F474089

General Info

Members Datasets Scaffolds Average Seq Length
670 288 670 128

Family's Representative Sequence

Representative Sequence 3300025926|Ga0207659_10348047|Ga0207659_103480471
Length 151
Sequence VRQAIATDQAPKAIGPYSQAITAGSLLYCSGQIPLDPATGALVQGDLAAQTRRVLDNVGAILAAAGTSFDRVVKTTVFLADMNDFAAMNEVYATYFTSPAPARSTVAAAGLPKGARIEIEGFGELHQQGRRKWPLIALHQIEIAWRDCQHF

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
117 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
262 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
263 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
264 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
265 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
271 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
272 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.76
Rhizosphere 91.94
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_551986 2162886011 Bacteria 1745
2 LJQas_1000046 3300000549 Bacteria 19569
3 JGI24751J29686_10039302 3300002459 Bacteria 979
4 JGI24751J29686_10083194 3300002459 Unclassified 664
5 JGI25406J46586_10017975 3300003203 Bacteria 2912
6 JGI25406J46586_10101567 3300003203 Bacteria 857
7 Ga0065712_10000329 3300005290 Bacteria 17463
8 Ga0065712_10004655 3300005290 Bacteria 6705
9 Ga0065715_10001890 3300005293 Bacteria 7149
10 Ga0065715_10126324 3300005293 Bacteria 2111
11 Ga0065715_10181738 3300005293 Bacteria 1472
12 Ga0065707_10166691 3300005295 Bacteria 1517
13 Ga0065707_10383896 3300005295 Bacteria 873
14 Ga0070676_10007361 3300005328 Bacteria 5906
15 Ga0070676_10103048 3300005328 Bacteria 1766
16 Ga0070676_10595593 3300005328 Bacteria 797
17 Ga0070683_101354420 3300005329 Bacteria 684
18 Ga0070690_100307618 3300005330 Bacteria 1138
19 Ga0070690_100773823 3300005330 Bacteria 743
20 Ga0070670_100000040 3300005331 Bacteria 149939
21 Ga0070670_100000177 3300005331 Bacteria 57701
22 Ga0070670_100002961 3300005331 Bacteria 14061
23 Ga0070670_100008026 3300005331 Bacteria 8980
24 Ga0070670_100075366 3300005331 Bacteria 2899
25 Ga0068869_100710809 3300005334 Bacteria 858
26 Ga0068869_101943091 3300005334 Bacteria 527
27 Ga0070680_101371364 3300005336 Bacteria 612
28 Ga0070682_101666982 3300005337 Bacteria 553
29 Ga0068868_100179457 3300005338 Bacteria 1756
30 Ga0068868_100433762 3300005338 Bacteria 1140
31 Ga0070689_100056898 3300005340 Bacteria 3034
32 Ga0070689_100231183 3300005340 Bacteria 1520
33 Ga0070689_100808792 3300005340 Bacteria 825
34 Ga0070691_10003956 3300005341 Bacteria 6703
35 Ga0070691_10724514 3300005341 Bacteria 599
36 Ga0070687_100492089 3300005343 Bacteria 824
37 Ga0070687_100760963 3300005343 Bacteria 682
38 Ga0070692_10276731 3300005345 Bacteria 1015
39 Ga0070692_10462046 3300005345 Unclassified 815
40 Ga0070668_100015638 3300005347 Bacteria 5673
41 Ga0070669_100051607 3300005353 Bacteria 3007
42 Ga0070669_100211602 3300005353 Bacteria 1530
43 Ga0070669_100385179 3300005353 Unclassified 1144
44 Ga0070675_100049947 3300005354 Bacteria 3434
45 Ga0070675_100085282 3300005354 Bacteria 2638
46 Ga0070675_100486313 3300005354 Bacteria 1111
47 Ga0070675_100554867 3300005354 Bacteria 1039
48 Ga0070671_100033098 3300005355 Bacteria 4274
49 Ga0070671_100224742 3300005355 Bacteria 1593
50 Ga0070671_100809206 3300005355 Bacteria 816
51 Ga0070674_100002662 3300005356 Bacteria 9894
52 Ga0070674_100005767 3300005356 Bacteria 7185
53 Ga0070674_100075290 3300005356 Bacteria 2397
54 Ga0070673_100163106 3300005364 Bacteria 1897
55 Ga0070673_100168830 3300005364 Bacteria 1866
56 Ga0070673_100425051 3300005364 Unclassified 1192
57 Ga0070673_100609210 3300005364 Bacteria 997
58 Ga0070688_100008752 3300005365 Bacteria 5505
59 Ga0070688_100010798 3300005365 Bacteria 5048
60 Ga0070688_100459181 3300005365 Bacteria 954
61 Ga0070659_100088747 3300005366 Bacteria 2476
62 Ga0070667_100316736 3300005367 Bacteria 1407
63 Ga0070667_100398187 3300005367 Bacteria 1253
64 Ga0070703_10048321 3300005406 Bacteria 1351
65 Ga0070709_10248779 3300005434 Bacteria 1280
66 Ga0070701_10022642 3300005438 Bacteria 3014
67 Ga0070701_10151103 3300005438 Bacteria 1337
68 Ga0070705_100006397 3300005440 Bacteria 5774
69 Ga0070705_100029428 3300005440 Bacteria 3021
70 Ga0070705_100458119 3300005440 Bacteria 958
71 Ga0070700_100009994 3300005441 Bacteria 5223
72 Ga0070700_100011679 3300005441 Bacteria 4872
73 Ga0070700_100026025 3300005441 Bacteria 3450
74 Ga0070700_100436678 3300005441 Unclassified 993
75 Ga0070700_100665313 3300005441 Bacteria 824
76 Ga0070694_100058835 3300005444 Bacteria 2616
77 Ga0070694_100786013 3300005444 Bacteria 779
78 Ga0070708_100005220 3300005445 Bacteria 10287
79 Ga0070708_100015034 3300005445 Archaea 6384
80 Ga0070708_100184211 3300005445 Archaea 1952
81 Ga0070708_101067551 3300005445 Bacteria 757
82 Ga0070678_100096650 3300005456 Bacteria 2279
83 Ga0070678_100187374 3300005456 Bacteria 1698
84 Ga0070662_100714127 3300005457 Bacteria 848
85 Ga0070681_10364398 3300005458 Unclassified 1355
86 Ga0068867_100017807 3300005459 Bacteria 5045
87 Ga0068867_100145891 3300005459 Bacteria 1855
88 Ga0068867_100178754 3300005459 Bacteria 1686
89 Ga0068867_100460233 3300005459 Unclassified 1086
90 Ga0068867_100677151 3300005459 Bacteria 908
91 Ga0068867_101016165 3300005459 Bacteria 753
92 Ga0070685_10011459 3300005466 Bacteria 4640
93 Ga0070685_10024892 3300005466 Bacteria 3292
94 Ga0070685_10045911 3300005466 Bacteria 2507
95 Ga0070706_100000223 3300005467 Bacteria 69475
96 Ga0070706_100021405 3300005467 Bacteria 5956
97 Ga0070706_100061416 3300005467 Bacteria 3470
98 Ga0070706_100338406 3300005467 Bacteria 1403
99 Ga0070707_100000030 3300005468 Unclassified 122924
100 Ga0070707_100083777 3300005468 Archaea 3081
101 Ga0070707_100244169 3300005468 Bacteria 1747
102 Ga0070707_100367042 3300005468 Bacteria 1398
103 Ga0070707_100413735 3300005468 Unclassified 1309
104 Ga0070698_100004458 3300005471 Bacteria 15388
105 Ga0074259_10176926 3300005507 Bacteria 855
106 Ga0070699_100372459 3300005518 Bacteria 1288
107 Ga0070699_100650597 3300005518 Bacteria 962
108 Ga0070699_101443933 3300005518 Bacteria 631
109 Ga0070684_100171712 3300005535 Bacteria 1969
110 Ga0070684_100176135 3300005535 Bacteria 1944
111 Ga0070684_100633334 3300005535 Unclassified 995
112 Ga0070684_100804320 3300005535 Bacteria 879
113 Ga0070697_100130966 3300005536 Archaea 2103
114 Ga0070697_100131712 3300005536 Bacteria 2098
115 Ga0070697_101336689 3300005536 Bacteria 639
116 Ga0068853_100176180 3300005539 Bacteria 1937
117 Ga0068853_101394995 3300005539 Bacteria 677
118 Ga0070672_100004106 3300005543 Bacteria 9506
119 Ga0070672_100551720 3300005543 Bacteria 1001
120 Ga0070672_100671494 3300005543 Bacteria 906
121 Ga0070672_101368958 3300005543 Bacteria 633
122 Ga0070686_100008839 3300005544 Bacteria 5645
123 Ga0070686_100100640 3300005544 Bacteria 1952
124 Ga0070686_100167064 3300005544 Bacteria 1553
125 Ga0070695_100009270 3300005545 Bacteria 5851
126 Ga0070695_100157247 3300005545 Bacteria 1592
127 Ga0070696_100004210 3300005546 Bacteria 9582
128 Ga0070696_100269509 3300005546 Bacteria 1294
129 Ga0070665_100011544 3300005548 Bacteria 8928
130 Ga0070665_100518880 3300005548 Bacteria 1203
131 Ga0070704_100006282 3300005549 Bacteria 6993
132 Ga0070704_100545869 3300005549 Bacteria 1012
133 Ga0070704_100923341 3300005549 Bacteria 786
134 Ga0068855_100930783 3300005563 Bacteria 917
135 Ga0068855_101356614 3300005563 Bacteria 734
136 Ga0070664_100465160 3300005564 Bacteria 1162
137 Ga0068854_100005336 3300005578 Bacteria 8112
138 Ga0068854_100024287 3300005578 Unclassified 4148
139 Ga0068854_100326574 3300005578 Bacteria 1249
140 Ga0068854_100612274 3300005578 Unclassified 931
141 Ga0068854_100751779 3300005578 Unclassified 846
142 Ga0068856_100053873 3300005614 Bacteria 3967
143 Ga0068856_100997029 3300005614 Bacteria 856
144 Ga0070702_100008040 3300005615 Bacteria 5089
145 Ga0070702_100134791 3300005615 Bacteria 1565
146 Ga0068852_100841993 3300005616 Bacteria 933
147 Ga0068852_102779818 3300005616 Bacteria 508
148 Ga0068859_100075274 3300005617 Bacteria 3416
149 Ga0068859_100231920 3300005617 Bacteria 1934
150 Ga0068859_100423725 3300005617 Bacteria 1427
151 Ga0068859_102414827 3300005617 Bacteria 579
152 Ga0068864_100057981 3300005618 Bacteria 3346
153 Ga0068864_100160576 3300005618 Bacteria 2043
154 Ga0068866_10039141 3300005718 Bacteria 2340
155 Ga0068866_10111378 3300005718 Bacteria 1528
156 Ga0068866_10132054 3300005718 Bacteria 1422
157 Ga0068866_10179224 3300005718 Bacteria 1250
158 Ga0068866_10205655 3300005718 Bacteria 1179
159 Ga0068861_100306023 3300005719 Bacteria 1379
160 Ga0068861_101245452 3300005719 Unclassified 721
161 Ga0068851_10993439 3300005834 Bacteria 529
162 Ga0068870_10000685 3300005840 Bacteria 12965
163 Ga0068870_10166252 3300005840 Bacteria 1313
164 Ga0068870_10203436 3300005840 Bacteria 1202
165 Ga0068863_100043250 3300005841 Bacteria 4277
166 Ga0068863_100048593 3300005841 Bacteria 4023
167 Ga0068858_100548654 3300005842 Bacteria 1119
168 Ga0068858_100604918 3300005842 Bacteria 1063
169 Ga0068860_100151563 3300005843 Unclassified 2233
170 Ga0068860_100847786 3300005843 Bacteria 928
171 Ga0068860_100950722 3300005843 Unclassified 876
172 Ga0068860_101168907 3300005843 Bacteria 789
173 Ga0068862_100244414 3300005844 Bacteria 1633
174 Ga0068862_100874656 3300005844 Bacteria 882
175 Ga0068862_101138925 3300005844 Unclassified 777
176 Ga0081538_10052075 3300005981 Bacteria 2450
177 Ga0081539_10000041 3300005985 Bacteria 292660
178 Ga0081539_10010708 3300005985 Bacteria 7393
179 Ga0070717_11659735 3300006028 Bacteria 579
180 Ga0070716_100064759 3300006173 Bacteria 2126
181 Ga0070716_100151662 3300006173 Bacteria 1491
182 Ga0070716_101140262 3300006173 Bacteria 624
183 Ga0070712_100522929 3300006175 Bacteria 997
184 Ga0097621_100007602 3300006237 Bacteria 7766
185 Ga0097621_100214551 3300006237 Bacteria 1675
186 Ga0097621_100240940 3300006237 Unclassified 1581
187 Ga0068871_100051751 3300006358 Bacteria 3325
188 Ga0068871_100095394 3300006358 Bacteria 2484
189 Ga0068871_101652148 3300006358 Unclassified 607
190 Ga0068871_101768044 3300006358 Bacteria 587
191 Ga0075428_100107143 3300006844 Bacteria 3046
192 Ga0075430_100687286 3300006846 Bacteria 843
193 Ga0075431_100092902 3300006847 Bacteria 3114
194 Ga0075434_100060885 3300006871 Bacteria 3755
195 Ga0068865_100399369 3300006881 Bacteria 1126
196 Ga0068865_100665003 3300006881 Bacteria 887
197 Ga0068865_100943391 3300006881 Bacteria 753
198 Ga0075436_100030397 3300006914 Bacteria 3718
199 Ga0075436_100179751 3300006914 Bacteria 1495
200 Ga0075436_100797866 3300006914 Bacteria 703
201 Ga0097620_100075280 3300006931 Bacteria 3416
202 Ga0097620_100231937 3300006931 Bacteria 1934
203 Ga0097620_100423749 3300006931 Bacteria 1427
204 Ga0097620_102415603 3300006931 Bacteria 579
205 Ga0075435_100033994 3300007076 Bacteria 4036
206 Ga0075435_100832320 3300007076 Bacteria 804
207 Ga0075435_101292226 3300007076 Bacteria 639
208 Ga0099794_10003801 3300007265 Archaea 5828
209 Ga0099794_10045626 3300007265 Archaea 2097
210 Ga0099794_10071376 3300007265 Archaea 1701
211 Ga0099794_10548685 3300007265 Unclassified 610
212 Ga0105240_10662715 3300009093 Bacteria 1142
213 Ga0105240_11205569 3300009093 Unclassified 801
214 Ga0105240_11662143 3300009093 Bacteria 667
215 Ga0111539_10024118 3300009094 Bacteria 7470
216 Ga0111539_10071959 3300009094 Bacteria 4079
217 Ga0111539_10275055 3300009094 Bacteria 1960
218 Ga0105245_10049106 3300009098 Bacteria 3777
219 Ga0105245_10085806 3300009098 Bacteria 2886
220 Ga0105245_10107876 3300009098 Bacteria 2585
221 Ga0105245_10156900 3300009098 Unclassified 2156
222 Ga0105245_10369223 3300009098 Bacteria 1426
223 Ga0105245_12283323 3300009098 Bacteria 595
224 Ga0105247_10062295 3300009101 Bacteria 2314
225 Ga0105247_10065435 3300009101 Bacteria 2261
226 Ga0105247_10354561 3300009101 Bacteria 1033
227 Ga0105247_10548011 3300009101 Unclassified 850
228 Ga0114129_10032907 3300009147 Bacteria 7326
229 Ga0114129_10662521 3300009147 Bacteria 1346
230 Ga0114129_12040153 3300009147 Bacteria 693
231 Ga0114129_13401282 3300009147 Unclassified 512
232 Ga0105243_10048809 3300009148 Bacteria 3338
233 Ga0105243_10133199 3300009148 Bacteria 2111
234 Ga0105243_10482566 3300009148 Bacteria 1170
235 Ga0105243_10986333 3300009148 Bacteria 844
236 Ga0105241_10037969 3300009174 Bacteria 3631
237 Ga0105241_10729206 3300009174 Bacteria 907
238 Ga0105241_11187614 3300009174 Bacteria 722
239 Ga0105242_10078817 3300009176 Bacteria 2750
240 Ga0105242_10087129 3300009176 Bacteria 2622
241 Ga0105248_10023640 3300009177 Bacteria 6828
242 Ga0105248_10125076 3300009177 Bacteria 2901
243 Ga0105248_10203480 3300009177 Bacteria 2231
244 Ga0105248_10721139 3300009177 Bacteria 1125
245 Ga0105237_10294931 3300009545 Bacteria 1624
246 Ga0105237_10313901 3300009545 Bacteria 1571
247 Ga0105237_10557922 3300009545 Bacteria 1152
248 Ga0105238_10420704 3300009551 Unclassified 1331
249 Ga0105249_11195378 3300009553 Bacteria 831
250 Ga0105249_11457354 3300009553 Bacteria 757
251 Ga0105239_10066883 3300010375 Bacteria 3947
252 Ga0105239_10105613 3300010375 Bacteria 3119
253 Ga0105239_10149616 3300010375 Bacteria 2605
254 Ga0105239_11223802 3300010375 Unclassified 865
255 Ga0105239_12765785 3300010375 Unclassified 573
256 Ga0105246_10012343 3300011119 Bacteria 5328
257 Ga0105246_10014513 3300011119 Bacteria 4955
258 Ga0105246_10235892 3300011119 Bacteria 1443
259 Ga0105246_10241382 3300011119 Bacteria 1428
260 Ga0105246_10470315 3300011119 Bacteria 1061
261 Ga0105246_11064072 3300011119 Bacteria 736
262 Ga0105246_12195017 3300011119 Bacteria 537
263 Ga0157325_1011236 3300012485 Unclassified 671
264 Ga0157373_10582196 3300013100 Unclassified 814
265 Ga0157374_10000021 3300013296 Bacteria 272840
266 Ga0157374_10564085 3300013296 Bacteria 1147
267 Ga0157378_10680324 3300013297 Bacteria 1047
268 Ga0157378_11122521 3300013297 Bacteria 824
269 Ga0163162_10046559 3300013306 Bacteria 4347
270 Ga0163162_10260284 3300013306 Bacteria 1867
271 Ga0163162_11219563 3300013306 Unclassified 854
272 Ga0157372_10039849 3300013307 Bacteria 5187
273 Ga0157372_11154790 3300013307 Unclassified 895
274 Ga0157375_10007205 3300013308 Bacteria 9724
275 Ga0157375_10243171 3300013308 Bacteria 1959
276 Ga0157375_10531628 3300013308 Bacteria 1338
277 Ga0157375_10623568 3300013308 Bacteria 1236
278 Ga0163163_10000275 3300014325 Bacteria 51570
279 Ga0163163_10034702 3300014325 Bacteria 4888
280 Ga0163163_10034994 3300014325 Bacteria 4869
281 Ga0163163_10159998 3300014325 Bacteria 2297
282 Ga0163163_10201557 3300014325 Bacteria 2038
283 Ga0163163_10503686 3300014325 Unclassified 1273
284 Ga0163163_10691785 3300014325 Unclassified 1083
285 Ga0157380_10015409 3300014326 Bacteria 5619
286 Ga0157380_10500316 3300014326 Bacteria 1180
287 Ga0157380_10879268 3300014326 Bacteria 920
288 Ga0157377_10000023 3300014745 Bacteria 146600
289 Ga0157377_10038673 3300014745 Bacteria 2635
290 Ga0157379_10083735 3300014968 Bacteria 2859
291 Ga0157379_10382350 3300014968 Bacteria 1292
292 Ga0157379_10390799 3300014968 Bacteria 1277
293 Ga0157379_10457255 3300014968 Bacteria 1179
294 Ga0157379_10634312 3300014968 Unclassified 999
295 Ga0157376_10000006 3300014969 Bacteria 368549
296 Ga0157376_10227683 3300014969 Unclassified 1730
297 Ga0157376_10404916 3300014969 Unclassified 1320
298 Ga0157376_10426217 3300014969 Bacteria 1288
299 Ga0157376_10900718 3300014969 Bacteria 903
300 Ga0157376_11139343 3300014969 Bacteria 807
301 Ga0163161_10003469 3300017792 Bacteria 11049
302 Ga0163161_10655606 3300017792 Bacteria 870
303 Ga0206350_10676508 3300020080 Unclassified 574
304 Ga0213872_10131334 3300021361 Unclassified 1103
305 Ga0213872_10212946 3300021361 Unclassified 825
306 Ga0213872_10432780 3300021361 Unclassified 530
307 Ga0213871_10119803 3300021441 Bacteria 784
308 Ga0207666_1013868 3300025271 Bacteria 1134
309 Ga0207697_10163975 3300025315 Unclassified 970
310 Ga0207656_10524668 3300025321 Bacteria 602
311 Ga0207653_10030087 3300025885 Bacteria 1751
312 Ga0207682_10086507 3300025893 Bacteria 1352
313 Ga0207642_10325624 3300025899 Bacteria 899
314 Ga0207642_10529486 3300025899 Unclassified 725
315 Ga0207642_10558153 3300025899 Bacteria 708
316 Ga0207710_10002045 3300025900 Bacteria 9583
317 Ga0207710_10029486 3300025900 Bacteria 2388
318 Ga0207688_10018235 3300025901 Bacteria 3821
319 Ga0207688_10037933 3300025901 Bacteria 2674
320 Ga0207688_10477918 3300025901 Bacteria 779
321 Ga0207680_10333288 3300025903 Bacteria 1063
322 Ga0207647_10190651 3300025904 Unclassified 1188
323 Ga0207699_10413225 3300025906 Bacteria 963
324 Ga0207645_10005026 3300025907 Bacteria 9690
325 Ga0207645_10065785 3300025907 Bacteria 2317
326 Ga0207645_10135881 3300025907 Bacteria 1601
327 Ga0207643_10111670 3300025908 Bacteria 1611
328 Ga0207684_10000312 3300025910 Bacteria 68977
329 Ga0207684_10080379 3300025910 Bacteria 2773
330 Ga0207684_10133471 3300025910 Unclassified 2131
331 Ga0207684_10352001 3300025910 Bacteria 1268
332 Ga0207654_10518770 3300025911 Bacteria 843
333 Ga0207671_10146994 3300025914 Unclassified 1819
334 Ga0207671_10430405 3300025914 Bacteria 1050
335 Ga0207693_10028023 3300025915 Bacteria 4452
336 Ga0207662_10263518 3300025918 Bacteria 1135
337 Ga0207662_10486974 3300025918 Bacteria 848
338 Ga0207652_10128962 3300025921 Bacteria 2255
339 Ga0207646_10019484 3300025922 Archaea 6305
340 Ga0207646_10034164 3300025922 Bacteria 4596
341 Ga0207646_10078224 3300025922 Archaea 2956
342 Ga0207646_10079498 3300025922 Unclassified 2932
343 Ga0207646_10574687 3300025922 Bacteria 1012
344 Ga0207681_10011395 3300025923 Bacteria 5464
345 Ga0207681_10209415 3300025923 Unclassified 1502
346 Ga0207681_10388212 3300025923 Bacteria 1125
347 Ga0207681_10742380 3300025923 Bacteria 818
348 Ga0207681_11350182 3300025923 Unclassified 598
349 Ga0207681_11622475 3300025923 Bacteria 541
350 Ga0207694_10497689 3300025924 Bacteria 1020
351 Ga0207694_10549947 3300025924 Unclassified 969
352 Ga0207650_10000067 3300025925 Bacteria 140196
353 Ga0207650_10000103 3300025925 Bacteria 111316
354 Ga0207650_10006716 3300025925 Bacteria 7845
355 Ga0207650_10015003 3300025925 Bacteria 5389
356 Ga0207650_10120620 3300025925 Unclassified 2041
357 Ga0207650_10503493 3300025925 Bacteria 1012
358 Ga0207659_10068554 3300025926 Bacteria 2580
359 Ga0207659_10083627 3300025926 Bacteria 2366
360 Ga0207659_10348047 3300025926 Bacteria 1229
361 Ga0207659_10390551 3300025926 Bacteria 1162
362 Ga0207659_11526563 3300025926 Bacteria 571
363 Ga0207687_10128182 3300025927 Bacteria 1908
364 Ga0207687_10143218 3300025927 Bacteria 1816
365 Ga0207687_11499587 3300025927 Bacteria 579
366 Ga0207644_10323117 3300025931 Bacteria 1248
367 Ga0207644_10355837 3300025931 Bacteria 1190
368 Ga0207690_10148341 3300025932 Bacteria 1736
369 Ga0207706_10479861 3300025933 Bacteria 1074
370 Ga0207706_10722503 3300025933 Bacteria 850
371 Ga0207686_10108384 3300025934 Bacteria 1868
372 Ga0207686_10237658 3300025934 Bacteria 1324
373 Ga0207686_10271122 3300025934 Unclassified 1248
374 Ga0207709_10019408 3300025935 Bacteria 3822
375 Ga0207709_10191138 3300025935 Bacteria 1454
376 Ga0207709_10979494 3300025935 Bacteria 690
377 Ga0207670_10047558 3300025936 Bacteria 2858
378 Ga0207670_10199170 3300025936 Bacteria 1520
379 Ga0207669_10030208 3300025937 Bacteria 3008
380 Ga0207669_10069304 3300025937 Bacteria 2206
381 Ga0207669_10261068 3300025937 Bacteria 1295
382 Ga0207669_11013689 3300025937 Unclassified 698
383 Ga0207704_10011319 3300025938 Bacteria 4387
384 Ga0207704_10034219 3300025938 Bacteria 2897
385 Ga0207704_10072914 3300025938 Bacteria 2185
386 Ga0207704_10233189 3300025938 Bacteria 1370
387 Ga0207704_10330907 3300025938 Bacteria 1179
388 Ga0207665_10021847 3300025939 Bacteria 4208
389 Ga0207665_10041424 3300025939 Bacteria 3075
390 Ga0207691_10007479 3300025940 Bacteria 10518
391 Ga0207691_10125850 3300025940 Bacteria 2268
392 Ga0207711_10327928 3300025941 Bacteria 1415
393 Ga0207711_10526478 3300025941 Bacteria 1102
394 Ga0207711_11173436 3300025941 Bacteria 709
395 Ga0207689_10999873 3300025942 Bacteria 705
396 Ga0207661_10109710 3300025944 Bacteria 2331
397 Ga0207679_10188165 3300025945 Bacteria 1714
398 Ga0207651_10043046 3300025960 Bacteria 3011
399 Ga0207651_10194795 3300025960 Unclassified 1619
400 Ga0207651_10314678 3300025960 Bacteria 1307
401 Ga0207651_10384322 3300025960 Bacteria 1190
402 Ga0207651_10584314 3300025960 Bacteria 975
403 Ga0207712_10073452 3300025961 Bacteria 2467
404 Ga0207712_11961938 3300025961 Bacteria 524
405 Ga0207668_10244302 3300025972 Unclassified 1454
406 Ga0207668_10267487 3300025972 Bacteria 1396
407 Ga0207640_10007968 3300025981 Bacteria 5851
408 Ga0207640_10019319 3300025981 Unclassified 4023
409 Ga0207640_10350171 3300025981 Bacteria 1186
410 Ga0207677_10000133 3300026023 Bacteria 61065
411 Ga0207703_10083922 3300026035 Bacteria 2663
412 Ga0207703_10917590 3300026035 Bacteria 839
413 Ga0207678_10201190 3300026067 Bacteria 1703
414 Ga0207678_10898447 3300026067 Bacteria 783
415 Ga0207708_10006686 3300026075 Bacteria 8528
416 Ga0207708_10007652 3300026075 Bacteria 7994
417 Ga0207708_10013419 3300026075 Bacteria 6124
418 Ga0207702_10039109 3300026078 Bacteria 3973
419 Ga0207702_10357580 3300026078 Bacteria 1399
420 Ga0207641_10934651 3300026088 Bacteria 862
421 Ga0207648_10051776 3300026089 Bacteria 3589
422 Ga0207648_10092720 3300026089 Bacteria 2641
423 Ga0207648_10331115 3300026089 Bacteria 1370
424 Ga0207648_11377492 3300026089 Bacteria 663
425 Ga0207676_10109275 3300026095 Bacteria 2310
426 Ga0207676_10179075 3300026095 Bacteria 1855
427 Ga0207674_10215514 3300026116 Bacteria 1868
428 Ga0207674_10794427 3300026116 Unclassified 913
429 Ga0207674_11843915 3300026116 Bacteria 571
430 Ga0207675_100072115 3300026118 Bacteria 3230
431 Ga0207675_101046825 3300026118 Bacteria 835
432 Ga0207683_10006229 3300026121 Bacteria 10227
433 Ga0207683_10020589 3300026121 Bacteria 5645
434 Ga0207683_10059685 3300026121 Bacteria 3350
435 Ga0207698_10734104 3300026142 Bacteria 985
436 Ga0207698_11832572 3300026142 Bacteria 622
437 Ga0209588_1000238 3300027671 Archaea 14657
438 Ga0209588_1047006 3300027671 Archaea 1396
439 Ga0207428_10009852 3300027907 Bacteria 8558
440 Ga0268266_10402154 3300028379 Bacteria 1295
441 Ga0268266_10456364 3300028379 Bacteria 1215
442 Ga0268265_10144917 3300028380 Bacteria 1994
443 Ga0268265_10554095 3300028380 Bacteria 1092
444 Ga0268264_10403726 3300028381 Bacteria 1314
445 Ga0268264_10416415 3300028381 Bacteria 1295
446 Ga0268264_10804358 3300028381 Unclassified 939
447 Ga0268264_12282400 3300028381 Bacteria 548
448 Ga0265338_10115093 3300028800 Bacteria 2157
449 Ga0307413_10035146 3300031824 Bacteria 2872
450 Ga0307410_10858678 3300031852 Bacteria 775
451 Ga0307410_10906010 3300031852 Bacteria 756
452 Ga0307406_10117138 3300031901 Bacteria 1845
453 Ga0307406_10554176 3300031901 Unclassified 941
454 Ga0307407_10624064 3300031903 Bacteria 805
455 Ga0307407_10948285 3300031903 Unclassified 662
456 Ga0307412_10024972 3300031911 Bacteria 3695
457 Ga0307412_10767293 3300031911 Bacteria 834
458 Ga0307409_100177819 3300031995 Bacteria 1880
459 Ga0307416_100097459 3300032002 Bacteria 2546
460 Ga0307414_11274225 3300032004 Bacteria 681
461 Ga0307411_10066794 3300032005 Bacteria 2417
462 Ga0307415_100039511 3300032126 Bacteria 3119
463 Ga0307415_100474814 3300032126 Unclassified 1087
464 Ga0373944_0069616 3300035089 Bacteria 1144
465 Ga0373944_0428100 3300035089 Unclassified 513
466 Ga0373942_0017351 3300035207 Bacteria 1774
467 Ga0373935_0099233 3300035692 Unclassified 1917
468 Ga0373927_0957599 3300035695 Unclassified 565
469 Ga0373937_0370826 3300036401 Unclassified 1357
470 Ga0395899_0191732 3300037312 Bacteria 1430
471 Ga0395900_0011556 3300037418 Bacteria 9034
472 Ga0395898_0093106 3300037466 Bacteria 2897
473 Ga0395905_0994154 3300037471 Bacteria 742
474 Ga0436364_1249034 3300037853 Unclassified 1018
475 Ga0395901_0025777 3300038443 Bacteria 6036
476 Ga0395901_0113940 3300038443 Bacteria 2840
477 Ga0395901_1401387 3300038443 Bacteria 657
478 Ga0242422_01099 3300038699 Unclassified 1843
479 Ga0436360_0253035 3300039438 Bacteria 3451
480 Ga0436360_1260888 3300039438 Bacteria 4219
481 Ga0436360_1270538 3300039438 Bacteria 1554
482 Ga0436361_0317298 3300039447 Bacteria 929
483 Ga0436361_0550221 3300039447 Bacteria 4543
484 Ga0436361_0649317 3300039447 Unclassified 2275
485 Ga0436361_0810969 3300039447 Bacteria 2124
486 Ga0436361_0892360 3300039447 Bacteria 4928
487 Ga0436361_0938542 3300039447 Bacteria 2663
488 Ga0436362_0442172 3300039453 Unclassified 1097
489 Ga0436362_0993857 3300039453 Bacteria 2356
490 Ga0451853_1239964 3300041512 Bacteria 913
491 Ga0439448_0117958 3300042005 Unclassified 910
492 Ga0451576_0076316 3300045051 Unclassified 3488
493 Ga0451576_0185677 3300045051 Bacteria 2171
494 Ga0495653_0522741 3300046463 Bacteria 737
495 Ga0495584_0315418 3300046491 Unclassified 794
496 Ga0495594_0666203 3300046499 Unclassified 589
497 Ga0495608_0216353 3300046511 Unclassified 1203
498 Ga0495665_0143798 3300046531 Bacteria 1246
499 Ga0495635_0574628 3300046663 Unclassified 737
500 Ga0495646_0635665 3300046680 Unclassified 540
501 Ga0495647_0188540 3300046681 Unclassified 900
502 Ga0495658_0212891 3300046683 Unclassified 1208
503 Ga0495613_0867479 3300046689 Unclassified 586
504 Ga0495600_0262385 3300046809 Bacteria 1097
505 Ga0495674_0187942 3300047319 Unclassified 1718
506 Ga0495680_0313824 3300047322 Unclassified 1098
507 Ga0496100_0608762 3300048903 Bacteria 849
508 Ga0496100_1091623 3300048903 Bacteria 629
509 Ga0496101_0042375 3300048904 Unclassified 3249
510 Ga0496101_0498539 3300048904 Bacteria 962
511 Ga0496102_0196665 3300048905 Bacteria 1900
512 Ga0496102_0329723 3300048905 Bacteria 1438
513 Ga0496102_0358305 3300048905 Bacteria 1373
514 Ga0496103_0213205 3300048906 Bacteria 1242
515 Ga0496104_0002907 3300048907 Bacteria 14760
516 Ga0496104_0017375 3300048907 Bacteria 6549
517 Ga0496104_0384309 3300048907 Unclassified 1316
518 Ga0496105_0120171 3300048908 Bacteria 2167
519 Ga0496105_0219377 3300048908 Unclassified 1548
520 Ga0496105_0256244 3300048908 Bacteria 1416
521 Ga0496106_0039270 3300048909 Bacteria 3545
522 Ga0496106_0349194 3300048909 Bacteria 1188
523 Ga0496106_0694468 3300048909 Unclassified 811
524 Ga0496107_0142941 3300048910 Bacteria 1769
525 Ga0496107_0164442 3300048910 Bacteria 1645
526 Ga0496107_0876585 3300048910 Bacteria 655
527 Ga0496108_0010864 3300048911 Bacteria 7392
528 Ga0496108_0017366 3300048911 Bacteria 5887
529 Ga0496108_0059111 3300048911 Bacteria 3224
530 Ga0496108_0148234 3300048911 Bacteria 2024
531 Ga0496108_1154686 3300048911 Bacteria 656
532 Ga0496109_0004820 3300048912 Bacteria 11261
533 Ga0496109_0166418 3300048912 Bacteria 2067
534 Ga0496109_0563265 3300048912 Unclassified 1075
535 Ga0496109_1032605 3300048912 Unclassified 759
536 Ga0496109_1231207 3300048912 Unclassified 685
537 Ga0496109_1688467 3300048912 Bacteria 567
538 Ga0496109_2042789 3300048912 Bacteria 505
539 Ga0496110_0031719 3300048913 Bacteria 4561
540 Ga0496110_0210157 3300048913 Bacteria 1769
541 Ga0496111_0238681 3300048914 Bacteria 1350
542 Ga0496111_0247296 3300048914 Bacteria 1324
543 Ga0496111_0459633 3300048914 Bacteria 939
544 Ga0496112_0006980 3300048915 Bacteria 9969
545 Ga0496112_0064157 3300048915 Bacteria 3624
546 Ga0496112_0073850 3300048915 Bacteria 3371
547 Ga0496112_0578529 3300048915 Bacteria 1056
548 Ga0496112_0823680 3300048915 Unclassified 852
549 Ga0496113_0016065 3300048916 Bacteria 5165
550 Ga0496113_0181019 3300048916 Bacteria 1671
551 Ga0496113_0388694 3300048916 Bacteria 1120
552 Ga0496113_0643922 3300048916 Unclassified 848
553 Ga0496114_0006946 3300048917 Bacteria 8917
554 Ga0496114_0027544 3300048917 Bacteria 4656
555 Ga0496114_0045450 3300048917 Bacteria 3648
556 Ga0496114_0247522 3300048917 Bacteria 1568
557 Ga0496115_0009463 3300048918 Bacteria 7238
558 Ga0496115_0399072 3300048918 Bacteria 1116
559 Ga0501299_003046 3300049522 Bacteria 2391
560 Ga0501318_040946 3300049534 Unclassified 662
561 Ga0501032_0002549 3300049569 Bacteria 14258
562 Ga0501032_0432062 3300049569 Bacteria 844
563 Ga0501034_0000096 3300049571 Bacteria 161155
564 Ga0501034_0005171 3300049571 Bacteria 14311
565 Ga0501036_0003288 3300049572 Bacteria 12889
566 Ga0501036_0017391 3300049572 Bacteria 6011
567 Ga0501037_0294212 3300049573 Bacteria 1129
568 Ga0501038_0002622 3300049574 Bacteria 16807
569 Ga0501038_0049975 3300049574 Bacteria 3613
570 Ga0501038_0427269 3300049574 Bacteria 1021
571 Ga0501039_0003272 3300049575 Bacteria 12110
572 Ga0501040_0001492 3300049576 Bacteria 14846
573 Ga0501040_0056405 3300049576 Bacteria 2696
574 Ga0501041_0004752 3300049577 Bacteria 7883
575 Ga0501041_0015708 3300049577 Bacteria 4496
576 Ga0501041_0452402 3300049577 Bacteria 815
577 Ga0501042_0000116 3300049578 Bacteria 33871
578 Ga0501042_0018587 3300049578 Bacteria 4814
579 Ga0501042_1197302 3300049578 Bacteria 554
580 Ga0501043_0014740 3300049579 Bacteria 6120
581 Ga0501043_0046599 3300049579 Bacteria 3409
582 Ga0501046_0001229 3300049580 Bacteria 24836
583 Ga0501046_0003365 3300049580 Bacteria 14690
584 Ga0501046_0036243 3300049580 Bacteria 3971
585 Ga0501047_0000008 3300049581 Bacteria 441758
586 Ga0501048_0001070 3300049582 Bacteria 20523
587 Ga0501048_0001118 3300049582 Bacteria 20134
588 Ga0501048_0071263 3300049582 Bacteria 2453
589 Ga0501067_0009814 3300049583 Bacteria 5299
590 Ga0501067_0022554 3300049583 Bacteria 3484
591 Ga0501067_0181840 3300049583 Unclassified 1171
592 Ga0501068_0047850 3300049584 Bacteria 2580
593 Ga0501068_1150993 3300049584 Bacteria 513
594 Ga0501069_0002263 3300049585 Bacteria 9718
595 Ga0501070_0002869 3300049586 Bacteria 15012
596 Ga0501070_0011220 3300049586 Bacteria 7565
597 Ga0501071_0002369 3300049587 Bacteria 11409
598 Ga0501071_0030557 3300049587 Bacteria 3811
599 Ga0501071_0214844 3300049587 Bacteria 1447
600 Ga0501072_0000153 3300049588 Bacteria 51166
601 Ga0501072_0003182 3300049588 Bacteria 12348
602 Ga0501072_0307862 3300049588 Bacteria 1259
603 Ga0501073_0007388 3300049589 Bacteria 8169
604 Ga0501073_0022856 3300049589 Bacteria 4497
605 Ga0501074_0001110 3300049590 Bacteria 17548
606 Ga0501074_0002631 3300049590 Bacteria 12571
607 Ga0501074_0023368 3300049590 Bacteria 4495
608 Ga0501075_0001696 3300049591 Bacteria 14485
609 Ga0501076_0008270 3300049592 Bacteria 7622
610 Ga0501076_0047792 3300049592 Bacteria 3383
611 Ga0501077_0000711 3300049593 Bacteria 20088
612 Ga0501077_0037687 3300049593 Bacteria 3078
613 Ga0501077_0154574 3300049593 Bacteria 1456
614 Ga0501224_055617 3300049664 Unclassified 612
615 Ga0501235_036898 3300049669 Bacteria 1112
616 Ga0501221_038899 3300049704 Unclassified 1029
617 Ga0501225_0181055 3300049705 Unclassified 659
618 Ga0501234_005810 3300049707 Viruses 1928
619 Ga0501079_0000084 3300049741 Bacteria 44872
620 Ga0501079_0000221 3300049741 Bacteria 33871
621 Ga0501079_0043637 3300049741 Bacteria 3461
622 Ga0501079_0278575 3300049741 Bacteria 1308
623 Ga0501079_0539601 3300049741 Bacteria 917
624 Ga0501080_0002637 3300049742 Bacteria 15700
625 Ga0501080_0024552 3300049742 Bacteria 5588
626 Ga0501081_0000284 3300049743 Bacteria 26831
627 Ga0501081_0017319 3300049743 Bacteria 4767
628 Ga0501083_0006749 3300049744 Bacteria 8145
629 Ga0501083_0041386 3300049744 Bacteria 3125
630 Ga0501083_0058600 3300049744 Bacteria 2576
631 Ga0501083_0300263 3300049744 Bacteria 1044
632 Ga0501268_055212 3300049765 Unclassified 777
633 Ga0501270_014917 3300049767 Unclassified 1102
634 Ga0501283_013278 3300049779 Bacteria 1246
635 Ga0501035_0032783 3300049822 Bacteria 4724
636 Ga0501035_1002459 3300049822 Bacteria 657
637 Ga0501044_0045490 3300049823 Bacteria 4546
638 Ga0501045_0000729 3300049824 Bacteria 20961
639 Ga0501045_0028445 3300049824 Bacteria 4032
640 Ga0501045_0600822 3300049824 Unclassified 815
641 nmdc:mga05p37_1036991_c1 3300050507 Unclassified 867
642 nmdc:mga05p37_2275938_c1 3300050507 Unclassified 500
643 nmdc:mga05p37_323935_c1 3300050507 Unclassified 1823
644 nmdc:mga05p37_75706_c1 3300050507 Bacteria 4143
645 nmdc:mga05p37_78549_c1 3300050507 Bacteria 4064
646 nmdc:mga09592_1216049_c1 3300050508 Bacteria 622
647 nmdc:mga09592_62030_c1 3300050508 Bacteria 3162
648 nmdc:mga0qj67_302611_c1 3300050509 Bacteria 1295
649 nmdc:mga06r32_691657_c1 3300050510 Bacteria 986
650 nmdc:mga08y16_19023_c1 3300050511 Bacteria 7234
651 nmdc:mga08y16_472940_c1 3300050511 Unclassified 1276
652 nmdc:mga0rr50_1060058_c1 3300050513 Bacteria 690
653 nmdc:mga0rr50_74809_c1 3300050513 Bacteria 2594
654 nmdc:mga08x19_32336_c1 3300050514 Bacteria 3295
655 nmdc:mga08x19_356378_c1 3300050514 Bacteria 1022
656 nmdc:mga08x19_746418_c1 3300050514 Bacteria 695
657 nmdc:mga08x19_93386_c1 3300050514 Unclassified 1988
658 nmdc:mga0a205_16021_c1 3300050515 Bacteria 7016
659 Ga0495601_0151470 3300053077 Bacteria 1514
660 Ga0495612_0325431 3300053078 Unclassified 692
661 Ga0501084_0000135 3300054114 Bacteria 56033
662 Ga0501084_0003048 3300054114 Bacteria 13579
663 Ga0501084_0068893 3300054114 Bacteria 2961
664 Ga0501082_0001674 3300060353 Bacteria 19551
665 Ga0501082_0003297 3300060353 Bacteria 14087
666 Ga0501082_0039818 3300060353 Bacteria 4054
667 Ga0530510_0002740 3300061734 Bacteria 12110
668 Ga0530510_0036572 3300061734 Bacteria 3538
669 Ga0530510_0308797 3300061734 Bacteria 1184
670 Ga0530510_0947455 3300061734 Bacteria 658

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100015034 Ga0070708_1000150344 111
2 3300005445 Ga0070708_100184211 Ga0070708_1001842112 111
3 3300005468 Ga0070707_100083777 Ga0070707_1000837774 111
4 3300007265 Ga0099794_10071376 Ga0099794_100713762 111
5 3300025922 Ga0207646_10019484 Ga0207646_100194842 111
6 3300005468 Ga0070707_100000030 Ga0070707_10000003081 122
7 3300005468 Ga0070707_100367042 Ga0070707_1003670422 122
8 3300005536 Ga0070697_100130966 Ga0070697_1001309663 122
9 3300007265 Ga0099794_10003801 Ga0099794_100038012 122
10 3300007265 Ga0099794_10045626 Ga0099794_100456263 122
11 3300007265 Ga0099794_10548685 Ga0099794_105486851 122
12 3300025922 Ga0207646_10078224 Ga0207646_100782242 122
13 3300025922 Ga0207646_10079498 Ga0207646_100794982 122
14 3300027671 Ga0209588_1000238 Ga0209588_10002383 122
15 3300027671 Ga0209588_1047006 Ga0209588_10470061 122
16 3300013308 Ga0157375_10623568 Ga0157375_106235682 123
17 3300005331 Ga0070670_100000040 Ga0070670_100000040125 124
18 3300005434 Ga0070709_10248779 Ga0070709_102487792 124
19 3300005440 Ga0070705_100029428 Ga0070705_1000294284 124
20 3300005445 Ga0070708_100005220 Ga0070708_1000052205 124
21 3300005458 Ga0070681_10364398 Ga0070681_103643982 124
22 3300005467 Ga0070706_100021405 Ga0070706_1000214055 124
23 3300005518 Ga0070699_100372459 Ga0070699_1003724592 124
24 3300005535 Ga0070684_100171712 Ga0070684_1001717122 124
25 3300005578 Ga0068854_100005336 Ga0068854_1000053362 124
26 3300005578 Ga0068854_100024287 Ga0068854_1000242871 124
27 3300006173 Ga0070716_100151662 Ga0070716_1001516622 124
28 3300006358 Ga0068871_100095394 Ga0068871_1000953943 124
29 3300013296 Ga0157374_10000021 Ga0157374_1000002120 124
30 3300014745 Ga0157377_10000023 Ga0157377_1000002319 124
31 3300014969 Ga0157376_10000006 Ga0157376_10000006125 124
32 3300025906 Ga0207699_10413225 Ga0207699_104132252 124
33 3300025910 Ga0207684_10080379 Ga0207684_100803795 124
34 3300025915 Ga0207693_10028023 Ga0207693_100280237 124
35 3300025922 Ga0207646_10034164 Ga0207646_100341644 124
36 3300025925 Ga0207650_10000067 Ga0207650_1000006769 124
37 3300025939 Ga0207665_10041424 Ga0207665_100414242 124
38 3300025981 Ga0207640_10019319 Ga0207640_100193192 124
39 3300025981 Ga0207640_10350171 Ga0207640_103501711 124
40 3300026023 Ga0207677_10000133 Ga0207677_100001332 124
41 3300031852 Ga0307410_10858678 Ga0307410_108586781 124
42 3300032004 Ga0307414_11274225 Ga0307414_112742251 124
43 3300035089 Ga0373944_0069616 Ga0373944_0069616_293_673 124
44 3300050514 nmdc:mga08x19_356378_c1 nmdc:mga08x19_356378_c1_345_722 124
45 2162886011 MRS1b_contig_551986 MRS1b_0010.00001620 125
46 3300000549 LJQas_1000046 LJQas_10000464 125
47 3300002459 JGI24751J29686_10039302 JGI24751J29686_100393022 125
48 3300002459 JGI24751J29686_10083194 JGI24751J29686_100831941 125
49 3300003203 JGI25406J46586_10017975 JGI25406J46586_100179753 125
50 3300003203 JGI25406J46586_10101567 JGI25406J46586_101015671 125
51 3300005290 Ga0065712_10000329 Ga0065712_1000032912 125
52 3300005290 Ga0065712_10004655 Ga0065712_100046556 125
53 3300005293 Ga0065715_10001890 Ga0065715_100018906 125
54 3300005293 Ga0065715_10126324 Ga0065715_101263243 125
55 3300005293 Ga0065715_10181738 Ga0065715_101817383 125
56 3300005295 Ga0065707_10166691 Ga0065707_101666912 125
57 3300005295 Ga0065707_10383896 Ga0065707_103838962 125
58 3300005328 Ga0070676_10007361 Ga0070676_100073613 125
59 3300005328 Ga0070676_10103048 Ga0070676_101030482 125
60 3300005328 Ga0070676_10595593 Ga0070676_105955932 125
61 3300005329 Ga0070683_101354420 Ga0070683_1013544202 125
62 3300005330 Ga0070690_100307618 Ga0070690_1003076182 125
63 3300005330 Ga0070690_100773823 Ga0070690_1007738231 125
64 3300005331 Ga0070670_100000177 Ga0070670_10000017712 125
65 3300005331 Ga0070670_100002961 Ga0070670_1000029615 125
66 3300005331 Ga0070670_100008026 Ga0070670_10000802610 125
67 3300005331 Ga0070670_100075366 Ga0070670_1000753662 125
68 3300005334 Ga0068869_100710809 Ga0068869_1007108092 125
69 3300005334 Ga0068869_101943091 Ga0068869_1019430911 125
70 3300005336 Ga0070680_101371364 Ga0070680_1013713641 125
71 3300005337 Ga0070682_101666982 Ga0070682_1016669821 125
72 3300005338 Ga0068868_100179457 Ga0068868_1001794573 125
73 3300005338 Ga0068868_100433762 Ga0068868_1004337622 125
74 3300005340 Ga0070689_100056898 Ga0070689_1000568982 125
75 3300005340 Ga0070689_100231183 Ga0070689_1002311833 125
76 3300005340 Ga0070689_100808792 Ga0070689_1008087921 125
77 3300005341 Ga0070691_10003956 Ga0070691_100039566 125
78 3300005341 Ga0070691_10724514 Ga0070691_107245141 125
79 3300005343 Ga0070687_100492089 Ga0070687_1004920891 125
80 3300005343 Ga0070687_100760963 Ga0070687_1007609632 125
81 3300005345 Ga0070692_10276731 Ga0070692_102767312 125
82 3300005345 Ga0070692_10462046 Ga0070692_104620462 125
83 3300005347 Ga0070668_100015638 Ga0070668_1000156387 125
84 3300005353 Ga0070669_100051607 Ga0070669_1000516072 125
85 3300005353 Ga0070669_100211602 Ga0070669_1002116022 125
86 3300005353 Ga0070669_100385179 Ga0070669_1003851792 125
87 3300005354 Ga0070675_100049947 Ga0070675_1000499473 125
88 3300005354 Ga0070675_100085282 Ga0070675_1000852823 125
89 3300005354 Ga0070675_100486313 Ga0070675_1004863131 125
90 3300005354 Ga0070675_100554867 Ga0070675_1005548672 125
91 3300005355 Ga0070671_100033098 Ga0070671_1000330983 125
92 3300005355 Ga0070671_100224742 Ga0070671_1002247422 125
93 3300005355 Ga0070671_100809206 Ga0070671_1008092062 125
94 3300005356 Ga0070674_100002662 Ga0070674_10000266210 125
95 3300005356 Ga0070674_100005767 Ga0070674_1000057672 125
96 3300005356 Ga0070674_100075290 Ga0070674_1000752903 125
97 3300005364 Ga0070673_100163106 Ga0070673_1001631064 125
98 3300005364 Ga0070673_100168830 Ga0070673_1001688303 125
99 3300005364 Ga0070673_100425051 Ga0070673_1004250512 125
100 3300005364 Ga0070673_100609210 Ga0070673_1006092102 125
101 3300005365 Ga0070688_100008752 Ga0070688_1000087524 125
102 3300005365 Ga0070688_100010798 Ga0070688_1000107982 125
103 3300005365 Ga0070688_100459181 Ga0070688_1004591813 125
104 3300005366 Ga0070659_100088747 Ga0070659_1000887472 125
105 3300005367 Ga0070667_100316736 Ga0070667_1003167363 125
106 3300005367 Ga0070667_100398187 Ga0070667_1003981873 125
107 3300005406 Ga0070703_10048321 Ga0070703_100483212 125
108 3300005438 Ga0070701_10022642 Ga0070701_100226422 125
109 3300005438 Ga0070701_10151103 Ga0070701_101511032 125
110 3300005440 Ga0070705_100006397 Ga0070705_1000063972 125
111 3300005440 Ga0070705_100458119 Ga0070705_1004581192 125
112 3300005441 Ga0070700_100009994 Ga0070700_1000099946 125
113 3300005441 Ga0070700_100011679 Ga0070700_1000116793 125
114 3300005441 Ga0070700_100026025 Ga0070700_1000260251 125
115 3300005441 Ga0070700_100436678 Ga0070700_1004366781 125
116 3300005441 Ga0070700_100665313 Ga0070700_1006653132 125
117 3300005444 Ga0070694_100058835 Ga0070694_1000588353 125
118 3300005444 Ga0070694_100786013 Ga0070694_1007860131 125
119 3300005445 Ga0070708_101067551 Ga0070708_1010675512 125
120 3300005456 Ga0070678_100096650 Ga0070678_1000966501 125
121 3300005456 Ga0070678_100187374 Ga0070678_1001873743 125
122 3300005457 Ga0070662_100714127 Ga0070662_1007141272 125
123 3300005459 Ga0068867_100017807 Ga0068867_1000178072 125
124 3300005459 Ga0068867_100145891 Ga0068867_1001458912 125
125 3300005459 Ga0068867_100178754 Ga0068867_1001787542 125
126 3300005459 Ga0068867_100460233 Ga0068867_1004602331 125
127 3300005459 Ga0068867_100677151 Ga0068867_1006771512 125
128 3300005459 Ga0068867_101016165 Ga0068867_1010161652 125
129 3300005466 Ga0070685_10011459 Ga0070685_100114594 125
130 3300005466 Ga0070685_10024892 Ga0070685_100248923 125
131 3300005466 Ga0070685_10045911 Ga0070685_100459112 125
132 3300005467 Ga0070706_100000223 Ga0070706_10000022335 125
133 3300005467 Ga0070706_100061416 Ga0070706_1000614162 125
134 3300005467 Ga0070706_100338406 Ga0070706_1003384062 125
135 3300005468 Ga0070707_100244169 Ga0070707_1002441692 125
136 3300005468 Ga0070707_100413735 Ga0070707_1004137353 125
137 3300005471 Ga0070698_100004458 Ga0070698_1000044583 125
138 3300005507 Ga0074259_10176926 Ga0074259_101769262 125
139 3300005518 Ga0070699_100650597 Ga0070699_1006505972 125
140 3300005518 Ga0070699_101443933 Ga0070699_1014439331 125
141 3300005535 Ga0070684_100176135 Ga0070684_1001761352 125
142 3300005535 Ga0070684_100633334 Ga0070684_1006333342 125
143 3300005535 Ga0070684_100804320 Ga0070684_1008043202 125
144 3300005536 Ga0070697_100131712 Ga0070697_1001317122 125
145 3300005536 Ga0070697_101336689 Ga0070697_1013366891 125
146 3300005539 Ga0068853_100176180 Ga0068853_1001761803 125
147 3300005539 Ga0068853_101394995 Ga0068853_1013949951 125
148 3300005543 Ga0070672_100004106 Ga0070672_1000041067 125
149 3300005543 Ga0070672_100551720 Ga0070672_1005517202 125
150 3300005543 Ga0070672_100671494 Ga0070672_1006714942 125
151 3300005543 Ga0070672_101368958 Ga0070672_1013689581 125
152 3300005544 Ga0070686_100008839 Ga0070686_1000088394 125
153 3300005544 Ga0070686_100100640 Ga0070686_1001006404 125
154 3300005544 Ga0070686_100167064 Ga0070686_1001670642 125
155 3300005545 Ga0070695_100009270 Ga0070695_1000092705 125
156 3300005545 Ga0070695_100157247 Ga0070695_1001572472 125
157 3300005546 Ga0070696_100004210 Ga0070696_1000042106 125
158 3300005546 Ga0070696_100269509 Ga0070696_1002695091 125
159 3300005548 Ga0070665_100011544 Ga0070665_10001154410 125
160 3300005548 Ga0070665_100518880 Ga0070665_1005188802 125
161 3300005549 Ga0070704_100006282 Ga0070704_1000062826 125
162 3300005549 Ga0070704_100545869 Ga0070704_1005458693 125
163 3300005549 Ga0070704_100923341 Ga0070704_1009233412 125
164 3300005563 Ga0068855_100930783 Ga0068855_1009307832 125
165 3300005563 Ga0068855_101356614 Ga0068855_1013566142 125
166 3300005564 Ga0070664_100465160 Ga0070664_1004651601 125
167 3300005578 Ga0068854_100326574 Ga0068854_1003265742 125
168 3300005578 Ga0068854_100612274 Ga0068854_1006122741 125
169 3300005578 Ga0068854_100751779 Ga0068854_1007517792 125
170 3300005614 Ga0068856_100053873 Ga0068856_1000538732 125
171 3300005614 Ga0068856_100997029 Ga0068856_1009970292 125
172 3300005615 Ga0070702_100008040 Ga0070702_1000080403 125
173 3300005615 Ga0070702_100134791 Ga0070702_1001347913 125
174 3300005616 Ga0068852_100841993 Ga0068852_1008419932 125
175 3300005616 Ga0068852_102779818 Ga0068852_1027798182 125
176 3300005617 Ga0068859_100075274 Ga0068859_1000752744 125
177 3300005617 Ga0068859_100231920 Ga0068859_1002319203 125
178 3300005617 Ga0068859_100423725 Ga0068859_1004237251 125
179 3300005617 Ga0068859_102414827 Ga0068859_1024148272 125
180 3300005618 Ga0068864_100057981 Ga0068864_1000579812 125
181 3300005618 Ga0068864_100160576 Ga0068864_1001605762 125
182 3300005718 Ga0068866_10039141 Ga0068866_100391412 125
183 3300005718 Ga0068866_10111378 Ga0068866_101113782 125
184 3300005718 Ga0068866_10132054 Ga0068866_101320542 125
185 3300005718 Ga0068866_10179224 Ga0068866_101792242 125
186 3300005718 Ga0068866_10205655 Ga0068866_102056552 125
187 3300005719 Ga0068861_100306023 Ga0068861_1003060232 125
188 3300005719 Ga0068861_101245452 Ga0068861_1012454522 125
189 3300005834 Ga0068851_10993439 Ga0068851_109934391 125
190 3300005840 Ga0068870_10000685 Ga0068870_100006853 125
191 3300005840 Ga0068870_10166252 Ga0068870_101662522 125
192 3300005840 Ga0068870_10203436 Ga0068870_102034362 125
193 3300005841 Ga0068863_100043250 Ga0068863_1000432505 125
194 3300005841 Ga0068863_100048593 Ga0068863_1000485933 125
195 3300005842 Ga0068858_100548654 Ga0068858_1005486542 125
196 3300005842 Ga0068858_100604918 Ga0068858_1006049182 125
197 3300005843 Ga0068860_100151563 Ga0068860_1001515633 125
198 3300005843 Ga0068860_100847786 Ga0068860_1008477861 125
199 3300005843 Ga0068860_100950722 Ga0068860_1009507222 125
200 3300005843 Ga0068860_101168907 Ga0068860_1011689071 125
201 3300005844 Ga0068862_100244414 Ga0068862_1002444142 125
202 3300005844 Ga0068862_100874656 Ga0068862_1008746561 125
203 3300005844 Ga0068862_101138925 Ga0068862_1011389252 125
204 3300005981 Ga0081538_10052075 Ga0081538_100520752 125
205 3300005985 Ga0081539_10000041 Ga0081539_10000041115 125
206 3300005985 Ga0081539_10010708 Ga0081539_100107085 125
207 3300006028 Ga0070717_11659735 Ga0070717_116597352 125
208 3300006173 Ga0070716_100064759 Ga0070716_1000647592 125
209 3300006173 Ga0070716_101140262 Ga0070716_1011402622 125
210 3300006175 Ga0070712_100522929 Ga0070712_1005229293 125
211 3300006237 Ga0097621_100007602 Ga0097621_1000076022 125
212 3300006237 Ga0097621_100214551 Ga0097621_1002145513 125
213 3300006237 Ga0097621_100240940 Ga0097621_1002409402 125
214 3300006358 Ga0068871_100051751 Ga0068871_1000517512 125
215 3300006358 Ga0068871_101652148 Ga0068871_1016521481 125
216 3300006358 Ga0068871_101768044 Ga0068871_1017680442 125
217 3300006844 Ga0075428_100107143 Ga0075428_1001071432 125
218 3300006846 Ga0075430_100687286 Ga0075430_1006872862 125
219 3300006847 Ga0075431_100092902 Ga0075431_1000929022 125
220 3300006871 Ga0075434_100060885 Ga0075434_1000608853 125
221 3300006881 Ga0068865_100399369 Ga0068865_1003993692 125
222 3300006881 Ga0068865_100665003 Ga0068865_1006650032 125
223 3300006881 Ga0068865_100943391 Ga0068865_1009433912 125
224 3300006914 Ga0075436_100030397 Ga0075436_1000303973 125
225 3300006914 Ga0075436_100179751 Ga0075436_1001797512 125
226 3300006914 Ga0075436_100797866 Ga0075436_1007978662 125
227 3300006931 Ga0097620_100075280 Ga0097620_1000752804 125
228 3300006931 Ga0097620_100231937 Ga0097620_1002319373 125
229 3300006931 Ga0097620_100423749 Ga0097620_1004237491 125
230 3300006931 Ga0097620_102415603 Ga0097620_1024156032 125
231 3300007076 Ga0075435_100033994 Ga0075435_1000339942 125
232 3300007076 Ga0075435_100832320 Ga0075435_1008323202 125
233 3300007076 Ga0075435_101292226 Ga0075435_1012922261 125
234 3300009093 Ga0105240_10662715 Ga0105240_106627152 125
235 3300009093 Ga0105240_11205569 Ga0105240_112055692 125
236 3300009093 Ga0105240_11662143 Ga0105240_116621432 125
237 3300009094 Ga0111539_10024118 Ga0111539_100241183 125
238 3300009094 Ga0111539_10071959 Ga0111539_100719594 125
239 3300009094 Ga0111539_10275055 Ga0111539_102750552 125
240 3300009098 Ga0105245_10049106 Ga0105245_100491063 125
241 3300009098 Ga0105245_10085806 Ga0105245_100858062 125
242 3300009098 Ga0105245_10107876 Ga0105245_101078762 125
243 3300009098 Ga0105245_10156900 Ga0105245_101569003 125
244 3300009098 Ga0105245_10369223 Ga0105245_103692233 125
245 3300009098 Ga0105245_12283323 Ga0105245_122833232 125
246 3300009101 Ga0105247_10062295 Ga0105247_100622952 125
247 3300009101 Ga0105247_10065435 Ga0105247_100654354 125
248 3300009101 Ga0105247_10354561 Ga0105247_103545611 125
249 3300009101 Ga0105247_10548011 Ga0105247_105480112 125
250 3300009147 Ga0114129_10032907 Ga0114129_1003290710 125
251 3300009147 Ga0114129_10662521 Ga0114129_106625212 125
252 3300009147 Ga0114129_12040153 Ga0114129_120401532 125
253 3300009147 Ga0114129_13401282 Ga0114129_134012822 125
254 3300009148 Ga0105243_10048809 Ga0105243_100488092 125
255 3300009148 Ga0105243_10133199 Ga0105243_101331992 125
256 3300009148 Ga0105243_10482566 Ga0105243_104825662 125
257 3300009148 Ga0105243_10986333 Ga0105243_109863332 125
258 3300009174 Ga0105241_10037969 Ga0105241_100379694 125
259 3300009174 Ga0105241_10729206 Ga0105241_107292061 125
260 3300009174 Ga0105241_11187614 Ga0105241_111876142 125
261 3300009176 Ga0105242_10078817 Ga0105242_100788173 125
262 3300009176 Ga0105242_10087129 Ga0105242_100871293 125
263 3300009177 Ga0105248_10023640 Ga0105248_100236402 125
264 3300009177 Ga0105248_10125076 Ga0105248_101250763 125
265 3300009177 Ga0105248_10203480 Ga0105248_102034803 125
266 3300009177 Ga0105248_10721139 Ga0105248_107211392 125
267 3300009545 Ga0105237_10294931 Ga0105237_102949312 125
268 3300009545 Ga0105237_10313901 Ga0105237_103139012 125
269 3300009545 Ga0105237_10557922 Ga0105237_105579221 125
270 3300009551 Ga0105238_10420704 Ga0105238_104207043 125
271 3300009553 Ga0105249_11195378 Ga0105249_111953782 125
272 3300009553 Ga0105249_11457354 Ga0105249_114573541 125
273 3300010375 Ga0105239_10066883 Ga0105239_100668831 125
274 3300010375 Ga0105239_10105613 Ga0105239_101056135 125
275 3300010375 Ga0105239_10149616 Ga0105239_101496164 125
276 3300010375 Ga0105239_11223802 Ga0105239_112238022 125
277 3300010375 Ga0105239_12765785 Ga0105239_127657851 125
278 3300011119 Ga0105246_10012343 Ga0105246_100123433 125
279 3300011119 Ga0105246_10014513 Ga0105246_100145134 125
280 3300011119 Ga0105246_10235892 Ga0105246_102358923 125
281 3300011119 Ga0105246_10241382 Ga0105246_102413821 125
282 3300011119 Ga0105246_10470315 Ga0105246_104703152 125
283 3300011119 Ga0105246_11064072 Ga0105246_110640721 125
284 3300011119 Ga0105246_12195017 Ga0105246_121950171 125
285 3300012485 Ga0157325_1011236 Ga0157325_10112361 125
286 3300013100 Ga0157373_10582196 Ga0157373_105821962 125
287 3300013296 Ga0157374_10564085 Ga0157374_105640853 125
288 3300013297 Ga0157378_10680324 Ga0157378_106803243 125
289 3300013297 Ga0157378_11122521 Ga0157378_111225212 125
290 3300013306 Ga0163162_10046559 Ga0163162_100465592 125
291 3300013306 Ga0163162_10260284 Ga0163162_102602842 125
292 3300013306 Ga0163162_11219563 Ga0163162_112195632 125
293 3300013307 Ga0157372_10039849 Ga0157372_100398492 125
294 3300013307 Ga0157372_11154790 Ga0157372_111547901 125
295 3300013308 Ga0157375_10007205 Ga0157375_100072053 125
296 3300013308 Ga0157375_10243171 Ga0157375_102431712 125
297 3300013308 Ga0157375_10531628 Ga0157375_105316283 125
298 3300014325 Ga0163163_10000275 Ga0163163_100002756 125
299 3300014325 Ga0163163_10034702 Ga0163163_100347023 125
300 3300014325 Ga0163163_10034994 Ga0163163_100349942 125
301 3300014325 Ga0163163_10159998 Ga0163163_101599983 125
302 3300014325 Ga0163163_10201557 Ga0163163_102015572 125
303 3300014325 Ga0163163_10503686 Ga0163163_105036863 125
304 3300014325 Ga0163163_10691785 Ga0163163_106917852 125
305 3300014326 Ga0157380_10015409 Ga0157380_100154095 125
306 3300014326 Ga0157380_10500316 Ga0157380_105003161 125
307 3300014326 Ga0157380_10879268 Ga0157380_108792682 125
308 3300014745 Ga0157377_10038673 Ga0157377_100386733 125
309 3300014968 Ga0157379_10083735 Ga0157379_100837352 125
310 3300014968 Ga0157379_10382350 Ga0157379_103823502 125
311 3300014968 Ga0157379_10390799 Ga0157379_103907993 125
312 3300014968 Ga0157379_10457255 Ga0157379_104572552 125
313 3300014968 Ga0157379_10634312 Ga0157379_106343121 125
314 3300014969 Ga0157376_10227683 Ga0157376_102276833 125
315 3300014969 Ga0157376_10404916 Ga0157376_104049162 125
316 3300014969 Ga0157376_10426217 Ga0157376_104262171 125
317 3300014969 Ga0157376_10900718 Ga0157376_109007182 125
318 3300014969 Ga0157376_11139343 Ga0157376_111393432 125
319 3300017792 Ga0163161_10003469 Ga0163161_100034696 125
320 3300017792 Ga0163161_10655606 Ga0163161_106556062 125
321 3300020080 Ga0206350_10676508 Ga0206350_106765082 125
322 3300021361 Ga0213872_10131334 Ga0213872_101313342 125
323 3300021361 Ga0213872_10212946 Ga0213872_102129462 125
324 3300021361 Ga0213872_10432780 Ga0213872_104327801 125
325 3300021441 Ga0213871_10119803 Ga0213871_101198031 125
326 3300025271 Ga0207666_1013868 Ga0207666_10138682 125
327 3300025315 Ga0207697_10163975 Ga0207697_101639753 125
328 3300025321 Ga0207656_10524668 Ga0207656_105246681 125
329 3300025885 Ga0207653_10030087 Ga0207653_100300872 125
330 3300025893 Ga0207682_10086507 Ga0207682_100865073 125
331 3300025899 Ga0207642_10325624 Ga0207642_103256242 125
332 3300025899 Ga0207642_10529486 Ga0207642_105294861 125
333 3300025899 Ga0207642_10558153 Ga0207642_105581532 125
334 3300025900 Ga0207710_10002045 Ga0207710_100020452 125
335 3300025900 Ga0207710_10029486 Ga0207710_100294864 125
336 3300025901 Ga0207688_10018235 Ga0207688_100182354 125
337 3300025901 Ga0207688_10037933 Ga0207688_100379334 125
338 3300025901 Ga0207688_10477918 Ga0207688_104779182 125
339 3300025903 Ga0207680_10333288 Ga0207680_103332882 125
340 3300025904 Ga0207647_10190651 Ga0207647_101906512 125
341 3300025907 Ga0207645_10005026 Ga0207645_100050268 125
342 3300025907 Ga0207645_10065785 Ga0207645_100657852 125
343 3300025907 Ga0207645_10135881 Ga0207645_101358812 125
344 3300025908 Ga0207643_10111670 Ga0207643_101116702 125
345 3300025910 Ga0207684_10000312 Ga0207684_1000031223 125
346 3300025910 Ga0207684_10133471 Ga0207684_101334712 125
347 3300025910 Ga0207684_10352001 Ga0207684_103520013 125
348 3300025911 Ga0207654_10518770 Ga0207654_105187702 125
349 3300025914 Ga0207671_10146994 Ga0207671_101469943 125
350 3300025914 Ga0207671_10430405 Ga0207671_104304053 125
351 3300025918 Ga0207662_10263518 Ga0207662_102635182 125
352 3300025918 Ga0207662_10486974 Ga0207662_104869742 125
353 3300025921 Ga0207652_10128962 Ga0207652_101289623 125
354 3300025922 Ga0207646_10574687 Ga0207646_105746872 125
355 3300025923 Ga0207681_10011395 Ga0207681_100113952 125
356 3300025923 Ga0207681_10209415 Ga0207681_102094152 125
357 3300025923 Ga0207681_10388212 Ga0207681_103882122 125
358 3300025923 Ga0207681_10742380 Ga0207681_107423802 125
359 3300025923 Ga0207681_11350182 Ga0207681_113501822 125
360 3300025923 Ga0207681_11622475 Ga0207681_116224751 125
361 3300025924 Ga0207694_10497689 Ga0207694_104976892 125
362 3300025924 Ga0207694_10549947 Ga0207694_105499472 125
363 3300025925 Ga0207650_10000103 Ga0207650_1000010365 125
364 3300025925 Ga0207650_10006716 Ga0207650_100067164 125
365 3300025925 Ga0207650_10015003 Ga0207650_100150033 125
366 3300025925 Ga0207650_10120620 Ga0207650_101206202 125
367 3300025925 Ga0207650_10503493 Ga0207650_105034932 125
368 3300025926 Ga0207659_10068554 Ga0207659_100685543 125
369 3300025926 Ga0207659_10083627 Ga0207659_100836272 125
370 3300025926 Ga0207659_10348047 Ga0207659_103480471 125
371 3300025926 Ga0207659_10390551 Ga0207659_103905512 125
372 3300025926 Ga0207659_11526563 Ga0207659_115265632 125
373 3300025927 Ga0207687_10128182 Ga0207687_101281823 125
374 3300025927 Ga0207687_10143218 Ga0207687_101432183 125
375 3300025927 Ga0207687_11499587 Ga0207687_114995871 125
376 3300025931 Ga0207644_10323117 Ga0207644_103231171 125
377 3300025931 Ga0207644_10355837 Ga0207644_103558372 125
378 3300025932 Ga0207690_10148341 Ga0207690_101483412 125
379 3300025933 Ga0207706_10479861 Ga0207706_104798611 125
380 3300025933 Ga0207706_10722503 Ga0207706_107225032 125
381 3300025934 Ga0207686_10108384 Ga0207686_101083842 125
382 3300025934 Ga0207686_10237658 Ga0207686_102376582 125
383 3300025934 Ga0207686_10271122 Ga0207686_102711222 125
384 3300025935 Ga0207709_10019408 Ga0207709_100194082 125
385 3300025935 Ga0207709_10191138 Ga0207709_101911383 125
386 3300025935 Ga0207709_10979494 Ga0207709_109794942 125
387 3300025936 Ga0207670_10047558 Ga0207670_100475584 125
388 3300025936 Ga0207670_10199170 Ga0207670_101991703 125
389 3300025937 Ga0207669_10030208 Ga0207669_100302082 125
390 3300025937 Ga0207669_10069304 Ga0207669_100693042 125
391 3300025937 Ga0207669_10261068 Ga0207669_102610682 125
392 3300025937 Ga0207669_11013689 Ga0207669_110136892 125
393 3300025938 Ga0207704_10011319 Ga0207704_100113192 125
394 3300025938 Ga0207704_10034219 Ga0207704_100342192 125
395 3300025938 Ga0207704_10072914 Ga0207704_100729143 125
396 3300025938 Ga0207704_10233189 Ga0207704_102331892 125
397 3300025938 Ga0207704_10330907 Ga0207704_103309072 125
398 3300025939 Ga0207665_10021847 Ga0207665_100218477 125
399 3300025940 Ga0207691_10007479 Ga0207691_100074798 125
400 3300025940 Ga0207691_10125850 Ga0207691_101258502 125
401 3300025941 Ga0207711_10327928 Ga0207711_103279282 125
402 3300025941 Ga0207711_10526478 Ga0207711_105264782 125
403 3300025941 Ga0207711_11173436 Ga0207711_111734362 125
404 3300025942 Ga0207689_10999873 Ga0207689_109998731 125
405 3300025944 Ga0207661_10109710 Ga0207661_101097103 125
406 3300025945 Ga0207679_10188165 Ga0207679_101881654 125
407 3300025960 Ga0207651_10043046 Ga0207651_100430462 125
408 3300025960 Ga0207651_10194795 Ga0207651_101947953 125
409 3300025960 Ga0207651_10314678 Ga0207651_103146782 125
410 3300025960 Ga0207651_10384322 Ga0207651_103843222 125
411 3300025960 Ga0207651_10584314 Ga0207651_105843142 125
412 3300025961 Ga0207712_10073452 Ga0207712_100734523 125
413 3300025961 Ga0207712_11961938 Ga0207712_119619381 125
414 3300025972 Ga0207668_10244302 Ga0207668_102443022 125
415 3300025972 Ga0207668_10267487 Ga0207668_102674873 125
416 3300025981 Ga0207640_10007968 Ga0207640_100079682 125
417 3300026035 Ga0207703_10083922 Ga0207703_100839222 125
418 3300026035 Ga0207703_10917590 Ga0207703_109175903 125
419 3300026067 Ga0207678_10201190 Ga0207678_102011902 125
420 3300026067 Ga0207678_10898447 Ga0207678_108984472 125
421 3300026075 Ga0207708_10006686 Ga0207708_100066862 125
422 3300026075 Ga0207708_10007652 Ga0207708_100076526 125
423 3300026075 Ga0207708_10013419 Ga0207708_100134192 125
424 3300026078 Ga0207702_10039109 Ga0207702_100391093 125
425 3300026078 Ga0207702_10357580 Ga0207702_103575802 125
426 3300026088 Ga0207641_10934651 Ga0207641_109346512 125
427 3300026089 Ga0207648_10051776 Ga0207648_100517764 125
428 3300026089 Ga0207648_10092720 Ga0207648_100927202 125
429 3300026089 Ga0207648_10331115 Ga0207648_103311152 125
430 3300026089 Ga0207648_11377492 Ga0207648_113774921 125
431 3300026095 Ga0207676_10109275 Ga0207676_101092753 125
432 3300026095 Ga0207676_10179075 Ga0207676_101790752 125
433 3300026116 Ga0207674_10215514 Ga0207674_102155141 125
434 3300026116 Ga0207674_10794427 Ga0207674_107944271 125
435 3300026116 Ga0207674_11843915 Ga0207674_118439151 125
436 3300026118 Ga0207675_100072115 Ga0207675_1000721152 125
437 3300026118 Ga0207675_101046825 Ga0207675_1010468252 125
438 3300026121 Ga0207683_10006229 Ga0207683_100062292 125
439 3300026121 Ga0207683_10020589 Ga0207683_100205892 125
440 3300026121 Ga0207683_10059685 Ga0207683_100596854 125
441 3300026142 Ga0207698_10734104 Ga0207698_107341042 125
442 3300026142 Ga0207698_11832572 Ga0207698_118325721 125
443 3300027907 Ga0207428_10009852 Ga0207428_100098522 125
444 3300028379 Ga0268266_10402154 Ga0268266_104021543 125
445 3300028379 Ga0268266_10456364 Ga0268266_104563642 125
446 3300028380 Ga0268265_10144917 Ga0268265_101449172 125
447 3300028380 Ga0268265_10554095 Ga0268265_105540953 125
448 3300028381 Ga0268264_10403726 Ga0268264_104037262 125
449 3300028381 Ga0268264_10416415 Ga0268264_104164152 125
450 3300028381 Ga0268264_10804358 Ga0268264_108043582 125
451 3300028381 Ga0268264_12282400 Ga0268264_122824002 125
452 3300028800 Ga0265338_10115093 Ga0265338_101150932 125
453 3300031824 Ga0307413_10035146 Ga0307413_100351463 125
454 3300031852 Ga0307410_10906010 Ga0307410_109060102 125
455 3300031901 Ga0307406_10117138 Ga0307406_101171383 125
456 3300031901 Ga0307406_10554176 Ga0307406_105541761 125
457 3300031903 Ga0307407_10624064 Ga0307407_106240642 125
458 3300031903 Ga0307407_10948285 Ga0307407_109482852 125
459 3300031911 Ga0307412_10024972 Ga0307412_100249724 125
460 3300031911 Ga0307412_10767293 Ga0307412_107672932 125
461 3300031995 Ga0307409_100177819 Ga0307409_1001778192 125
462 3300032002 Ga0307416_100097459 Ga0307416_1000974591 125
463 3300032005 Ga0307411_10066794 Ga0307411_100667942 125
464 3300032126 Ga0307415_100039511 Ga0307415_1000395112 125
465 3300032126 Ga0307415_100474814 Ga0307415_1004748142 125
466 3300035089 Ga0373944_0428100 Ga0373944_0428100_26_409 125
467 3300035207 Ga0373942_0017351 Ga0373942_0017351_1030_1425 125
468 3300035692 Ga0373935_0099233 Ga0373935_0099233_1237_1716 125
469 3300035695 Ga0373927_0957599 Ga0373927_0957599_44_427 125
470 3300036401 Ga0373937_0370826 Ga0373937_0370826_852_1235 125
471 3300037312 Ga0395899_0191732 Ga0395899_0191732_757_1143 125
472 3300037418 Ga0395900_0011556 Ga0395900_0011556_6791_7177 125
473 3300037466 Ga0395898_0093106 Ga0395898_0093106_2115_2501 125
474 3300037471 Ga0395905_0994154 Ga0395905_0994154_303_680 125
475 3300037853 Ga0436364_1249034 Ga0436364_1249034_427_810 125
476 3300038443 Ga0395901_0025777 Ga0395901_0025777_422_808 125
477 3300038443 Ga0395901_0113940 Ga0395901_0113940_1924_2301 125
478 3300038443 Ga0395901_1401387 Ga0395901_1401387_240_629 125
479 3300038699 Ga0242422_01099 Ga0242422_01099_91_486 125
480 3300039438 Ga0436360_0253035 Ga0436360_0253035_88_471 125
481 3300039438 Ga0436360_1260888 Ga0436360_1260888_1137_1520 125
482 3300039438 Ga0436360_1270538 Ga0436360_1270538_247_630 125
483 3300039447 Ga0436361_0317298 Ga0436361_0317298_463_843 125
484 3300039447 Ga0436361_0550221 Ga0436361_0550221_424_807 125
485 3300039447 Ga0436361_0649317 Ga0436361_0649317_1015_1398 125
486 3300039447 Ga0436361_0810969 Ga0436361_0810969_448_831 125
487 3300039447 Ga0436361_0892360 Ga0436361_0892360_3321_3704 125
488 3300039447 Ga0436361_0938542 Ga0436361_0938542_81_464 125
489 3300039453 Ga0436362_0442172 Ga0436362_0442172_106_489 125
490 3300039453 Ga0436362_0993857 Ga0436362_0993857_870_1253 125
491 3300041512 Ga0451853_1239964 Ga0451853_1239964_233_610 125
492 3300042005 Ga0439448_0117958 Ga0439448_0117958_90_485 125
493 3300045051 Ga0451576_0076316 Ga0451576_0076316_1706_2089 125
494 3300045051 Ga0451576_0185677 Ga0451576_0185677_1661_2056 125
495 3300046463 Ga0495653_0522741 Ga0495653_0522741_242_622 125
496 3300046491 Ga0495584_0315418 Ga0495584_0315418_320_697 125
497 3300046499 Ga0495594_0666203 Ga0495594_0666203_45_422 125
498 3300046511 Ga0495608_0216353 Ga0495608_0216353_590_973 125
499 3300046531 Ga0495665_0143798 Ga0495665_0143798_467_853 125
500 3300046663 Ga0495635_0574628 Ga0495635_0574628_168_551 125
501 3300046680 Ga0495646_0635665 Ga0495646_0635665_136_519 125
502 3300046681 Ga0495647_0188540 Ga0495647_0188540_257_640 125
503 3300046683 Ga0495658_0212891 Ga0495658_0212891_452_835 125
504 3300046689 Ga0495613_0867479 Ga0495613_0867479_154_537 125
505 3300046809 Ga0495600_0262385 Ga0495600_0262385_229_609 125
506 3300047319 Ga0495674_0187942 Ga0495674_0187942_107_490 125
507 3300047322 Ga0495680_0313824 Ga0495680_0313824_565_948 125
508 3300048903 Ga0496100_0608762 Ga0496100_0608762_440_817 125
509 3300048903 Ga0496100_1091623 Ga0496100_1091623_33_410 125
510 3300048904 Ga0496101_0042375 Ga0496101_0042375_2470_2847 125
511 3300048904 Ga0496101_0498539 Ga0496101_0498539_534_911 125
512 3300048905 Ga0496102_0196665 Ga0496102_0196665_869_1246 125
513 3300048905 Ga0496102_0329723 Ga0496102_0329723_800_1189 125
514 3300048905 Ga0496102_0358305 Ga0496102_0358305_668_1045 125
515 3300048906 Ga0496103_0213205 Ga0496103_0213205_808_1185 125
516 3300048907 Ga0496104_0002907 Ga0496104_0002907_3823_4206 125
517 3300048907 Ga0496104_0017375 Ga0496104_0017375_3731_4108 125
518 3300048907 Ga0496104_0384309 Ga0496104_0384309_676_1053 125
519 3300048908 Ga0496105_0120171 Ga0496105_0120171_678_1061 125
520 3300048908 Ga0496105_0219377 Ga0496105_0219377_1080_1457 125
521 3300048908 Ga0496105_0256244 Ga0496105_0256244_207_584 125
522 3300048909 Ga0496106_0039270 Ga0496106_0039270_2422_2799 125
523 3300048909 Ga0496106_0349194 Ga0496106_0349194_19_402 125
524 3300048909 Ga0496106_0694468 Ga0496106_0694468_377_754 125
525 3300048910 Ga0496107_0142941 Ga0496107_0142941_1322_1699 125
526 3300048910 Ga0496107_0164442 Ga0496107_0164442_302_685 125
527 3300048910 Ga0496107_0876585 Ga0496107_0876585_203_595 125
528 3300048911 Ga0496108_0010864 Ga0496108_0010864_4608_4985 125
529 3300048911 Ga0496108_0017366 Ga0496108_0017366_3785_4162 125
530 3300048911 Ga0496108_0059111 Ga0496108_0059111_50_445 125
531 3300048911 Ga0496108_0148234 Ga0496108_0148234_383_772 125
532 3300048911 Ga0496108_1154686 Ga0496108_1154686_44_421 125
533 3300048912 Ga0496109_0004820 Ga0496109_0004820_2121_2498 125
534 3300048912 Ga0496109_0166418 Ga0496109_0166418_1260_1637 125
535 3300048912 Ga0496109_0563265 Ga0496109_0563265_88_483 125
536 3300048912 Ga0496109_1032605 Ga0496109_1032605_54_440 125
537 3300048912 Ga0496109_1231207 Ga0496109_1231207_184_579 125
538 3300048912 Ga0496109_1688467 Ga0496109_1688467_157_534 125
539 3300048912 Ga0496109_2042789 Ga0496109_2042789_94_477 125
540 3300048913 Ga0496110_0031719 Ga0496110_0031719_3515_3892 125
541 3300048913 Ga0496110_0210157 Ga0496110_0210157_95_481 125
542 3300048914 Ga0496111_0238681 Ga0496111_0238681_95_481 125
543 3300048914 Ga0496111_0247296 Ga0496111_0247296_524_901 125
544 3300048914 Ga0496111_0459633 Ga0496111_0459633_117_506 125
545 3300048915 Ga0496112_0006980 Ga0496112_0006980_1166_1543 125
546 3300048915 Ga0496112_0064157 Ga0496112_0064157_927_1319 125
547 3300048915 Ga0496112_0073850 Ga0496112_0073850_54_440 125
548 3300048915 Ga0496112_0578529 Ga0496112_0578529_70_465 125
549 3300048915 Ga0496112_0823680 Ga0496112_0823680_90_485 125
550 3300048916 Ga0496113_0016065 Ga0496113_0016065_1225_1602 125
551 3300048916 Ga0496113_0181019 Ga0496113_0181019_302_688 125
552 3300048916 Ga0496113_0388694 Ga0496113_0388694_718_1107 125
553 3300048916 Ga0496113_0643922 Ga0496113_0643922_58_435 125
554 3300048917 Ga0496114_0006946 Ga0496114_0006946_1663_2046 125
555 3300048917 Ga0496114_0027544 Ga0496114_0027544_934_1311 125
556 3300048917 Ga0496114_0045450 Ga0496114_0045450_165_542 125
557 3300048917 Ga0496114_0247522 Ga0496114_0247522_428_817 125
558 3300048918 Ga0496115_0009463 Ga0496115_0009463_3522_3899 125
559 3300048918 Ga0496115_0399072 Ga0496115_0399072_543_926 125
560 3300049522 Ga0501299_003046 Ga0501299_003046_1561_1938 125
561 3300049534 Ga0501318_040946 Ga0501318_040946_265_642 125
562 3300049569 Ga0501032_0002549 Ga0501032_0002549_47_442 125
563 3300049569 Ga0501032_0432062 Ga0501032_0432062_133_519 125
564 3300049571 Ga0501034_0000096 Ga0501034_0000096_74294_74683 125
565 3300049571 Ga0501034_0005171 Ga0501034_0005171_3876_4271 125
566 3300049572 Ga0501036_0003288 Ga0501036_0003288_5053_5448 125
567 3300049572 Ga0501036_0017391 Ga0501036_0017391_1559_1948 125
568 3300049573 Ga0501037_0294212 Ga0501037_0294212_246_632 125
569 3300049574 Ga0501038_0002622 Ga0501038_0002622_11930_12337 125
570 3300049574 Ga0501038_0049975 Ga0501038_0049975_379_774 125
571 3300049574 Ga0501038_0427269 Ga0501038_0427269_52_438 125
572 3300049575 Ga0501039_0003272 Ga0501039_0003272_4721_5116 125
573 3300049576 Ga0501040_0001492 Ga0501040_0001492_6995_7390 125
574 3300049576 Ga0501040_0056405 Ga0501040_0056405_939_1328 125
575 3300049577 Ga0501041_0004752 Ga0501041_0004752_47_442 125
576 3300049577 Ga0501041_0015708 Ga0501041_0015708_3300_3686 125
577 3300049577 Ga0501041_0452402 Ga0501041_0452402_89_475 125
578 3300049578 Ga0501042_0000116 Ga0501042_0000116_8201_8596 125
579 3300049578 Ga0501042_0018587 Ga0501042_0018587_2845_3231 125
580 3300049578 Ga0501042_1197302 Ga0501042_1197302_52_441 125
581 3300049579 Ga0501043_0014740 Ga0501043_0014740_3470_3859 125
582 3300049579 Ga0501043_0046599 Ga0501043_0046599_47_442 125
583 3300049580 Ga0501046_0001229 Ga0501046_0001229_3343_3732 125
584 3300049580 Ga0501046_0003365 Ga0501046_0003365_379_774 125
585 3300049580 Ga0501046_0036243 Ga0501046_0036243_295_681 125
586 3300049581 Ga0501047_0000008 Ga0501047_0000008_93783_94172 125
587 3300049582 Ga0501048_0001070 Ga0501048_0001070_16554_16943 125
588 3300049582 Ga0501048_0001118 Ga0501048_0001118_7570_7965 125
589 3300049582 Ga0501048_0071263 Ga0501048_0071263_1882_2268 125
590 3300049583 Ga0501067_0009814 Ga0501067_0009814_4478_4873 125
591 3300049583 Ga0501067_0022554 Ga0501067_0022554_642_1031 125
592 3300049583 Ga0501067_0181840 Ga0501067_0181840_278_676 125
593 3300049584 Ga0501068_0047850 Ga0501068_0047850_385_774 125
594 3300049584 Ga0501068_1150993 Ga0501068_1150993_47_442 125
595 3300049585 Ga0501069_0002263 Ga0501069_0002263_7851_8246 125
596 3300049586 Ga0501070_0002869 Ga0501070_0002869_7570_7965 125
597 3300049586 Ga0501070_0011220 Ga0501070_0011220_4209_4598 125
598 3300049587 Ga0501071_0002369 Ga0501071_0002369_4020_4415 125
599 3300049587 Ga0501071_0030557 Ga0501071_0030557_1351_1737 125
600 3300049587 Ga0501071_0214844 Ga0501071_0214844_634_1023 125
601 3300049588 Ga0501072_0000153 Ga0501072_0000153_34926_35315 125
602 3300049588 Ga0501072_0003182 Ga0501072_0003182_4959_5354 125
603 3300049588 Ga0501072_0307862 Ga0501072_0307862_83_469 125
604 3300049589 Ga0501073_0007388 Ga0501073_0007388_2968_3357 125
605 3300049589 Ga0501073_0022856 Ga0501073_0022856_47_442 125
606 3300049590 Ga0501074_0001110 Ga0501074_0001110_11284_11673 125
607 3300049590 Ga0501074_0002631 Ga0501074_0002631_9110_9505 125
608 3300049590 Ga0501074_0023368 Ga0501074_0023368_1673_2059 125
609 3300049591 Ga0501075_0001696 Ga0501075_0001696_7096_7491 125
610 3300049592 Ga0501076_0008270 Ga0501076_0008270_6995_7390 125
611 3300049592 Ga0501076_0047792 Ga0501076_0047792_945_1331 125
612 3300049593 Ga0501077_0000711 Ga0501077_0000711_7851_8246 125
613 3300049593 Ga0501077_0037687 Ga0501077_0037687_1378_1764 125
614 3300049593 Ga0501077_0154574 Ga0501077_0154574_1010_1387 125
615 3300049664 Ga0501224_055617 Ga0501224_055617_59_436 125
616 3300049669 Ga0501235_036898 Ga0501235_036898_541_918 125
617 3300049704 Ga0501221_038899 Ga0501221_038899_365_742 125
618 3300049705 Ga0501225_0181055 Ga0501225_0181055_148_525 125
619 3300049707 Ga0501234_005810 Ga0501234_005810_203_580 125
620 3300049741 Ga0501079_0000084 Ga0501079_0000084_13518_13907 125
621 3300049741 Ga0501079_0000221 Ga0501079_0000221_8201_8596 125
622 3300049741 Ga0501079_0043637 Ga0501079_0043637_1518_1904 125
623 3300049741 Ga0501079_0278575 Ga0501079_0278575_301_690 125
624 3300049741 Ga0501079_0539601 Ga0501079_0539601_164_541 125
625 3300049742 Ga0501080_0002637 Ga0501080_0002637_14908_15297 125
626 3300049742 Ga0501080_0024552 Ga0501080_0024552_4753_5148 125
627 3300049743 Ga0501081_0000284 Ga0501081_0000284_9237_9632 125
628 3300049743 Ga0501081_0017319 Ga0501081_0017319_1303_1689 125
629 3300049744 Ga0501083_0006749 Ga0501083_0006749_4414_4803 125
630 3300049744 Ga0501083_0041386 Ga0501083_0041386_2479_2862 125
631 3300049744 Ga0501083_0058600 Ga0501083_0058600_581_976 125
632 3300049744 Ga0501083_0300263 Ga0501083_0300263_628_1014 125
633 3300049765 Ga0501268_055212 Ga0501268_055212_297_674 125
634 3300049767 Ga0501270_014917 Ga0501270_014917_125_502 125
635 3300049779 Ga0501283_013278 Ga0501283_013278_446_823 125
636 3300049822 Ga0501035_0032783 Ga0501035_0032783_581_976 125
637 3300049822 Ga0501035_1002459 Ga0501035_1002459_122_505 125
638 3300049823 Ga0501044_0045490 Ga0501044_0045490_3901_4296 125
639 3300049824 Ga0501045_0000729 Ga0501045_0000729_12840_13235 125
640 3300049824 Ga0501045_0028445 Ga0501045_0028445_963_1349 125
641 3300049824 Ga0501045_0600822 Ga0501045_0600822_168_557 125
642 3300050507 nmdc:mga05p37_1036991_c1 nmdc:mga05p37_1036991_c1_255_644 125
643 3300050507 nmdc:mga05p37_2275938_c1 nmdc:mga05p37_2275938_c1_46_435 125
644 3300050507 nmdc:mga05p37_323935_c1 nmdc:mga05p37_323935_c1_254_643 125
645 3300050507 nmdc:mga05p37_75706_c1 nmdc:mga05p37_75706_c1_1472_1861 125
646 3300050507 nmdc:mga05p37_78549_c1 nmdc:mga05p37_78549_c1_271_660 125
647 3300050508 nmdc:mga09592_1216049_c1 nmdc:mga09592_1216049_c1_90_482 125
648 3300050508 nmdc:mga09592_62030_c1 nmdc:mga09592_62030_c1_2679_3068 125
649 3300050509 nmdc:mga0qj67_302611_c1 nmdc:mga0qj67_302611_c1_104_496 125
650 3300050510 nmdc:mga06r32_691657_c1 nmdc:mga06r32_691657_c1_403_792 125
651 3300050511 nmdc:mga08y16_19023_c1 nmdc:mga08y16_19023_c1_6590_6970 125
652 3300050511 nmdc:mga08y16_472940_c1 nmdc:mga08y16_472940_c1_256_636 125
653 3300050513 nmdc:mga0rr50_1060058_c1 nmdc:mga0rr50_1060058_c1_207_584 125
654 3300050513 nmdc:mga0rr50_74809_c1 nmdc:mga0rr50_74809_c1_1990_2382 125
655 3300050514 nmdc:mga08x19_32336_c1 nmdc:mga08x19_32336_c1_2796_3188 125
656 3300050514 nmdc:mga08x19_746418_c1 nmdc:mga08x19_746418_c1_208_597 125
657 3300050514 nmdc:mga08x19_93386_c1 nmdc:mga08x19_93386_c1_1316_1699 125
658 3300050515 nmdc:mga0a205_16021_c1 nmdc:mga0a205_16021_c1_3488_3871 125
659 3300053077 Ga0495601_0151470 Ga0495601_0151470_1037_1420 125
660 3300053078 Ga0495612_0325431 Ga0495612_0325431_140_523 125
661 3300054114 Ga0501084_0000135 Ga0501084_0000135_27353_27742 125
662 3300054114 Ga0501084_0003048 Ga0501084_0003048_8201_8596 125
663 3300054114 Ga0501084_0068893 Ga0501084_0068893_1100_1486 125
664 3300060353 Ga0501082_0001674 Ga0501082_0001674_3300_3689 125
665 3300060353 Ga0501082_0003297 Ga0501082_0003297_4984_5379 125
666 3300060353 Ga0501082_0039818 Ga0501082_0039818_402_788 125
667 3300061734 Ga0530510_0002740 Ga0530510_0002740_4721_5116 125
668 3300061734 Ga0530510_0036572 Ga0530510_0036572_576_962 125
669 3300061734 Ga0530510_0308797 Ga0530510_0308797_715_1104 125
670 3300061734 Ga0530510_0947455 Ga0530510_0947455_236_622 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

7

124

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xrg-assembly1.cif.gz_A conserved hypothetical protein from clostridium thermocellum cth-2968 0.9856 1 125
1xrg-assembly1.cif.gz_C conserved hypothetical protein from clostridium thermocellum cth-2968 0.984 2 125
2csl-assembly1.cif.gz_B crystal structure of ttha0137 from thermus thermophilus hb8 0.9816 3 124
1nq3-assembly2.cif.gz_E crystal structure of the mammalian tumor associated antigen uk114 0.9813 1 124
5y6u-assembly1.cif.gz_C crystal structure of wild-type yabj protein from bacillus subtilis (natto). 0.9799 3 124
ID Description Score Start End Superfamily
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.98 1 124 3.30.1330.40
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9792 1 124 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9781 1 124 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9773 18 125 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9754 3 125 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A2V8BM28-F1-model_v4 RidA family protein 0.9962 1 125 GO:0005829
GO:0019239
AF-A0A321LJU5-F1-model_v4 Reactive intermediate/imine deaminase 0.9956 1 125 GO:0005829
GO:0019239
AF-A0A1F5ZSH9-F1-model_v4 Reactive intermediate/imine deaminase 0.9956 1 124 GO:0005829
GO:0019239
AF-A0A7X8Z7B7-F1-model_v4 RidA family protein 0.9956 3 125 GO:0005829
GO:0019239
AF-A0A353A1P7-F1-model_v4 Reactive intermediate/imine deaminase 0.9951 3 124 GO:0005829
GO:0019239

Feature Viewer

pLDDT pTM Quality
97.31 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map