |
| 440 | 3300026121 | Ga0207683_10059685 | Ga0207683_100596854 | 125 |
| 441 | 3300026142 | Ga0207698_10734104 | Ga0207698_107341042 | 125 |
| 442 | 3300026142 | Ga0207698_11832572 | Ga0207698_118325721 | 125 |
| 443 | 3300027907 | Ga0207428_10009852 | Ga0207428_100098522 | 125 |
| 444 | 3300028379 | Ga0268266_10402154 | Ga0268266_104021543 | 125 |
| 445 | 3300028379 | Ga0268266_10456364 | Ga0268266_104563642 | 125 |
| 446 | 3300028380 | Ga0268265_10144917 | Ga0268265_101449172 | 125 |
| 447 | 3300028380 | Ga0268265_10554095 | Ga0268265_105540953 | 125 |
| 448 | 3300028381 | Ga0268264_10403726 | Ga0268264_104037262 | 125 |
| 449 | 3300028381 | Ga0268264_10416415 | Ga0268264_104164152 | 125 |
| 450 | 3300028381 | Ga0268264_10804358 | Ga0268264_108043582 | 125 |
| 451 | 3300028381 | Ga0268264_12282400 | Ga0268264_122824002 | 125 |
| 452 | 3300028800 | Ga0265338_10115093 | Ga0265338_101150932 | 125 |
| 453 | 3300031824 | Ga0307413_10035146 | Ga0307413_100351463 | 125 |
| 454 | 3300031852 | Ga0307410_10906010 | Ga0307410_109060102 | 125 |
| 455 | 3300031901 | Ga0307406_10117138 | Ga0307406_101171383 | 125 |
| 456 | 3300031901 | Ga0307406_10554176 | Ga0307406_105541761 | 125 |
| 457 | 3300031903 | Ga0307407_10624064 | Ga0307407_106240642 | 125 |
| 458 | 3300031903 | Ga0307407_10948285 | Ga0307407_109482852 | 125 |
| 459 | 3300031911 | Ga0307412_10024972 | Ga0307412_100249724 | 125 |
| 460 | 3300031911 | Ga0307412_10767293 | Ga0307412_107672932 | 125 |
| 461 | 3300031995 | Ga0307409_100177819 | Ga0307409_1001778192 | 125 |
| 462 | 3300032002 | Ga0307416_100097459 | Ga0307416_1000974591 | 125 |
| 463 | 3300032005 | Ga0307411_10066794 | Ga0307411_100667942 | 125 |
| 464 | 3300032126 | Ga0307415_100039511 | Ga0307415_1000395112 | 125 |
| 465 | 3300032126 | Ga0307415_100474814 | Ga0307415_1004748142 | 125 |
| 466 | 3300035089 | Ga0373944_0428100 | Ga0373944_0428100_26_409 | 125 |
| 467 | 3300035207 | Ga0373942_0017351 | Ga0373942_0017351_1030_1425 | 125 |
| 468 | 3300035692 | Ga0373935_0099233 | Ga0373935_0099233_1237_1716 | 125 |
| 469 | 3300035695 | Ga0373927_0957599 | Ga0373927_0957599_44_427 | 125 |
| 470 | 3300036401 | Ga0373937_0370826 | Ga0373937_0370826_852_1235 | 125 |
| 471 | 3300037312 | Ga0395899_0191732 | Ga0395899_0191732_757_1143 | 125 |
| 472 | 3300037418 | Ga0395900_0011556 | Ga0395900_0011556_6791_7177 | 125 |
| 473 | 3300037466 | Ga0395898_0093106 | Ga0395898_0093106_2115_2501 | 125 |
| 474 | 3300037471 | Ga0395905_0994154 | Ga0395905_0994154_303_680 | 125 |
| 475 | 3300037853 | Ga0436364_1249034 | Ga0436364_1249034_427_810 | 125 |
| 476 | 3300038443 | Ga0395901_0025777 | Ga0395901_0025777_422_808 | 125 |
| 477 | 3300038443 | Ga0395901_0113940 | Ga0395901_0113940_1924_2301 | 125 |
| 478 | 3300038443 | Ga0395901_1401387 | Ga0395901_1401387_240_629 | 125 |
| 479 | 3300038699 | Ga0242422_01099 | Ga0242422_01099_91_486 | 125 |
| 480 | 3300039438 | Ga0436360_0253035 | Ga0436360_0253035_88_471 | 125 |
| 481 | 3300039438 | Ga0436360_1260888 | Ga0436360_1260888_1137_1520 | 125 |
| 482 | 3300039438 | Ga0436360_1270538 | Ga0436360_1270538_247_630 | 125 |
| 483 | 3300039447 | Ga0436361_0317298 | Ga0436361_0317298_463_843 | 125 |
| 484 | 3300039447 | Ga0436361_0550221 | Ga0436361_0550221_424_807 | 125 |
| 485 | 3300039447 | Ga0436361_0649317 | Ga0436361_0649317_1015_1398 | 125 |
| 486 | 3300039447 | Ga0436361_0810969 | Ga0436361_0810969_448_831 | 125 |
| 487 | 3300039447 | Ga0436361_0892360 | Ga0436361_0892360_3321_3704 | 125 |
| 488 | 3300039447 | Ga0436361_0938542 | Ga0436361_0938542_81_464 | 125 |
| 489 | 3300039453 | Ga0436362_0442172 | Ga0436362_0442172_106_489 | 125 |
| 490 | 3300039453 | Ga0436362_0993857 | Ga0436362_0993857_870_1253 | 125 |
| 491 | 3300041512 | Ga0451853_1239964 | Ga0451853_1239964_233_610 | 125 |
| 492 | 3300042005 | Ga0439448_0117958 | Ga0439448_0117958_90_485 | 125 |
| 493 | 3300045051 | Ga0451576_0076316 | Ga0451576_0076316_1706_2089 | 125 |
| 494 | 3300045051 | Ga0451576_0185677 | Ga0451576_0185677_1661_2056 | 125 |
| 495 | 3300046463 | Ga0495653_0522741 | Ga0495653_0522741_242_622 | 125 |
| 496 | 3300046491 | Ga0495584_0315418 | Ga0495584_0315418_320_697 | 125 |
| 497 | 3300046499 | Ga0495594_0666203 | Ga0495594_0666203_45_422 | 125 |
| 498 | 3300046511 | Ga0495608_0216353 | Ga0495608_0216353_590_973 | 125 |
| 499 | 3300046531 | Ga0495665_0143798 | Ga0495665_0143798_467_853 | 125 |
| 500 | 3300046663 | Ga0495635_0574628 | Ga0495635_0574628_168_551 | 125 |
| 501 | 3300046680 | Ga0495646_0635665 | Ga0495646_0635665_136_519 | 125 |
| 502 | 3300046681 | Ga0495647_0188540 | Ga0495647_0188540_257_640 | 125 |
| 503 | 3300046683 | Ga0495658_0212891 | Ga0495658_0212891_452_835 | 125 |
| 504 | 3300046689 | Ga0495613_0867479 | Ga0495613_0867479_154_537 | 125 |
| 505 | 3300046809 | Ga0495600_0262385 | Ga0495600_0262385_229_609 | 125 |
| 506 | 3300047319 | Ga0495674_0187942 | Ga0495674_0187942_107_490 | 125 |
| 507 | 3300047322 | Ga0495680_0313824 | Ga0495680_0313824_565_948 | 125 |
| 508 | 3300048903 | Ga0496100_0608762 | Ga0496100_0608762_440_817 | 125 |
| 509 | 3300048903 | Ga0496100_1091623 | Ga0496100_1091623_33_410 | 125 |
| 510 | 3300048904 | Ga0496101_0042375 | Ga0496101_0042375_2470_2847 | 125 |
| 511 | 3300048904 | Ga0496101_0498539 | Ga0496101_0498539_534_911 | 125 |
| 512 | 3300048905 | Ga0496102_0196665 | Ga0496102_0196665_869_1246 | 125 |
| 513 | 3300048905 | Ga0496102_0329723 | Ga0496102_0329723_800_1189 | 125 |
| 514 | 3300048905 | Ga0496102_0358305 | Ga0496102_0358305_668_1045 | 125 |
| 515 | 3300048906 | Ga0496103_0213205 | Ga0496103_0213205_808_1185 | 125 |
| 516 | 3300048907 | Ga0496104_0002907 | Ga0496104_0002907_3823_4206 | 125 |
| 517 | 3300048907 | Ga0496104_0017375 | Ga0496104_0017375_3731_4108 | 125 |
| 518 | 3300048907 | Ga0496104_0384309 | Ga0496104_0384309_676_1053 | 125 |
| 519 | 3300048908 | Ga0496105_0120171 | Ga0496105_0120171_678_1061 | 125 |
| 520 | 3300048908 | Ga0496105_0219377 | Ga0496105_0219377_1080_1457 | 125 |
| 521 | 3300048908 | Ga0496105_0256244 | Ga0496105_0256244_207_584 | 125 |
| 522 | 3300048909 | Ga0496106_0039270 | Ga0496106_0039270_2422_2799 | 125 |
| 523 | 3300048909 | Ga0496106_0349194 | Ga0496106_0349194_19_402 | 125 |
| 524 | 3300048909 | Ga0496106_0694468 | Ga0496106_0694468_377_754 | 125 |
| 525 | 3300048910 | Ga0496107_0142941 | Ga0496107_0142941_1322_1699 | 125 |
| 526 | 3300048910 | Ga0496107_0164442 | Ga0496107_0164442_302_685 | 125 |
| 527 | 3300048910 | Ga0496107_0876585 | Ga0496107_0876585_203_595 | 125 |
| 528 | 3300048911 | Ga0496108_0010864 | Ga0496108_0010864_4608_4985 | 125 |
| 529 | 3300048911 | Ga0496108_0017366 | Ga0496108_0017366_3785_4162 | 125 |
| 530 | 3300048911 | Ga0496108_0059111 | Ga0496108_0059111_50_445 | 125 |
| 531 | 3300048911 | Ga0496108_0148234 | Ga0496108_0148234_383_772 | 125 |
| 532 | 3300048911 | Ga0496108_1154686 | Ga0496108_1154686_44_421 | 125 |
| 533 | 3300048912 | Ga0496109_0004820 | Ga0496109_0004820_2121_2498 | 125 |
| 534 | 3300048912 | Ga0496109_0166418 | Ga0496109_0166418_1260_1637 | 125 |
| 535 | 3300048912 | Ga0496109_0563265 | Ga0496109_0563265_88_483 | 125 |
| 536 | 3300048912 | Ga0496109_1032605 | Ga0496109_1032605_54_440 | 125 |
| 537 | 3300048912 | Ga0496109_1231207 | Ga0496109_1231207_184_579 | 125 |
| 538 | 3300048912 | Ga0496109_1688467 | Ga0496109_1688467_157_534 | 125 |
| 539 | 3300048912 | Ga0496109_2042789 | Ga0496109_2042789_94_477 | 125 |
| 540 | 3300048913 | Ga0496110_0031719 | Ga0496110_0031719_3515_3892 | 125 |
| 541 | 3300048913 | Ga0496110_0210157 | Ga0496110_0210157_95_481 | 125 |
| 542 | 3300048914 | Ga0496111_0238681 | Ga0496111_0238681_95_481 | 125 |
| 543 | 3300048914 | Ga0496111_0247296 | Ga0496111_0247296_524_901 | 125 |
| 544 | 3300048914 | Ga0496111_0459633 | Ga0496111_0459633_117_506 | 125 |
| 545 | 3300048915 | Ga0496112_0006980 | Ga0496112_0006980_1166_1543 | 125 |
| 546 | 3300048915 | Ga0496112_0064157 | Ga0496112_0064157_927_1319 | 125 |
| 547 | 3300048915 | Ga0496112_0073850 | Ga0496112_0073850_54_440 | 125 |
| 548 | 3300048915 | Ga0496112_0578529 | Ga0496112_0578529_70_465 | 125 |
| 549 | 3300048915 | Ga0496112_0823680 | Ga0496112_0823680_90_485 | 125 |
| 550 | 3300048916 | Ga0496113_0016065 | Ga0496113_0016065_1225_1602 | 125 |
| 551 | 3300048916 | Ga0496113_0181019 | Ga0496113_0181019_302_688 | 125 |
| 552 | 3300048916 | Ga0496113_0388694 | Ga0496113_0388694_718_1107 | 125 |
| 553 | 3300048916 | Ga0496113_0643922 | Ga0496113_0643922_58_435 | 125 |
| 554 | 3300048917 | Ga0496114_0006946 | Ga0496114_0006946_1663_2046 | 125 |
| 555 | 3300048917 | Ga0496114_0027544 | Ga0496114_0027544_934_1311 | 125 |
| 556 | 3300048917 | Ga0496114_0045450 | Ga0496114_0045450_165_542 | 125 |
| 557 | 3300048917 | Ga0496114_0247522 | Ga0496114_0247522_428_817 | 125 |
| 558 | 3300048918 | Ga0496115_0009463 | Ga0496115_0009463_3522_3899 | 125 |
| 559 | 3300048918 | Ga0496115_0399072 | Ga0496115_0399072_543_926 | 125 |
| 560 | 3300049522 | Ga0501299_003046 | Ga0501299_003046_1561_1938 | 125 |
| 561 | 3300049534 | Ga0501318_040946 | Ga0501318_040946_265_642 | 125 |
| 562 | 3300049569 | Ga0501032_0002549 | Ga0501032_0002549_47_442 | 125 |
| 563 | 3300049569 | Ga0501032_0432062 | Ga0501032_0432062_133_519 | 125 |
| 564 | 3300049571 | Ga0501034_0000096 | Ga0501034_0000096_74294_74683 | 125 |
| 565 | 3300049571 | Ga0501034_0005171 | Ga0501034_0005171_3876_4271 | 125 |
| 566 | 3300049572 | Ga0501036_0003288 | Ga0501036_0003288_5053_5448 | 125 |
| 567 | 3300049572 | Ga0501036_0017391 | Ga0501036_0017391_1559_1948 | 125 |
| 568 | 3300049573 | Ga0501037_0294212 | Ga0501037_0294212_246_632 | 125 |
| 569 | 3300049574 | Ga0501038_0002622 | Ga0501038_0002622_11930_12337 | 125 |
| 570 | 3300049574 | Ga0501038_0049975 | Ga0501038_0049975_379_774 | 125 |
| 571 | 3300049574 | Ga0501038_0427269 | Ga0501038_0427269_52_438 | 125 |
| 572 | 3300049575 | Ga0501039_0003272 | Ga0501039_0003272_4721_5116 | 125 |
| 573 | 3300049576 | Ga0501040_0001492 | Ga0501040_0001492_6995_7390 | 125 |
| 574 | 3300049576 | Ga0501040_0056405 | Ga0501040_0056405_939_1328 | 125 |
| 575 | 3300049577 | Ga0501041_0004752 | Ga0501041_0004752_47_442 | 125 |
| 576 | 3300049577 | Ga0501041_0015708 | Ga0501041_0015708_3300_3686 | 125 |
| 577 | 3300049577 | Ga0501041_0452402 | Ga0501041_0452402_89_475 | 125 |
| 578 | 3300049578 | Ga0501042_0000116 | Ga0501042_0000116_8201_8596 | 125 |
| 579 | 3300049578 | Ga0501042_0018587 | Ga0501042_0018587_2845_3231 | 125 |
| 580 | 3300049578 | Ga0501042_1197302 | Ga0501042_1197302_52_441 | 125 |
| 581 | 3300049579 | Ga0501043_0014740 | Ga0501043_0014740_3470_3859 | 125 |
| 582 | 3300049579 | Ga0501043_0046599 | Ga0501043_0046599_47_442 | 125 |
| 583 | 3300049580 | Ga0501046_0001229 | Ga0501046_0001229_3343_3732 | 125 |
| 584 | 3300049580 | Ga0501046_0003365 | Ga0501046_0003365_379_774 | 125 |
| 585 | 3300049580 | Ga0501046_0036243 | Ga0501046_0036243_295_681 | 125 |
| 586 | 3300049581 | Ga0501047_0000008 | Ga0501047_0000008_93783_94172 | 125 |
| 587 | 3300049582 | Ga0501048_0001070 | Ga0501048_0001070_16554_16943 | 125 |
| 588 | 3300049582 | Ga0501048_0001118 | Ga0501048_0001118_7570_7965 | 125 |
| 589 | 3300049582 | Ga0501048_0071263 | Ga0501048_0071263_1882_2268 | 125 |
| 590 | 3300049583 | Ga0501067_0009814 | Ga0501067_0009814_4478_4873 | 125 |
| 591 | 3300049583 | Ga0501067_0022554 | Ga0501067_0022554_642_1031 | 125 |
| 592 | 3300049583 | Ga0501067_0181840 | Ga0501067_0181840_278_676 | 125 |
| 593 | 3300049584 | Ga0501068_0047850 | Ga0501068_0047850_385_774 | 125 |
| 594 | 3300049584 | Ga0501068_1150993 | Ga0501068_1150993_47_442 | 125 |
| 595 | 3300049585 | Ga0501069_0002263 | Ga0501069_0002263_7851_8246 | 125 |
| 596 | 3300049586 | Ga0501070_0002869 | Ga0501070_0002869_7570_7965 | 125 |
| 597 | 3300049586 | Ga0501070_0011220 | Ga0501070_0011220_4209_4598 | 125 |
| 598 | 3300049587 | Ga0501071_0002369 | Ga0501071_0002369_4020_4415 | 125 |
| 599 | 3300049587 | Ga0501071_0030557 | Ga0501071_0030557_1351_1737 | 125 |
| 600 | 3300049587 | Ga0501071_0214844 | Ga0501071_0214844_634_1023 | 125 |
| 601 | 3300049588 | Ga0501072_0000153 | Ga0501072_0000153_34926_35315 | 125 |
| 602 | 3300049588 | Ga0501072_0003182 | Ga0501072_0003182_4959_5354 | 125 |
| 603 | 3300049588 | Ga0501072_0307862 | Ga0501072_0307862_83_469 | 125 |
| 604 | 3300049589 | Ga0501073_0007388 | Ga0501073_0007388_2968_3357 | 125 |
| 605 | 3300049589 | Ga0501073_0022856 | Ga0501073_0022856_47_442 | 125 |
| 606 | 3300049590 | Ga0501074_0001110 | Ga0501074_0001110_11284_11673 | 125 |
| 607 | 3300049590 | Ga0501074_0002631 | Ga0501074_0002631_9110_9505 | 125 |
| 608 | 3300049590 | Ga0501074_0023368 | Ga0501074_0023368_1673_2059 | 125 |
| 609 | 3300049591 | Ga0501075_0001696 | Ga0501075_0001696_7096_7491 | 125 |
| 610 | 3300049592 | Ga0501076_0008270 | Ga0501076_0008270_6995_7390 | 125 |
| 611 | 3300049592 | Ga0501076_0047792 | Ga0501076_0047792_945_1331 | 125 |
| 612 | 3300049593 | Ga0501077_0000711 | Ga0501077_0000711_7851_8246 | 125 |
| 613 | 3300049593 | Ga0501077_0037687 | Ga0501077_0037687_1378_1764 | 125 |
| 614 | 3300049593 | Ga0501077_0154574 | Ga0501077_0154574_1010_1387 | 125 |
| 615 | 3300049664 | Ga0501224_055617 | Ga0501224_055617_59_436 | 125 |
| 616 | 3300049669 | Ga0501235_036898 | Ga0501235_036898_541_918 | 125 |
| 617 | 3300049704 | Ga0501221_038899 | Ga0501221_038899_365_742 | 125 |
| 618 | 3300049705 | Ga0501225_0181055 | Ga0501225_0181055_148_525 | 125 |
| 619 | 3300049707 | Ga0501234_005810 | Ga0501234_005810_203_580 | 125 |
| 620 | 3300049741 | Ga0501079_0000084 | Ga0501079_0000084_13518_13907 | 125 |
| 621 | 3300049741 | Ga0501079_0000221 | Ga0501079_0000221_8201_8596 | 125 |
| 622 | 3300049741 | Ga0501079_0043637 | Ga0501079_0043637_1518_1904 | 125 |
| 623 | 3300049741 | Ga0501079_0278575 | Ga0501079_0278575_301_690 | 125 |
| 624 | 3300049741 | Ga0501079_0539601 | Ga0501079_0539601_164_541 | 125 |
| 625 | 3300049742 | Ga0501080_0002637 | Ga0501080_0002637_14908_15297 | 125 |
| 626 | 3300049742 | Ga0501080_0024552 | Ga0501080_0024552_4753_5148 | 125 |
| 627 | 3300049743 | Ga0501081_0000284 | Ga0501081_0000284_9237_9632 | 125 |
| 628 | 3300049743 | Ga0501081_0017319 | Ga0501081_0017319_1303_1689 | 125 |
| 629 | 3300049744 | Ga0501083_0006749 | Ga0501083_0006749_4414_4803 | 125 |
| 630 | 3300049744 | Ga0501083_0041386 | Ga0501083_0041386_2479_2862 | 125 |
| 631 | 3300049744 | Ga0501083_0058600 | Ga0501083_0058600_581_976 | 125 |
| 632 | 3300049744 | Ga0501083_0300263 | Ga0501083_0300263_628_1014 | 125 |
| 633 | 3300049765 | Ga0501268_055212 | Ga0501268_055212_297_674 | 125 |
| 634 | 3300049767 | Ga0501270_014917 | Ga0501270_014917_125_502 | 125 |
| 635 | 3300049779 | Ga0501283_013278 | Ga0501283_013278_446_823 | 125 |
| 636 | 3300049822 | Ga0501035_0032783 | Ga0501035_0032783_581_976 | 125 |
| 637 | 3300049822 | Ga0501035_1002459 | Ga0501035_1002459_122_505 | 125 |
| 638 | 3300049823 | Ga0501044_0045490 | Ga0501044_0045490_3901_4296 | 125 |
| 639 | 3300049824 | Ga0501045_0000729 | Ga0501045_0000729_12840_13235 | 125 |
| 640 | 3300049824 | Ga0501045_0028445 | Ga0501045_0028445_963_1349 | 125 |
| 641 | 3300049824 | Ga0501045_0600822 | Ga0501045_0600822_168_557 | 125 |
| 642 | 3300050507 | nmdc:mga05p37_1036991_c1 | nmdc:mga05p37_1036991_c1_255_644 | 125 |
| 643 | 3300050507 | nmdc:mga05p37_2275938_c1 | nmdc:mga05p37_2275938_c1_46_435 | 125 |
| 644 | 3300050507 | nmdc:mga05p37_323935_c1 | nmdc:mga05p37_323935_c1_254_643 | 125 |
| 645 | 3300050507 | nmdc:mga05p37_75706_c1 | nmdc:mga05p37_75706_c1_1472_1861 | 125 |
| 646 | 3300050507 | nmdc:mga05p37_78549_c1 | nmdc:mga05p37_78549_c1_271_660 | 125 |
| 647 | 3300050508 | nmdc:mga09592_1216049_c1 | nmdc:mga09592_1216049_c1_90_482 | 125 |
| 648 | 3300050508 | nmdc:mga09592_62030_c1 | nmdc:mga09592_62030_c1_2679_3068 | 125 |
| 649 | 3300050509 | nmdc:mga0qj67_302611_c1 | nmdc:mga0qj67_302611_c1_104_496 | 125 |
| 650 | 3300050510 | nmdc:mga06r32_691657_c1 | nmdc:mga06r32_691657_c1_403_792 | 125 |
| 651 | 3300050511 | nmdc:mga08y16_19023_c1 | nmdc:mga08y16_19023_c1_6590_6970 | 125 |
| 652 | 3300050511 | nmdc:mga08y16_472940_c1 | nmdc:mga08y16_472940_c1_256_636 | 125 |
| 653 | 3300050513 | nmdc:mga0rr50_1060058_c1 | nmdc:mga0rr50_1060058_c1_207_584 | 125 |
| 654 | 3300050513 | nmdc:mga0rr50_74809_c1 | nmdc:mga0rr50_74809_c1_1990_2382 | 125 |
| 655 | 3300050514 | nmdc:mga08x19_32336_c1 | nmdc:mga08x19_32336_c1_2796_3188 | 125 |
| 656 | 3300050514 | nmdc:mga08x19_746418_c1 | nmdc:mga08x19_746418_c1_208_597 | 125 |
| 657 | 3300050514 | nmdc:mga08x19_93386_c1 | nmdc:mga08x19_93386_c1_1316_1699 | 125 |
| 658 | 3300050515 | nmdc:mga0a205_16021_c1 | nmdc:mga0a205_16021_c1_3488_3871 | 125 |
| 659 | 3300053077 | Ga0495601_0151470 | Ga0495601_0151470_1037_1420 | 125 |
| 660 | 3300053078 | Ga0495612_0325431 | Ga0495612_0325431_140_523 | 125 |
| 661 | 3300054114 | Ga0501084_0000135 | Ga0501084_0000135_27353_27742 | 125 |
| 662 | 3300054114 | Ga0501084_0003048 | Ga0501084_0003048_8201_8596 | 125 |
| 663 | 3300054114 | Ga0501084_0068893 | Ga0501084_0068893_1100_1486 | 125 |
| 664 | 3300060353 | Ga0501082_0001674 | Ga0501082_0001674_3300_3689 | 125 |
| 665 | 3300060353 | Ga0501082_0003297 | Ga0501082_0003297_4984_5379 | 125 |
| 666 | 3300060353 | Ga0501082_0039818 | Ga0501082_0039818_402_788 | 125 |
| 667 | 3300061734 | Ga0530510_0002740 | Ga0530510_0002740_4721_5116 | 125 |
| 668 | 3300061734 | Ga0530510_0036572 | Ga0530510_0036572_576_962 | 125 |
| 669 | 3300061734 | Ga0530510_0308797 | Ga0530510_0308797_715_1104 | 125 |
| 670 | 3300061734 | Ga0530510_0947455 | Ga0530510_0947455_236_622 | 125 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xrg-assembly1.cif.gz_A | conserved hypothetical protein from clostridium thermocellum cth-2968 | 0.9856 | 1 | 125 |
| 1xrg-assembly1.cif.gz_C | conserved hypothetical protein from clostridium thermocellum cth-2968 | 0.984 | 2 | 125 |
| 2csl-assembly1.cif.gz_B | crystal structure of ttha0137 from thermus thermophilus hb8 | 0.9816 | 3 | 124 |
| 1nq3-assembly2.cif.gz_E | crystal structure of the mammalian tumor associated antigen uk114 | 0.9813 | 1 | 124 |
| 5y6u-assembly1.cif.gz_C | crystal structure of wild-type yabj protein from bacillus subtilis (natto). | 0.9799 | 3 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nq3C00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.98 | 1 | 124 | 3.30.1330.40 |
| 1jd1F00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9792 | 1 | 124 | 3.30.1330.40 |
| af_Q86KR5_2_129_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9781 | 1 | 124 | 3.30.1330.40 |
| 5hp8A00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9773 | 18 | 125 | 3.30.1330.40 |
| 2dyyG00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9754 | 3 | 125 | 3.30.1330.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8BM28-F1-model_v4 | RidA family protein | 0.9962 | 1 | 125 |
GO:0005829
GO:0019239 |
| AF-A0A321LJU5-F1-model_v4 | Reactive intermediate/imine deaminase | 0.9956 | 1 | 125 |
GO:0005829
GO:0019239 |
| AF-A0A1F5ZSH9-F1-model_v4 | Reactive intermediate/imine deaminase | 0.9956 | 1 | 124 |
GO:0005829
GO:0019239 |
| AF-A0A7X8Z7B7-F1-model_v4 | RidA family protein | 0.9956 | 3 | 125 |
GO:0005829
GO:0019239 |
| AF-A0A353A1P7-F1-model_v4 | Reactive intermediate/imine deaminase | 0.9951 | 3 | 124 |
GO:0005829
GO:0019239 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar