F474095
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 670 | 273 | 670 | 388 |
Family's Representative Sequence
| Representative Sequence | 3300028379|Ga0268266_10189584|Ga0268266_101895841 |
| Length | 434 |
| Sequence | MNAIVIHYKELALKGRNRSWFVQQLVRNLRTAVAGLGVVAVRAVMGRIEIELQAPAVSPAAATGRSPAETSALGEIGAPGQVRLGSPSRGHSPASPPPGWAELRDRIGHVFGIANFSHAGRAPHEFAALASTILSDLGDTEASSFRVSARRADKQLPFTSPQIEREVGGLIKEARGWQVRLDDPELTIHVEMMPDHAFYYFGKEPGAGGLPTGTSGRVACLLSGGIDSPVAAYRMMRRGCPVLFIHFHSYPLLSRASQEKVREIATLLTRYQLRSRLHLVPFGELQQQVLLAVQPELRVVIYRRLMLRIAERLARRWKAGALVTGEVVGQVASQTLENMTTIAGATNLEILRPLVGMDKDEIIEQAQRLGTFPISIIPDQDCCQLFTPRHPATRARPEQIEAAERALPIAEMVDAAIAASVVEEFRFPMPSSPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 156 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 169 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 170 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 171 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 172 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 173 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 174 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 177 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 183 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 192 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 193 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 194 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 195 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 196 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 197 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 198 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 199 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 200 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 224 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 225 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 226 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 227 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 233 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 253 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 254 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 255 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 256 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 269 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 270 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 271 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 272 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.79 |
| Nodule | 0 |
| Rhizoplane | 3.88 |
| Rhizosphere | 94.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10002791 | 3300002459 | Bacteria | 3514 |
| 2 | JGI25406J46586_10000491 | 3300003203 | Bacteria | 18498 |
| 3 | Ga0065712_10020821 | 3300005290 | Unclassified | 1713 |
| 4 | Ga0065712_10026676 | 3300005290 | Bacteria | 1546 |
| 5 | Ga0065712_10142213 | 3300005290 | Unclassified | 1440 |
| 6 | Ga0065715_10094271 | 3300005293 | Bacteria | 4389 |
| 7 | Ga0065715_10118756 | 3300005293 | Unclassified | 2296 |
| 8 | Ga0065707_10001449 | 3300005295 | Bacteria | 11740 |
| 9 | Ga0065707_10006518 | 3300005295 | Bacteria | 3337 |
| 10 | Ga0065707_10009013 | 3300005295 | Unclassified | 3939 |
| 11 | Ga0070676_10004192 | 3300005328 | Bacteria | 7571 |
| 12 | Ga0070676_10021642 | 3300005328 | Bacteria | 3601 |
| 13 | Ga0070676_10038590 | 3300005328 | Bacteria | 2759 |
| 14 | Ga0070676_10038917 | 3300005328 | Bacteria | 2748 |
| 15 | Ga0070683_100000702 | 3300005329 | Bacteria | 24327 |
| 16 | Ga0070683_100119518 | 3300005329 | Bacteria | 2489 |
| 17 | Ga0070683_100136965 | 3300005329 | Bacteria | 2319 |
| 18 | Ga0070690_100131778 | 3300005330 | Unclassified | 1689 |
| 19 | Ga0070670_100003306 | 3300005331 | Bacteria | 13341 |
| 20 | Ga0070670_100014348 | 3300005331 | Bacteria | 6798 |
| 21 | Ga0070670_100078964 | 3300005331 | Bacteria | 2828 |
| 22 | Ga0070670_100098815 | 3300005331 | Bacteria | 2512 |
| 23 | Ga0070670_100187951 | 3300005331 | Unclassified | 1794 |
| 24 | Ga0070677_10005129 | 3300005333 | Bacteria | 4304 |
| 25 | Ga0068869_100222030 | 3300005334 | Bacteria | 1498 |
| 26 | Ga0070666_10004947 | 3300005335 | Bacteria | 8153 |
| 27 | Ga0070666_10126739 | 3300005335 | Bacteria | 1772 |
| 28 | Ga0070680_100041031 | 3300005336 | Unclassified | 3752 |
| 29 | Ga0068868_100011616 | 3300005338 | Bacteria | 6414 |
| 30 | Ga0068868_100095107 | 3300005338 | Bacteria | 2404 |
| 31 | Ga0070660_100088263 | 3300005339 | Bacteria | 2442 |
| 32 | Ga0070689_100069246 | 3300005340 | Bacteria | 2753 |
| 33 | Ga0070689_100132421 | 3300005340 | Bacteria | 2000 |
| 34 | Ga0070689_100199512 | 3300005340 | Bacteria | 1633 |
| 35 | Ga0070691_10000473 | 3300005341 | Bacteria | 15007 |
| 36 | Ga0070692_10094327 | 3300005345 | Bacteria | 1631 |
| 37 | Ga0070668_100091583 | 3300005347 | Bacteria | 2397 |
| 38 | Ga0070669_100060746 | 3300005353 | Bacteria | 2777 |
| 39 | Ga0070669_100088294 | 3300005353 | Bacteria | 2320 |
| 40 | Ga0070669_100168146 | 3300005353 | Bacteria | 1708 |
| 41 | Ga0070675_100000202 | 3300005354 | Bacteria | 37748 |
| 42 | Ga0070675_100038954 | 3300005354 | Bacteria | 3876 |
| 43 | Ga0070675_100223235 | 3300005354 | Bacteria | 1641 |
| 44 | Ga0070671_100061790 | 3300005355 | Bacteria | 3120 |
| 45 | Ga0070671_100064146 | 3300005355 | Bacteria | 3060 |
| 46 | Ga0070674_100024262 | 3300005356 | Bacteria | 3934 |
| 47 | Ga0070674_100045893 | 3300005356 | Bacteria | 2987 |
| 48 | Ga0070674_100133085 | 3300005356 | Bacteria | 1857 |
| 49 | Ga0070674_100153363 | 3300005356 | Bacteria | 1740 |
| 50 | Ga0070673_100000282 | 3300005364 | Bacteria | 26333 |
| 51 | Ga0070673_100002528 | 3300005364 | Bacteria | 11171 |
| 52 | Ga0070673_100071179 | 3300005364 | Bacteria | 2793 |
| 53 | Ga0070688_100029128 | 3300005365 | Bacteria | 3303 |
| 54 | Ga0070688_100115143 | 3300005365 | Bacteria | 1794 |
| 55 | Ga0070659_100233553 | 3300005366 | Bacteria | 1520 |
| 56 | Ga0070667_100013136 | 3300005367 | Bacteria | 6846 |
| 57 | Ga0070667_100072801 | 3300005367 | Bacteria | 2929 |
| 58 | Ga0070714_100020682 | 3300005435 | Bacteria | 5379 |
| 59 | Ga0070714_100347481 | 3300005435 | Unclassified | 1392 |
| 60 | Ga0070701_10014384 | 3300005438 | Bacteria | 3627 |
| 61 | Ga0070705_100006359 | 3300005440 | Bacteria | 5787 |
| 62 | Ga0070700_100006004 | 3300005441 | Bacteria | 6461 |
| 63 | Ga0070700_100070143 | 3300005441 | Bacteria | 2234 |
| 64 | Ga0070700_100079587 | 3300005441 | Bacteria | 2113 |
| 65 | Ga0070700_100095906 | 3300005441 | Bacteria | 1945 |
| 66 | Ga0070700_100125087 | 3300005441 | Bacteria | 1728 |
| 67 | Ga0070694_100010880 | 3300005444 | Bacteria | 5629 |
| 68 | Ga0070694_100079292 | 3300005444 | Bacteria | 2279 |
| 69 | Ga0070708_100075792 | 3300005445 | Bacteria | 3036 |
| 70 | Ga0070708_100275386 | 3300005445 | Bacteria | 1583 |
| 71 | Ga0070678_100002631 | 3300005456 | Bacteria | 9880 |
| 72 | Ga0070678_100028953 | 3300005456 | Bacteria | 3786 |
| 73 | Ga0070662_100223431 | 3300005457 | Bacteria | 1504 |
| 74 | Ga0070681_10019500 | 3300005458 | Bacteria | 6790 |
| 75 | Ga0070681_10108226 | 3300005458 | Bacteria | 2720 |
| 76 | Ga0068867_100009353 | 3300005459 | Bacteria | 6917 |
| 77 | Ga0068867_100013323 | 3300005459 | Bacteria | 5825 |
| 78 | Ga0068867_100025953 | 3300005459 | Bacteria | 4203 |
| 79 | Ga0068867_100065776 | 3300005459 | Bacteria | 2699 |
| 80 | Ga0070706_100000101 | 3300005467 | Bacteria | 104707 |
| 81 | Ga0070706_100087293 | 3300005467 | Bacteria | 2891 |
| 82 | Ga0070707_100014493 | 3300005468 | Bacteria | 7388 |
| 83 | Ga0070707_100058637 | 3300005468 | Bacteria | 3692 |
| 84 | Ga0070707_100079899 | 3300005468 | Bacteria | 3156 |
| 85 | Ga0070707_100195747 | 3300005468 | Unclassified | 1970 |
| 86 | Ga0070698_100029348 | 3300005471 | Bacteria | 5710 |
| 87 | Ga0070698_100040293 | 3300005471 | Bacteria | 4801 |
| 88 | Ga0070698_100054630 | 3300005471 | Bacteria | 4054 |
| 89 | Ga0070698_100229468 | 3300005471 | Unclassified | 1790 |
| 90 | Ga0070699_100003668 | 3300005518 | Bacteria | 13600 |
| 91 | Ga0070699_100008689 | 3300005518 | Bacteria | 8804 |
| 92 | Ga0070699_100030443 | 3300005518 | Bacteria | 4659 |
| 93 | Ga0070699_100093431 | 3300005518 | Bacteria | 2632 |
| 94 | Ga0070699_100172458 | 3300005518 | Bacteria | 1917 |
| 95 | Ga0070679_100022602 | 3300005530 | Bacteria | 6148 |
| 96 | Ga0070679_100174362 | 3300005530 | Bacteria | 2123 |
| 97 | Ga0070684_100000068 | 3300005535 | Bacteria | 65538 |
| 98 | Ga0070684_100009549 | 3300005535 | Bacteria | 7645 |
| 99 | Ga0070697_100000189 | 3300005536 | Bacteria | 50813 |
| 100 | Ga0070697_100038812 | 3300005536 | Bacteria | 3848 |
| 101 | Ga0070697_100189167 | 3300005536 | Bacteria | 1747 |
| 102 | Ga0070672_100029894 | 3300005543 | Bacteria | 4089 |
| 103 | Ga0070695_100000785 | 3300005545 | Bacteria | 17066 |
| 104 | Ga0070695_100014083 | 3300005545 | Bacteria | 4815 |
| 105 | Ga0070696_100029118 | 3300005546 | Bacteria | 3771 |
| 106 | Ga0070696_100058504 | 3300005546 | Bacteria | 2692 |
| 107 | Ga0070696_100078877 | 3300005546 | Bacteria | 2329 |
| 108 | Ga0070696_100125583 | 3300005546 | Bacteria | 1861 |
| 109 | Ga0070693_100047782 | 3300005547 | Bacteria | 2436 |
| 110 | Ga0070665_100006386 | 3300005548 | Bacteria | 12013 |
| 111 | Ga0070665_100008967 | 3300005548 | Bacteria | 10134 |
| 112 | Ga0070665_100010405 | 3300005548 | Bacteria | 9414 |
| 113 | Ga0070665_100033210 | 3300005548 | Bacteria | 5192 |
| 114 | Ga0070704_100001151 | 3300005549 | Bacteria | 13820 |
| 115 | Ga0070704_100011495 | 3300005549 | Bacteria | 5427 |
| 116 | Ga0070704_100055179 | 3300005549 | Bacteria | 2815 |
| 117 | Ga0070704_100089098 | 3300005549 | Bacteria | 2294 |
| 118 | Ga0070704_100103135 | 3300005549 | Bacteria | 2154 |
| 119 | Ga0070704_100140567 | 3300005549 | Unclassified | 1884 |
| 120 | Ga0070704_100146319 | 3300005549 | Unclassified | 1852 |
| 121 | Ga0068855_100322533 | 3300005563 | Bacteria | 1707 |
| 122 | Ga0070664_100008127 | 3300005564 | Bacteria | 8482 |
| 123 | Ga0068857_100050996 | 3300005577 | Bacteria | 3670 |
| 124 | Ga0068854_100050997 | 3300005578 | Bacteria | 2963 |
| 125 | Ga0068854_100052821 | 3300005578 | Bacteria | 2916 |
| 126 | Ga0070702_100001302 | 3300005615 | Bacteria | 10114 |
| 127 | Ga0068859_100005666 | 3300005617 | Bacteria | 12714 |
| 128 | Ga0068859_100024547 | 3300005617 | Bacteria | 6048 |
| 129 | Ga0068859_100227254 | 3300005617 | Bacteria | 1954 |
| 130 | Ga0068859_100266819 | 3300005617 | Unclassified | 1804 |
| 131 | Ga0068859_100328683 | 3300005617 | Bacteria | 1623 |
| 132 | Ga0068864_100006553 | 3300005618 | Bacteria | 9539 |
| 133 | Ga0068866_10010359 | 3300005718 | Bacteria | 3994 |
| 134 | Ga0068861_100003622 | 3300005719 | Bacteria | 10288 |
| 135 | Ga0068863_100066986 | 3300005841 | Bacteria | 3396 |
| 136 | Ga0068863_100140256 | 3300005841 | Unclassified | 2310 |
| 137 | Ga0068863_100194278 | 3300005841 | Bacteria | 1951 |
| 138 | Ga0068858_100005453 | 3300005842 | Bacteria | 12454 |
| 139 | Ga0068858_100013146 | 3300005842 | Bacteria | 7805 |
| 140 | Ga0068858_100034125 | 3300005842 | Bacteria | 4720 |
| 141 | Ga0068858_100180904 | 3300005842 | Bacteria | 1991 |
| 142 | Ga0068860_100061312 | 3300005843 | Bacteria | 3574 |
| 143 | Ga0068860_100185959 | 3300005843 | Bacteria | 2009 |
| 144 | Ga0068862_100016452 | 3300005844 | Bacteria | 6156 |
| 145 | Ga0068862_100046267 | 3300005844 | Bacteria | 3712 |
| 146 | Ga0068862_100234264 | 3300005844 | Bacteria | 1667 |
| 147 | Ga0068862_100323912 | 3300005844 | Bacteria | 1423 |
| 148 | Ga0081455_10013648 | 3300005937 | Bacteria | 8002 |
| 149 | Ga0081455_10102180 | 3300005937 | Unclassified | 2299 |
| 150 | Ga0081455_10116831 | 3300005937 | Bacteria | 2109 |
| 151 | Ga0081538_10001528 | 3300005981 | Bacteria | 23736 |
| 152 | Ga0081538_10058983 | 3300005981 | Bacteria | 2221 |
| 153 | Ga0081539_10000093 | 3300005985 | Bacteria | 207314 |
| 154 | Ga0075365_10007190 | 3300006038 | Bacteria | 6215 |
| 155 | Ga0075364_10047399 | 3300006051 | Bacteria | 2799 |
| 156 | Ga0075362_10000421 | 3300006177 | Bacteria | 12191 |
| 157 | Ga0075367_10003356 | 3300006178 | Bacteria | 7615 |
| 158 | Ga0075366_10013364 | 3300006195 | Bacteria | 4672 |
| 159 | Ga0097621_100000477 | 3300006237 | Bacteria | 28162 |
| 160 | Ga0097621_100002349 | 3300006237 | Bacteria | 12970 |
| 161 | Ga0097621_100013417 | 3300006237 | Bacteria | 6107 |
| 162 | Ga0097621_100022317 | 3300006237 | Bacteria | 4912 |
| 163 | Ga0097621_100030260 | 3300006237 | Bacteria | 4284 |
| 164 | Ga0097621_100040296 | 3300006237 | Bacteria | 3755 |
| 165 | Ga0097621_100192429 | 3300006237 | Unclassified | 1767 |
| 166 | Ga0075370_10006888 | 3300006353 | Bacteria | 5751 |
| 167 | Ga0068871_100005279 | 3300006358 | Bacteria | 9044 |
| 168 | Ga0068871_100012430 | 3300006358 | Bacteria | 6275 |
| 169 | Ga0068871_100015114 | 3300006358 | Bacteria | 5771 |
| 170 | Ga0068871_100032832 | 3300006358 | Bacteria | 4104 |
| 171 | Ga0075428_100000080 | 3300006844 | Bacteria | 80349 |
| 172 | Ga0075428_100032730 | 3300006844 | Bacteria | 5742 |
| 173 | Ga0075428_100131866 | 3300006844 | Bacteria | 2717 |
| 174 | Ga0075428_100414895 | 3300006844 | Bacteria | 1442 |
| 175 | Ga0075430_100002473 | 3300006846 | Bacteria | 15388 |
| 176 | Ga0075430_100078679 | 3300006846 | Unclassified | 2764 |
| 177 | Ga0075431_100002515 | 3300006847 | Bacteria | 17677 |
| 178 | Ga0075431_100011777 | 3300006847 | Bacteria | 8824 |
| 179 | Ga0075431_100133808 | 3300006847 | Unclassified | 2556 |
| 180 | Ga0075433_10007021 | 3300006852 | Bacteria | 8923 |
| 181 | Ga0075433_10016600 | 3300006852 | Bacteria | 6075 |
| 182 | Ga0075433_10129598 | 3300006852 | Bacteria | 2241 |
| 183 | Ga0075434_100004294 | 3300006871 | Bacteria | 12804 |
| 184 | Ga0075434_100005549 | 3300006871 | Bacteria | 11495 |
| 185 | Ga0075434_100010893 | 3300006871 | Bacteria | 8550 |
| 186 | Ga0075434_100035368 | 3300006871 | Bacteria | 4938 |
| 187 | Ga0075434_100045559 | 3300006871 | Bacteria | 4351 |
| 188 | Ga0075434_100059288 | 3300006871 | Bacteria | 3805 |
| 189 | Ga0075434_100162802 | 3300006871 | Bacteria | 2251 |
| 190 | Ga0075434_100302637 | 3300006871 | Bacteria | 1620 |
| 191 | Ga0075429_100000156 | 3300006880 | Bacteria | 42804 |
| 192 | Ga0075429_100001098 | 3300006880 | Bacteria | 21794 |
| 193 | Ga0075429_100050306 | 3300006880 | Bacteria | 3626 |
| 194 | Ga0075429_100093444 | 3300006880 | Bacteria | 2623 |
| 195 | Ga0068865_100008148 | 3300006881 | Bacteria | 6466 |
| 196 | Ga0068865_100039835 | 3300006881 | Bacteria | 3189 |
| 197 | Ga0068865_100058204 | 3300006881 | Bacteria | 2698 |
| 198 | Ga0068865_100089278 | 3300006881 | Bacteria | 2232 |
| 199 | Ga0075436_100000295 | 3300006914 | Bacteria | 31676 |
| 200 | Ga0075436_100007582 | 3300006914 | Bacteria | 7413 |
| 201 | Ga0097620_100005666 | 3300006931 | Bacteria | 12714 |
| 202 | Ga0097620_100024547 | 3300006931 | Bacteria | 6048 |
| 203 | Ga0097620_100227264 | 3300006931 | Bacteria | 1954 |
| 204 | Ga0097620_100266820 | 3300006931 | Unclassified | 1804 |
| 205 | Ga0097620_100328726 | 3300006931 | Bacteria | 1623 |
| 206 | Ga0075435_100000147 | 3300007076 | Bacteria | 39845 |
| 207 | Ga0075435_100002656 | 3300007076 | Bacteria | 11922 |
| 208 | Ga0075435_100030102 | 3300007076 | Bacteria | 4266 |
| 209 | Ga0075435_100036648 | 3300007076 | Bacteria | 3900 |
| 210 | Ga0075435_100037478 | 3300007076 | Bacteria | 3861 |
| 211 | Ga0075435_100091312 | 3300007076 | Bacteria | 2513 |
| 212 | Ga0075435_100149449 | 3300007076 | Archaea | 1963 |
| 213 | Ga0105240_10011792 | 3300009093 | Bacteria | 12141 |
| 214 | Ga0105240_10034088 | 3300009093 | Bacteria | 6571 |
| 215 | Ga0105240_10178022 | 3300009093 | Unclassified | 2512 |
| 216 | Ga0105240_10180230 | 3300009093 | Bacteria | 2494 |
| 217 | Ga0105240_10197850 | 3300009093 | Bacteria | 2357 |
| 218 | Ga0111539_10000059 | 3300009094 | Bacteria | 113645 |
| 219 | Ga0111539_10000181 | 3300009094 | Bacteria | 73457 |
| 220 | Ga0111539_10000209 | 3300009094 | Bacteria | 69503 |
| 221 | Ga0111539_10002429 | 3300009094 | Bacteria | 24773 |
| 222 | Ga0111539_10009783 | 3300009094 | Bacteria | 12103 |
| 223 | Ga0111539_10043681 | 3300009094 | Bacteria | 5372 |
| 224 | Ga0111539_10047449 | 3300009094 | Bacteria | 5132 |
| 225 | Ga0111539_10100907 | 3300009094 | Bacteria | 3389 |
| 226 | Ga0111539_10115071 | 3300009094 | Bacteria | 3155 |
| 227 | Ga0111539_10137313 | 3300009094 | Bacteria | 2863 |
| 228 | Ga0111539_10145053 | 3300009094 | Bacteria | 2779 |
| 229 | Ga0111539_10164168 | 3300009094 | Bacteria | 2598 |
| 230 | Ga0105245_10005530 | 3300009098 | Bacteria | 11098 |
| 231 | Ga0105245_10324095 | 3300009098 | Bacteria | 1519 |
| 232 | Ga0105247_10019812 | 3300009101 | Bacteria | 4041 |
| 233 | Ga0105247_10031210 | 3300009101 | Bacteria | 3233 |
| 234 | Ga0105247_10040093 | 3300009101 | Unclassified | 2862 |
| 235 | Ga0114129_10000077 | 3300009147 | Bacteria | 90951 |
| 236 | Ga0114129_10001820 | 3300009147 | Bacteria | 29050 |
| 237 | Ga0114129_10009067 | 3300009147 | Bacteria | 14179 |
| 238 | Ga0114129_10034155 | 3300009147 | Bacteria | 7183 |
| 239 | Ga0114129_10036366 | 3300009147 | Bacteria | 6954 |
| 240 | Ga0114129_10043732 | 3300009147 | Bacteria | 6302 |
| 241 | Ga0114129_10106350 | 3300009147 | Unclassified | 3876 |
| 242 | Ga0114129_10108011 | 3300009147 | Bacteria | 3842 |
| 243 | Ga0114129_10112109 | 3300009147 | Bacteria | 3762 |
| 244 | Ga0105243_10016882 | 3300009148 | Bacteria | 5520 |
| 245 | Ga0105243_10054372 | 3300009148 | Bacteria | 3179 |
| 246 | Ga0105242_10003632 | 3300009176 | Bacteria | 12008 |
| 247 | Ga0105242_10027319 | 3300009176 | Bacteria | 4529 |
| 248 | Ga0105242_10097791 | 3300009176 | Bacteria | 2482 |
| 249 | Ga0105248_10004014 | 3300009177 | Bacteria | 16266 |
| 250 | Ga0105248_10014318 | 3300009177 | Bacteria | 8730 |
| 251 | Ga0105248_10018395 | 3300009177 | Bacteria | 7720 |
| 252 | Ga0105248_10023744 | 3300009177 | Bacteria | 6814 |
| 253 | Ga0105248_10033764 | 3300009177 | Bacteria | 5718 |
| 254 | Ga0105248_10043896 | 3300009177 | Bacteria | 5014 |
| 255 | Ga0105248_10148605 | 3300009177 | Bacteria | 2644 |
| 256 | Ga0105248_10317020 | 3300009177 | Bacteria | 1756 |
| 257 | Ga0105237_10176890 | 3300009545 | Bacteria | 2134 |
| 258 | Ga0105249_10153421 | 3300009553 | Bacteria | 2219 |
| 259 | Ga0105249_10154010 | 3300009553 | Bacteria | 2215 |
| 260 | Ga0105249_10232698 | 3300009553 | Unclassified | 1818 |
| 261 | Ga0157370_10278479 | 3300013104 | Bacteria | 1546 |
| 262 | Ga0157374_10128612 | 3300013296 | Bacteria | 2450 |
| 263 | Ga0157374_10305188 | 3300013296 | Unclassified | 1575 |
| 264 | Ga0157378_10000578 | 3300013297 | Bacteria | 34492 |
| 265 | Ga0157378_10023338 | 3300013297 | Bacteria | 5444 |
| 266 | Ga0163162_10056599 | 3300013306 | Bacteria | 3949 |
| 267 | Ga0157372_10140203 | 3300013307 | Unclassified | 2785 |
| 268 | Ga0157375_10002741 | 3300013308 | Bacteria | 15224 |
| 269 | Ga0157375_10028668 | 3300013308 | Bacteria | 5223 |
| 270 | Ga0157375_10132350 | 3300013308 | Unclassified | 2614 |
| 271 | Ga0157375_10218723 | 3300013308 | Unclassified | 2063 |
| 272 | Ga0163163_10010892 | 3300014325 | Bacteria | 8216 |
| 273 | Ga0163163_10013097 | 3300014325 | Bacteria | 7577 |
| 274 | Ga0163163_10023177 | 3300014325 | Bacteria | 5890 |
| 275 | Ga0157380_10034162 | 3300014326 | Bacteria | 3921 |
| 276 | Ga0157380_10051633 | 3300014326 | Bacteria | 3253 |
| 277 | Ga0157380_10065967 | 3300014326 | Bacteria | 2911 |
| 278 | Ga0157380_10114672 | 3300014326 | Bacteria | 2271 |
| 279 | Ga0157379_10000584 | 3300014968 | Bacteria | 29559 |
| 280 | Ga0157379_10017975 | 3300014968 | Bacteria | 6231 |
| 281 | Ga0157379_10018346 | 3300014968 | Bacteria | 6168 |
| 282 | Ga0157379_10021777 | 3300014968 | Bacteria | 5678 |
| 283 | Ga0157379_10044495 | 3300014968 | Bacteria | 3963 |
| 284 | Ga0157379_10171473 | 3300014968 | Bacteria | 1959 |
| 285 | Ga0157376_10019378 | 3300014969 | Bacteria | 5243 |
| 286 | Ga0157376_10034338 | 3300014969 | Bacteria | 4095 |
| 287 | Ga0157376_10041762 | 3300014969 | Bacteria | 3757 |
| 288 | Ga0157376_10124749 | 3300014969 | Bacteria | 2288 |
| 289 | Ga0207682_10011954 | 3300025893 | Bacteria | 3390 |
| 290 | Ga0207682_10015468 | 3300025893 | Unclassified | 2970 |
| 291 | Ga0207680_10004015 | 3300025903 | Bacteria | 6953 |
| 292 | Ga0207680_10019777 | 3300025903 | Bacteria | 3609 |
| 293 | Ga0207680_10030934 | 3300025903 | Bacteria | 3026 |
| 294 | Ga0207680_10041021 | 3300025903 | Bacteria | 2698 |
| 295 | Ga0207699_10077698 | 3300025906 | Unclassified | 2049 |
| 296 | Ga0207645_10041479 | 3300025907 | Bacteria | 2945 |
| 297 | Ga0207684_10000584 | 3300025910 | Bacteria | 44035 |
| 298 | Ga0207684_10000607 | 3300025910 | Bacteria | 42607 |
| 299 | Ga0207684_10214483 | 3300025910 | Bacteria | 1661 |
| 300 | Ga0207684_10325909 | 3300025910 | Unclassified | 1323 |
| 301 | Ga0207707_10036870 | 3300025912 | Bacteria | 4273 |
| 302 | Ga0207707_10039875 | 3300025912 | Unclassified | 4103 |
| 303 | Ga0207707_10230432 | 3300025912 | Unclassified | 1611 |
| 304 | Ga0207695_10136275 | 3300025913 | Unclassified | 2408 |
| 305 | Ga0207695_10165469 | 3300025913 | Unclassified | 2140 |
| 306 | Ga0207671_10111125 | 3300025914 | Bacteria | 2085 |
| 307 | Ga0207660_10029026 | 3300025917 | Unclassified | 3790 |
| 308 | Ga0207662_10009833 | 3300025918 | Bacteria | 5277 |
| 309 | Ga0207662_10064804 | 3300025918 | Bacteria | 2199 |
| 310 | Ga0207657_10114870 | 3300025919 | Bacteria | 2219 |
| 311 | Ga0207649_10022407 | 3300025920 | Bacteria | 3649 |
| 312 | Ga0207652_10038008 | 3300025921 | Unclassified | 4078 |
| 313 | Ga0207652_10210762 | 3300025921 | Bacteria | 1749 |
| 314 | Ga0207646_10024832 | 3300025922 | Bacteria | 5485 |
| 315 | Ga0207646_10036794 | 3300025922 | Bacteria | 4417 |
| 316 | Ga0207646_10036937 | 3300025922 | Bacteria | 4407 |
| 317 | Ga0207681_10012038 | 3300025923 | Bacteria | 5329 |
| 318 | Ga0207681_10019225 | 3300025923 | Bacteria | 4314 |
| 319 | Ga0207681_10244036 | 3300025923 | Bacteria | 1399 |
| 320 | Ga0207650_10008008 | 3300025925 | Bacteria | 7201 |
| 321 | Ga0207650_10030010 | 3300025925 | Bacteria | 3913 |
| 322 | Ga0207650_10180756 | 3300025925 | Bacteria | 1681 |
| 323 | Ga0207650_10188207 | 3300025925 | Bacteria | 1648 |
| 324 | Ga0207659_10000076 | 3300025926 | Bacteria | 62373 |
| 325 | Ga0207659_10017562 | 3300025926 | Bacteria | 4675 |
| 326 | Ga0207659_10096939 | 3300025926 | Bacteria | 2214 |
| 327 | Ga0207687_10008541 | 3300025927 | Bacteria | 6698 |
| 328 | Ga0207664_10177549 | 3300025929 | Unclassified | 1827 |
| 329 | Ga0207644_10022378 | 3300025931 | Bacteria | 4319 |
| 330 | Ga0207706_10066896 | 3300025933 | Bacteria | 3162 |
| 331 | Ga0207706_10084052 | 3300025933 | Bacteria | 2798 |
| 332 | Ga0207706_10099614 | 3300025933 | Bacteria | 2557 |
| 333 | Ga0207686_10017136 | 3300025934 | Bacteria | 4077 |
| 334 | Ga0207686_10020853 | 3300025934 | Bacteria | 3751 |
| 335 | Ga0207709_10048363 | 3300025935 | Bacteria | 2591 |
| 336 | Ga0207670_10131699 | 3300025936 | Bacteria | 1833 |
| 337 | Ga0207669_10015080 | 3300025937 | Unclassified | 3888 |
| 338 | Ga0207669_10046761 | 3300025937 | Bacteria | 2559 |
| 339 | Ga0207669_10062920 | 3300025937 | Bacteria | 2288 |
| 340 | Ga0207669_10093624 | 3300025937 | Unclassified | 1964 |
| 341 | Ga0207669_10221925 | 3300025937 | Bacteria | 1388 |
| 342 | Ga0207704_10010703 | 3300025938 | Bacteria | 4486 |
| 343 | Ga0207704_10062347 | 3300025938 | Bacteria | 2318 |
| 344 | Ga0207704_10132313 | 3300025938 | Bacteria | 1730 |
| 345 | Ga0207691_10000274 | 3300025940 | Bacteria | 51054 |
| 346 | Ga0207691_10022903 | 3300025940 | Bacteria | 5887 |
| 347 | Ga0207691_10095964 | 3300025940 | Bacteria | 2651 |
| 348 | Ga0207711_10016158 | 3300025941 | Bacteria | 6196 |
| 349 | Ga0207711_10030976 | 3300025941 | Bacteria | 4512 |
| 350 | Ga0207711_10033697 | 3300025941 | Bacteria | 4335 |
| 351 | Ga0207711_10042071 | 3300025941 | Bacteria | 3892 |
| 352 | Ga0207711_10073136 | 3300025941 | Unclassified | 2979 |
| 353 | Ga0207711_10091941 | 3300025941 | Bacteria | 2669 |
| 354 | Ga0207711_10114557 | 3300025941 | Bacteria | 2401 |
| 355 | Ga0207661_10002311 | 3300025944 | Bacteria | 13129 |
| 356 | Ga0207661_10031293 | 3300025944 | Bacteria | 4108 |
| 357 | Ga0207679_10002489 | 3300025945 | Bacteria | 11346 |
| 358 | Ga0207679_10193752 | 3300025945 | Bacteria | 1692 |
| 359 | Ga0207651_10000358 | 3300025960 | Bacteria | 19310 |
| 360 | Ga0207668_10051113 | 3300025972 | Bacteria | 2853 |
| 361 | Ga0207640_10026213 | 3300025981 | Bacteria | 3536 |
| 362 | Ga0207640_10040545 | 3300025981 | Bacteria | 2955 |
| 363 | Ga0207658_10053150 | 3300025986 | Bacteria | 2992 |
| 364 | Ga0207677_10029159 | 3300026023 | Bacteria | 3503 |
| 365 | Ga0207677_10038536 | 3300026023 | Bacteria | 3134 |
| 366 | Ga0207677_10098597 | 3300026023 | Bacteria | 2144 |
| 367 | Ga0207703_10021562 | 3300026035 | Bacteria | 5044 |
| 368 | Ga0207703_10024618 | 3300026035 | Bacteria | 4735 |
| 369 | Ga0207703_10136597 | 3300026035 | Bacteria | 2123 |
| 370 | Ga0207703_10225785 | 3300026035 | Bacteria | 1676 |
| 371 | Ga0207678_10030823 | 3300026067 | Bacteria | 4683 |
| 372 | Ga0207708_10067610 | 3300026075 | Bacteria | 2734 |
| 373 | Ga0207641_10001113 | 3300026088 | Bacteria | 27018 |
| 374 | Ga0207641_10099587 | 3300026088 | Bacteria | 2558 |
| 375 | Ga0207641_10188514 | 3300026088 | Bacteria | 1894 |
| 376 | Ga0207648_10015198 | 3300026089 | Bacteria | 7085 |
| 377 | Ga0207648_10017181 | 3300026089 | Bacteria | 6592 |
| 378 | Ga0207648_10024699 | 3300026089 | Bacteria | 5360 |
| 379 | Ga0207676_10090218 | 3300026095 | Bacteria | 2514 |
| 380 | Ga0207676_10139761 | 3300026095 | Bacteria | 2072 |
| 381 | Ga0207674_10102743 | 3300026116 | Bacteria | 2838 |
| 382 | Ga0207675_100009497 | 3300026118 | Bacteria | 9103 |
| 383 | Ga0207675_100015621 | 3300026118 | Bacteria | 7082 |
| 384 | Ga0207675_100030251 | 3300026118 | Bacteria | 5043 |
| 385 | Ga0207675_100044375 | 3300026118 | Bacteria | 4154 |
| 386 | Ga0207683_10000220 | 3300026121 | Bacteria | 50064 |
| 387 | Ga0207683_10078339 | 3300026121 | Bacteria | 2928 |
| 388 | Ga0207683_10135318 | 3300026121 | Unclassified | 2218 |
| 389 | Ga0207683_10198667 | 3300026121 | Bacteria | 1822 |
| 390 | Ga0209974_10014515 | 3300027876 | Bacteria | 2621 |
| 391 | Ga0207428_10000022 | 3300027907 | Bacteria | 273333 |
| 392 | Ga0207428_10000558 | 3300027907 | Bacteria | 44040 |
| 393 | Ga0207428_10010107 | 3300027907 | Bacteria | 8441 |
| 394 | Ga0207428_10044726 | 3300027907 | Bacteria | 3570 |
| 395 | Ga0207428_10113132 | 3300027907 | Bacteria | 2087 |
| 396 | Ga0207428_10130250 | 3300027907 | Bacteria | 1925 |
| 397 | Ga0207428_10215065 | 3300027907 | Bacteria | 1443 |
| 398 | Ga0268266_10003789 | 3300028379 | Bacteria | 14802 |
| 399 | Ga0268266_10013799 | 3300028379 | Bacteria | 6955 |
| 400 | Ga0268266_10059104 | 3300028379 | Bacteria | 3303 |
| 401 | Ga0268266_10189584 | 3300028379 | Bacteria | 1877 |
| 402 | Ga0268265_10005243 | 3300028380 | Bacteria | 8869 |
| 403 | Ga0268265_10015893 | 3300028380 | Bacteria | 5162 |
| 404 | Ga0268265_10048093 | 3300028380 | Bacteria | 3200 |
| 405 | Ga0268265_10084405 | 3300028380 | Bacteria | 2517 |
| 406 | Ga0268264_10150375 | 3300028381 | Bacteria | 2087 |
| 407 | Ga0268264_10183526 | 3300028381 | Bacteria | 1902 |
| 408 | Ga0268264_10222629 | 3300028381 | Bacteria | 1738 |
| 409 | Ga0307408_100014908 | 3300031548 | Bacteria | 5170 |
| 410 | Ga0307408_100017734 | 3300031548 | Bacteria | 4769 |
| 411 | Ga0307408_100028574 | 3300031548 | Bacteria | 3855 |
| 412 | Ga0307408_100048714 | 3300031548 | Bacteria | 3040 |
| 413 | Ga0307408_100174714 | 3300031548 | Bacteria | 1718 |
| 414 | Ga0316576_10001732 | 3300031727 | Bacteria | 12009 |
| 415 | Ga0316576_10012676 | 3300031727 | Bacteria | 5576 |
| 416 | Ga0316576_10079178 | 3300031727 | Bacteria | 2436 |
| 417 | Ga0316576_10097215 | 3300031727 | Bacteria | 2198 |
| 418 | Ga0316578_10039372 | 3300031728 | Bacteria | 2730 |
| 419 | Ga0316578_10045731 | 3300031728 | Bacteria | 2549 |
| 420 | Ga0307405_10106539 | 3300031731 | Unclassified | 1891 |
| 421 | Ga0307413_10011324 | 3300031824 | Bacteria | 4378 |
| 422 | Ga0307410_10015511 | 3300031852 | Bacteria | 4522 |
| 423 | Ga0307406_10006061 | 3300031901 | Bacteria | 6644 |
| 424 | Ga0307406_10060683 | 3300031901 | Bacteria | 2439 |
| 425 | Ga0307407_10083699 | 3300031903 | Bacteria | 1936 |
| 426 | Ga0307407_10164637 | 3300031903 | Bacteria | 1454 |
| 427 | Ga0307412_10056975 | 3300031911 | Bacteria | 2606 |
| 428 | Ga0307412_10080319 | 3300031911 | Bacteria | 2252 |
| 429 | Ga0307412_10257282 | 3300031911 | Unclassified | 1359 |
| 430 | Ga0307409_100001383 | 3300031995 | Bacteria | 11838 |
| 431 | Ga0307409_100015060 | 3300031995 | Bacteria | 5058 |
| 432 | Ga0307409_100043912 | 3300031995 | Bacteria | 3361 |
| 433 | Ga0307409_100099475 | 3300031995 | Bacteria | 2408 |
| 434 | Ga0307409_100146814 | 3300031995 | Bacteria | 2041 |
| 435 | Ga0307409_100169240 | 3300031995 | Bacteria | 1921 |
| 436 | Ga0307416_100019816 | 3300032002 | Bacteria | 4780 |
| 437 | Ga0307416_100042086 | 3300032002 | Bacteria | 3563 |
| 438 | Ga0307416_100051044 | 3300032002 | Bacteria | 3301 |
| 439 | Ga0307416_100128625 | 3300032002 | Bacteria | 2274 |
| 440 | Ga0307416_100164779 | 3300032002 | Unclassified | 2054 |
| 441 | Ga0307416_100225817 | 3300032002 | Unclassified | 1800 |
| 442 | Ga0307416_100248288 | 3300032002 | Bacteria | 1730 |
| 443 | Ga0307414_10003946 | 3300032004 | Bacteria | 7998 |
| 444 | Ga0307414_10294894 | 3300032004 | Bacteria | 1369 |
| 445 | Ga0307411_10013487 | 3300032005 | Bacteria | 4511 |
| 446 | Ga0307411_10022704 | 3300032005 | Bacteria | 3700 |
| 447 | Ga0307411_10040453 | 3300032005 | Bacteria | 2957 |
| 448 | Ga0307415_100033261 | 3300032126 | Bacteria | 3346 |
| 449 | Ga0307415_100036207 | 3300032126 | Bacteria | 3232 |
| 450 | Ga0307415_100059500 | 3300032126 | Bacteria | 2635 |
| 451 | Ga0307415_100070606 | 3300032126 | Bacteria | 2453 |
| 452 | Ga0307415_100152678 | 3300032126 | Unclassified | 1779 |
| 453 | Ga0307415_100155516 | 3300032126 | Bacteria | 1765 |
| 454 | Ga0316585_10003409 | 3300032137 | Bacteria | 4382 |
| 455 | Ga0373930_0005539 | 3300034816 | Bacteria | 2104 |
| 456 | Ga0373948_0001144 | 3300034817 | Bacteria | 3590 |
| 457 | Ga0373959_0003577 | 3300034820 | Bacteria | 2484 |
| 458 | Ga0373938_0009930 | 3300034957 | Bacteria | 1735 |
| 459 | Ga0373929_0001662 | 3300035085 | Bacteria | 4206 |
| 460 | Ga0373949_0003851 | 3300035090 | Bacteria | 3486 |
| 461 | Ga0373951_0001709 | 3300035091 | Bacteria | 5739 |
| 462 | Ga0373952_0005960 | 3300035092 | Bacteria | 2242 |
| 463 | Ga0373960_0001784 | 3300035121 | Bacteria | 4826 |
| 464 | Ga0373960_0019621 | 3300035121 | Unclassified | 1778 |
| 465 | Ga0373943_0014143 | 3300035170 | Bacteria | 3609 |
| 466 | Ga0373943_0093508 | 3300035170 | Bacteria | 1561 |
| 467 | Ga0373955_0062485 | 3300035172 | Bacteria | 2060 |
| 468 | Ga0373942_0002156 | 3300035207 | Bacteria | 4857 |
| 469 | Ga0373961_0001299 | 3300035241 | Bacteria | 7587 |
| 470 | Ga0373962_0021759 | 3300035242 | Bacteria | 1694 |
| 471 | Ga0316574_0005798 | 3300035398 | Bacteria | 6623 |
| 472 | Ga0373931_0003301 | 3300035691 | Bacteria | 7222 |
| 473 | Ga0373935_0001390 | 3300035692 | Bacteria | 13377 |
| 474 | Ga0373927_0195421 | 3300035695 | Unclassified | 1328 |
| 475 | Ga0373947_0019793 | 3300035725 | Bacteria | 3884 |
| 476 | Ga0373947_0030984 | 3300035725 | Bacteria | 3145 |
| 477 | Ga0373947_0061983 | 3300035725 | Bacteria | 2274 |
| 478 | Ga0373937_0113098 | 3300036401 | Unclassified | 2526 |
| 479 | Ga0373937_0130401 | 3300036401 | Bacteria | 2348 |
| 480 | Ga0373937_0192147 | 3300036401 | Bacteria | 1918 |
| 481 | Ga0373937_0324798 | 3300036401 | Unclassified | 1456 |
| 482 | Ga0316584_0062827 | 3300036712 | Unclassified | 2781 |
| 483 | Ga0316584_0147689 | 3300036712 | Bacteria | 1751 |
| 484 | Ga0395901_0138426 | 3300038443 | Bacteria | 2559 |
| 485 | Ga0400489_79885 | 3300039093 | Bacteria | 2165 |
| 486 | Ga0439450_011231 | 3300042008 | Bacteria | 1750 |
| 487 | Ga0450894_001322 | 3300042131 | Bacteria | 3596 |
| 488 | Ga0450896_003414 | 3300042133 | Bacteria | 2108 |
| 489 | Ga0439446_0005503 | 3300042156 | Bacteria | 3260 |
| 490 | Ga0451577_0009300 | 3300042876 | Bacteria | 9473 |
| 491 | Ga0453683_0101290 | 3300044673 | Bacteria | 1808 |
| 492 | Ga0466963_0043121 | 3300044694 | Bacteria | 2965 |
| 493 | Ga0453684_0189375 | 3300044712 | Archaea | 2408 |
| 494 | Ga0451576_0085794 | 3300045051 | Bacteria | 3275 |
| 495 | Ga0451576_0295006 | 3300045051 | Bacteria | 1695 |
| 496 | Ga0466967_0120944 | 3300045976 | Bacteria | 2419 |
| 497 | Ga0466967_0149774 | 3300045976 | Archaea | 2180 |
| 498 | Ga0495592_0047193 | 3300046454 | Bacteria | 3208 |
| 499 | Ga0495603_0077086 | 3300046455 | Bacteria | 1956 |
| 500 | Ga0495603_0159939 | 3300046455 | Unclassified | 1306 |
| 501 | Ga0495629_0138722 | 3300046459 | Bacteria | 1692 |
| 502 | Ga0495653_0282290 | 3300046463 | Bacteria | 1089 |
| 503 | Ga0495580_0004341 | 3300046472 | Bacteria | 11903 |
| 504 | Ga0495580_0085690 | 3300046472 | Bacteria | 2194 |
| 505 | Ga0495580_0168405 | 3300046472 | Bacteria | 1515 |
| 506 | Ga0495582_0142071 | 3300046473 | Bacteria | 1361 |
| 507 | Ga0495664_0046084 | 3300046477 | Bacteria | 2587 |
| 508 | Ga0495664_0059719 | 3300046477 | Bacteria | 2270 |
| 509 | Ga0495608_0011561 | 3300046511 | Bacteria | 6140 |
| 510 | Ga0495628_0172061 | 3300046516 | Bacteria | 1642 |
| 511 | Ga0495652_0118392 | 3300046529 | Bacteria | 2117 |
| 512 | Ga0495586_0128782 | 3300046535 | Bacteria | 1417 |
| 513 | Ga0495645_0007653 | 3300046543 | Bacteria | 7516 |
| 514 | Ga0495645_0076832 | 3300046543 | Bacteria | 2401 |
| 515 | Ga0495647_0023242 | 3300046681 | Bacteria | 2247 |
| 516 | Ga0495647_0042692 | 3300046681 | Bacteria | 1733 |
| 517 | Ga0495658_0022670 | 3300046683 | Bacteria | 3324 |
| 518 | Ga0495658_0085015 | 3300046683 | Bacteria | 1864 |
| 519 | Ga0495658_0104655 | 3300046683 | Bacteria | 1694 |
| 520 | Ga0495669_0000990 | 3300046684 | Bacteria | 11874 |
| 521 | Ga0495613_0004695 | 3300046689 | Bacteria | 10249 |
| 522 | Ga0495613_0148506 | 3300046689 | Bacteria | 1673 |
| 523 | Ga0495604_0017283 | 3300047317 | Bacteria | 5773 |
| 524 | Ga0495674_0029729 | 3300047319 | Bacteria | 4972 |
| 525 | Ga0495674_0172636 | 3300047319 | Bacteria | 1803 |
| 526 | Ga0495684_0000228 | 3300047471 | Bacteria | 43929 |
| 527 | Ga0496100_0026293 | 3300048903 | Bacteria | 3567 |
| 528 | Ga0496101_0000348 | 3300048904 | Bacteria | 31198 |
| 529 | Ga0496101_0064748 | 3300048904 | Bacteria | 2664 |
| 530 | Ga0496102_0297390 | 3300048905 | Bacteria | 1521 |
| 531 | Ga0496104_0005196 | 3300048907 | Bacteria | 11382 |
| 532 | Ga0496104_0069587 | 3300048907 | Bacteria | 3345 |
| 533 | Ga0496104_0084489 | 3300048907 | Bacteria | 3029 |
| 534 | Ga0496104_0109714 | 3300048907 | Unclassified | 2645 |
| 535 | Ga0496104_0217815 | 3300048907 | Bacteria | 1821 |
| 536 | Ga0496106_0097866 | 3300048909 | Bacteria | 2272 |
| 537 | Ga0496106_0265093 | 3300048909 | Bacteria | 1375 |
| 538 | Ga0496107_0139087 | 3300048910 | Bacteria | 1795 |
| 539 | Ga0496108_0021614 | 3300048911 | Bacteria | 5287 |
| 540 | Ga0496108_0148650 | 3300048911 | Bacteria | 2021 |
| 541 | Ga0496108_0284399 | 3300048911 | Bacteria | 1440 |
| 542 | Ga0496109_0001290 | 3300048912 | Bacteria | 20786 |
| 543 | Ga0496110_0008036 | 3300048913 | Bacteria | 8459 |
| 544 | Ga0496110_0159285 | 3300048913 | Bacteria | 2046 |
| 545 | Ga0496110_0277894 | 3300048913 | Bacteria | 1525 |
| 546 | Ga0496112_0027070 | 3300048915 | Bacteria | 5527 |
| 547 | Ga0496112_0091338 | 3300048915 | Bacteria | 3014 |
| 548 | Ga0496114_0002236 | 3300048917 | Bacteria | 14743 |
| 549 | Ga0496114_0002337 | 3300048917 | Bacteria | 14432 |
| 550 | Ga0496114_0109399 | 3300048917 | Unclassified | 2367 |
| 551 | Ga0496114_0211738 | 3300048917 | Bacteria | 1700 |
| 552 | Ga0496115_0012077 | 3300048918 | Bacteria | 6495 |
| 553 | Ga0501031_0040726 | 3300049568 | Bacteria | 3033 |
| 554 | Ga0501036_0030546 | 3300049572 | Bacteria | 4550 |
| 555 | Ga0501036_0156172 | 3300049572 | Unclassified | 1924 |
| 556 | Ga0501036_0279895 | 3300049572 | Unclassified | 1396 |
| 557 | Ga0501037_0119167 | 3300049573 | Bacteria | 1899 |
| 558 | Ga0501040_0004841 | 3300049576 | Bacteria | 8723 |
| 559 | Ga0501040_0201607 | 3300049576 | Unclassified | 1413 |
| 560 | Ga0501041_0002942 | 3300049577 | Bacteria | 9771 |
| 561 | Ga0501047_0072784 | 3300049581 | Bacteria | 3308 |
| 562 | Ga0501048_0013517 | 3300049582 | Bacteria | 6057 |
| 563 | Ga0501048_0042667 | 3300049582 | Bacteria | 3247 |
| 564 | Ga0501071_0006201 | 3300049587 | Bacteria | 7754 |
| 565 | Ga0501071_0016739 | 3300049587 | Bacteria | 5043 |
| 566 | Ga0501071_0019329 | 3300049587 | Bacteria | 4727 |
| 567 | Ga0501071_0022296 | 3300049587 | Bacteria | 4415 |
| 568 | Ga0501072_0010004 | 3300049588 | Bacteria | 7213 |
| 569 | Ga0501072_0017543 | 3300049588 | Bacteria | 5502 |
| 570 | Ga0501072_0030128 | 3300049588 | Bacteria | 4242 |
| 571 | Ga0501072_0048095 | 3300049588 | Bacteria | 3359 |
| 572 | Ga0501074_0087231 | 3300049590 | Bacteria | 2235 |
| 573 | Ga0501074_0111236 | 3300049590 | Bacteria | 1960 |
| 574 | Ga0501075_0079644 | 3300049591 | Bacteria | 2479 |
| 575 | Ga0501075_0105271 | 3300049591 | Bacteria | 2144 |
| 576 | Ga0501076_0026029 | 3300049592 | Bacteria | 4527 |
| 577 | Ga0501076_0164356 | 3300049592 | Unclassified | 1809 |
| 578 | Ga0501076_0171279 | 3300049592 | Bacteria | 1769 |
| 579 | Ga0501217_028030 | 3300049661 | Bacteria | 1370 |
| 580 | Ga0501079_0007892 | 3300049741 | Bacteria | 8066 |
| 581 | Ga0501079_0029175 | 3300049741 | Bacteria | 4234 |
| 582 | Ga0501080_0055210 | 3300049742 | Bacteria | 3700 |
| 583 | Ga0501081_0000406 | 3300049743 | Bacteria | 23901 |
| 584 | Ga0501081_0136202 | 3300049743 | Bacteria | 1758 |
| 585 | Ga0501081_0160036 | 3300049743 | Unclassified | 1622 |
| 586 | Ga0501081_0177963 | 3300049743 | Bacteria | 1537 |
| 587 | Ga0501083_0149519 | 3300049744 | Bacteria | 1529 |
| 588 | Ga0501035_0076370 | 3300049822 | Bacteria | 2963 |
| 589 | Ga0501045_0002648 | 3300049824 | Bacteria | 12203 |
| 590 | Ga0501045_0007195 | 3300049824 | Bacteria | 7722 |
| 591 | Ga0501045_0011015 | 3300049824 | Bacteria | 6338 |
| 592 | Ga0501045_0193451 | 3300049824 | Unclassified | 1516 |
| 593 | nmdc:mga03683_600_c2 | 3300050489 | Bacteria | 8045 |
| 594 | nmdc:mga00v17_23721_c1 | 3300050491 | Bacteria | 3552 |
| 595 | nmdc:mga00v17_4143_c1 | 3300050491 | Bacteria | 7506 |
| 596 | nmdc:mga0yw44_4147_c1 | 3300050492 | Bacteria | 6583 |
| 597 | nmdc:mga0yw44_61194_c1 | 3300050492 | Bacteria | 2309 |
| 598 | nmdc:mga0k408_4679_c1 | 3300050493 | Bacteria | 7252 |
| 599 | nmdc:mga05p37_121506_c1 | 3300050507 | Unclassified | 3208 |
| 600 | nmdc:mga05p37_1796_c1 | 3300050507 | Bacteria | 25058 |
| 601 | nmdc:mga05p37_200269_c1 | 3300050507 | Archaea | 2419 |
| 602 | nmdc:mga05p37_2105_c1 | 3300050507 | Bacteria | 23247 |
| 603 | nmdc:mga05p37_216566_c1 | 3300050507 | Bacteria | 2313 |
| 604 | nmdc:mga05p37_235500_c1 | 3300050507 | Bacteria | 2204 |
| 605 | nmdc:mga05p37_2819_c1 | 3300050507 | Bacteria | 20214 |
| 606 | nmdc:mga05p37_34458_c1 | 3300050507 | Bacteria | 6202 |
| 607 | nmdc:mga05p37_4142_c1 | 3300050507 | Bacteria | 16948 |
| 608 | nmdc:mga05p37_48480_c1 | 3300050507 | Bacteria | 5224 |
| 609 | nmdc:mga05p37_580882_c1 | 3300050507 | Bacteria | 1269 |
| 610 | nmdc:mga09592_3401_c1 | 3300050508 | Bacteria | 12863 |
| 611 | nmdc:mga09592_4431_c1 | 3300050508 | Bacteria | 11368 |
| 612 | nmdc:mga0qj67_4824_c1 | 3300050509 | Bacteria | 9800 |
| 613 | nmdc:mga0qj67_62847_c1 | 3300050509 | Bacteria | 2951 |
| 614 | nmdc:mga06r32_134482_c1 | 3300050510 | Bacteria | 2447 |
| 615 | nmdc:mga06r32_23254_c1 | 3300050510 | Bacteria | 5732 |
| 616 | nmdc:mga06r32_6534_c1 | 3300050510 | Bacteria | 10474 |
| 617 | nmdc:mga06r32_77179_c1 | 3300050510 | Archaea | 3236 |
| 618 | nmdc:mga06r32_90676_c1 | 3300050510 | Bacteria | 2986 |
| 619 | nmdc:mga08y16_10497_c1 | 3300050511 | Bacteria | 9716 |
| 620 | nmdc:mga08y16_1066_c1 | 3300050511 | Bacteria | 26995 |
| 621 | nmdc:mga08y16_108938_c1 | 3300050511 | Bacteria | 2884 |
| 622 | nmdc:mga08y16_125304_c1 | 3300050511 | Bacteria | 2672 |
| 623 | nmdc:mga08y16_1923_c1 | 3300050511 | Bacteria | 21184 |
| 624 | nmdc:mga08y16_21_c1 | 3300050511 | Bacteria | 254790 |
| 625 | nmdc:mga08y16_282095_c1 | 3300050511 | Bacteria | 1713 |
| 626 | nmdc:mga08y16_35300_c1 | 3300050511 | Bacteria | 5251 |
| 627 | nmdc:mga0n895_153202_c1 | 3300050512 | Unclassified | 2336 |
| 628 | nmdc:mga0n895_2150_c1 | 3300050512 | Bacteria | 15218 |
| 629 | nmdc:mga0n895_31871_c1 | 3300050512 | Bacteria | 5053 |
| 630 | nmdc:mga0n895_3356_c1 | 3300050512 | Bacteria | 12873 |
| 631 | nmdc:mga0n895_400504_c1 | 3300050512 | Bacteria | 1388 |
| 632 | nmdc:mga0n895_59365_c1 | 3300050512 | Bacteria | 3774 |
| 633 | nmdc:mga0n895_74231_c1 | 3300050512 | Bacteria | 3378 |
| 634 | nmdc:mga0n895_97_c2 | 3300050512 | Bacteria | 37428 |
| 635 | nmdc:mga0rr50_20_c1 | 3300050513 | Bacteria | 140799 |
| 636 | nmdc:mga0rr50_214006_c1 | 3300050513 | Bacteria | 1589 |
| 637 | nmdc:mga0rr50_223155_c1 | 3300050513 | Unclassified | 1557 |
| 638 | nmdc:mga0rr50_31819_c1 | 3300050513 | Bacteria | 3752 |
| 639 | nmdc:mga0rr50_41109_c1 | 3300050513 | Bacteria | 3366 |
| 640 | nmdc:mga0rr50_42681_c1 | 3300050513 | Bacteria | 3314 |
| 641 | nmdc:mga0rr50_43911_c1 | 3300050513 | Bacteria | 3274 |
| 642 | nmdc:mga0rr50_62346_c1 | 3300050513 | Bacteria | 2812 |
| 643 | nmdc:mga08x19_178_c1 | 3300050514 | Bacteria | 51286 |
| 644 | nmdc:mga08x19_41524_c1 | 3300050514 | Bacteria | 2930 |
| 645 | nmdc:mga0a205_138041_c1 | 3300050515 | Unclassified | 2338 |
| 646 | nmdc:mga0a205_249232_c1 | 3300050515 | Bacteria | 1656 |
| 647 | nmdc:mga0a205_3446_c1 | 3300050515 | Bacteria | 14116 |
| 648 | nmdc:mga0a205_41616_c1 | 3300050515 | Bacteria | 4425 |
| 649 | Ga0495601_0086087 | 3300053077 | Bacteria | 2019 |
| 650 | Ga0495619_0000422 | 3300053085 | Bacteria | 28636 |
| 651 | Ga0495619_0038606 | 3300053085 | Bacteria | 3115 |
| 652 | Ga0495619_0081819 | 3300053085 | Bacteria | 2175 |
| 653 | Ga0495619_0090977 | 3300053085 | Bacteria | 2066 |
| 654 | Ga0501084_0004142 | 3300054114 | Bacteria | 11817 |
| 655 | Ga0501084_0004916 | 3300054114 | Bacteria | 10921 |
| 656 | Ga0590071_000249 | 3300059421 | Bacteria | 15561 |
| 657 | Ga0590071_000772 | 3300059421 | Bacteria | 8967 |
| 658 | Ga0590071_006188 | 3300059421 | Unclassified | 2854 |
| 659 | Ga0590071_009311 | 3300059421 | Bacteria | 2305 |
| 660 | Ga0590074_000326 | 3300059423 | Bacteria | 6606 |
| 661 | Ga0590075_000576 | 3300059424 | Bacteria | 9946 |
| 662 | Ga0590075_001822 | 3300059424 | Bacteria | 5199 |
| 663 | Ga0590077_000087 | 3300059426 | Bacteria | 23513 |
| 664 | Ga0590077_002482 | 3300059426 | Unclassified | 3934 |
| 665 | Ga0501082_0001528 | 3300060353 | Bacteria | 20359 |
| 666 | Ga0501082_0013241 | 3300060353 | Bacteria | 7093 |
| 667 | Ga0501082_0040443 | 3300060353 | Bacteria | 4022 |
| 668 | Ga0501082_0169842 | 3300060353 | Unclassified | 1896 |
| 669 | Ga0530510_0001387 | 3300061734 | Bacteria | 16257 |
| 670 | Ga0530510_0036178 | 3300061734 | Bacteria | 3558 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048909 | Ga0496106_0265093 | Ga0496106_0265093_257_1345 | 321 |
| 2 | 3300050507 | nmdc:mga05p37_216566_c1 | nmdc:mga05p37_216566_c1_15_1070 | 326 |
| 3 | 3300026035 | Ga0207703_10225785 | Ga0207703_102257852 | 349 |
| 4 | 3300046463 | Ga0495653_0282290 | Ga0495653_0282290_19_1074 | 349 |
| 5 | 3300046689 | Ga0495613_0148506 | Ga0495613_0148506_17_1096 | 349 |
| 6 | 3300050511 | nmdc:mga08y16_1923_c1 | nmdc:mga08y16_1923_c1_20064_21122 | 349 |
| 7 | 3300049591 | Ga0501075_0105271 | Ga0501075_0105271_1072_2127 | 351 |
| 8 | 3300050509 | nmdc:mga0qj67_62847_c1 | nmdc:mga0qj67_62847_c1_18_1139 | 354 |
| 9 | 3300007076 | Ga0075435_100002656 | Ga0075435_1000026562 | 356 |
| 10 | 3300050513 | nmdc:mga0rr50_214006_c1 | nmdc:mga0rr50_214006_c1_273_1493 | 356 |
| 11 | 3300005328 | Ga0070676_10038917 | Ga0070676_100389172 | 357 |
| 12 | 3300005338 | Ga0068868_100011616 | Ga0068868_1000116162 | 357 |
| 13 | 3300005459 | Ga0068867_100025953 | Ga0068867_1000259534 | 357 |
| 14 | 3300005548 | Ga0070665_100010405 | Ga0070665_1000104057 | 357 |
| 15 | 3300005842 | Ga0068858_100034125 | Ga0068858_1000341256 | 357 |
| 16 | 3300006237 | Ga0097621_100030260 | Ga0097621_1000302603 | 357 |
| 17 | 3300006358 | Ga0068871_100015114 | Ga0068871_1000151141 | 357 |
| 18 | 3300006881 | Ga0068865_100039835 | Ga0068865_1000398353 | 357 |
| 19 | 3300009098 | Ga0105245_10005530 | Ga0105245_100055303 | 357 |
| 20 | 3300009176 | Ga0105242_10027319 | Ga0105242_100273193 | 357 |
| 21 | 3300009177 | Ga0105248_10148605 | Ga0105248_101486052 | 357 |
| 22 | 3300013306 | Ga0163162_10056599 | Ga0163162_100565992 | 357 |
| 23 | 3300025903 | Ga0207680_10019777 | Ga0207680_100197772 | 357 |
| 24 | 3300025927 | Ga0207687_10008541 | Ga0207687_100085415 | 357 |
| 25 | 3300025934 | Ga0207686_10020853 | Ga0207686_100208532 | 357 |
| 26 | 3300025938 | Ga0207704_10010703 | Ga0207704_100107033 | 357 |
| 27 | 3300025940 | Ga0207691_10095964 | Ga0207691_100959643 | 357 |
| 28 | 3300025941 | Ga0207711_10030976 | Ga0207711_100309766 | 357 |
| 29 | 3300025941 | Ga0207711_10033697 | Ga0207711_100336973 | 357 |
| 30 | 3300026023 | Ga0207677_10029159 | Ga0207677_100291592 | 357 |
| 31 | 3300026035 | Ga0207703_10024618 | Ga0207703_100246181 | 357 |
| 32 | 3300026089 | Ga0207648_10017181 | Ga0207648_100171815 | 357 |
| 33 | 3300026121 | Ga0207683_10198667 | Ga0207683_101986672 | 357 |
| 34 | 3300028379 | Ga0268266_10013799 | Ga0268266_100137996 | 357 |
| 35 | 3300034816 | Ga0373930_0005539 | Ga0373930_0005539_775_1995 | 357 |
| 36 | 3300034817 | Ga0373948_0001144 | Ga0373948_0001144_472_1692 | 357 |
| 37 | 3300034820 | Ga0373959_0003577 | Ga0373959_0003577_56_1276 | 357 |
| 38 | 3300034957 | Ga0373938_0009930 | Ga0373938_0009930_332_1552 | 357 |
| 39 | 3300035085 | Ga0373929_0001662 | Ga0373929_0001662_779_1999 | 357 |
| 40 | 3300035090 | Ga0373949_0003851 | Ga0373949_0003851_304_1524 | 357 |
| 41 | 3300035091 | Ga0373951_0001709 | Ga0373951_0001709_2642_3862 | 357 |
| 42 | 3300035092 | Ga0373952_0005960 | Ga0373952_0005960_324_1544 | 357 |
| 43 | 3300035121 | Ga0373960_0001784 | Ga0373960_0001784_937_2157 | 357 |
| 44 | 3300035207 | Ga0373942_0002156 | Ga0373942_0002156_3141_4361 | 357 |
| 45 | 3300035241 | Ga0373961_0001299 | Ga0373961_0001299_3579_4799 | 357 |
| 46 | 3300035242 | Ga0373962_0021759 | Ga0373962_0021759_292_1512 | 357 |
| 47 | 3300035691 | Ga0373931_0003301 | Ga0373931_0003301_3351_4571 | 357 |
| 48 | 3300045051 | Ga0451576_0085794 | Ga0451576_0085794_794_2014 | 357 |
| 49 | 3300048910 | Ga0496107_0139087 | Ga0496107_0139087_31_1224 | 357 |
| 50 | 3300048911 | Ga0496108_0284399 | Ga0496108_0284399_148_1308 | 357 |
| 51 | 3300005347 | Ga0070668_100091583 | Ga0070668_1000915832 | 358 |
| 52 | 3300005563 | Ga0068855_100322533 | Ga0068855_1003225332 | 358 |
| 53 | 3300005718 | Ga0068866_10010359 | Ga0068866_100103593 | 358 |
| 54 | 3300006237 | Ga0097621_100022317 | Ga0097621_1000223172 | 359 |
| 55 | 3300006358 | Ga0068871_100032832 | Ga0068871_1000328324 | 359 |
| 56 | 3300009094 | Ga0111539_10043681 | Ga0111539_100436812 | 359 |
| 57 | 3300027907 | Ga0207428_10044726 | Ga0207428_100447262 | 359 |
| 58 | 3300035170 | Ga0373943_0093508 | Ga0373943_0093508_57_1217 | 359 |
| 59 | 3300036401 | Ga0373937_0192147 | Ga0373937_0192147_247_1407 | 359 |
| 60 | 3300044694 | Ga0466963_0043121 | Ga0466963_0043121_681_1853 | 359 |
| 61 | 3300045976 | Ga0466967_0149774 | Ga0466967_0149774_800_1972 | 359 |
| 62 | 3300046681 | Ga0495647_0023242 | Ga0495647_0023242_418_1578 | 359 |
| 63 | 3300048903 | Ga0496100_0026293 | Ga0496100_0026293_2038_3198 | 359 |
| 64 | 3300048904 | Ga0496101_0000348 | Ga0496101_0000348_28332_29492 | 359 |
| 65 | 3300048917 | Ga0496114_0002236 | Ga0496114_0002236_13382_14542 | 359 |
| 66 | 3300050511 | nmdc:mga08y16_10497_c1 | nmdc:mga08y16_10497_c1_4576_5778 | 359 |
| 67 | 3300005549 | Ga0070704_100055179 | Ga0070704_1000551792 | 360 |
| 68 | 3300049743 | Ga0501081_0136202 | Ga0501081_0136202_493_1707 | 360 |
| 69 | 3300005471 | Ga0070698_100229468 | Ga0070698_1002294682 | 361 |
| 70 | 3300005841 | Ga0068863_100194278 | Ga0068863_1001942782 | 361 |
| 71 | 3300006881 | Ga0068865_100089278 | Ga0068865_1000892782 | 361 |
| 72 | 3300009177 | Ga0105248_10018395 | Ga0105248_100183954 | 361 |
| 73 | 3300014969 | Ga0157376_10041762 | Ga0157376_100417622 | 361 |
| 74 | 3300025938 | Ga0207704_10062347 | Ga0207704_100623471 | 361 |
| 75 | 3300035172 | Ga0373955_0062485 | Ga0373955_0062485_141_1310 | 361 |
| 76 | 3300042876 | Ga0451577_0009300 | Ga0451577_0009300_6478_7650 | 361 |
| 77 | 3300044712 | Ga0453684_0189375 | Ga0453684_0189375_176_1348 | 361 |
| 78 | 3300046535 | Ga0495586_0128782 | Ga0495586_0128782_87_1256 | 361 |
| 79 | 3300046683 | Ga0495658_0104655 | Ga0495658_0104655_152_1321 | 361 |
| 80 | 3300053077 | Ga0495601_0086087 | Ga0495601_0086087_197_1366 | 361 |
| 81 | 3300053085 | Ga0495619_0090977 | Ga0495619_0090977_378_1547 | 361 |
| 82 | 3300005841 | Ga0068863_100066986 | Ga0068863_1000669863 | 362 |
| 83 | 3300006852 | Ga0075433_10007021 | Ga0075433_100070216 | 362 |
| 84 | 3300006871 | Ga0075434_100045559 | Ga0075434_1000455593 | 362 |
| 85 | 3300026088 | Ga0207641_10001113 | Ga0207641_100011132 | 362 |
| 86 | 3300035121 | Ga0373960_0019621 | Ga0373960_0019621_468_1637 | 362 |
| 87 | 3300049581 | Ga0501047_0072784 | Ga0501047_0072784_1559_2731 | 362 |
| 88 | 3300050512 | nmdc:mga0n895_31871_c1 | nmdc:mga0n895_31871_c1_1154_2323 | 362 |
| 89 | 3300005328 | Ga0070676_10004192 | Ga0070676_100041922 | 364 |
| 90 | 3300005330 | Ga0070690_100131778 | Ga0070690_1001317782 | 364 |
| 91 | 3300005341 | Ga0070691_10000473 | Ga0070691_100004736 | 364 |
| 92 | 3300005353 | Ga0070669_100088294 | Ga0070669_1000882942 | 364 |
| 93 | 3300005356 | Ga0070674_100024262 | Ga0070674_1000242622 | 364 |
| 94 | 3300005364 | Ga0070673_100071179 | Ga0070673_1000711792 | 364 |
| 95 | 3300005438 | Ga0070701_10014384 | Ga0070701_100143842 | 364 |
| 96 | 3300005440 | Ga0070705_100006359 | Ga0070705_1000063592 | 364 |
| 97 | 3300005441 | Ga0070700_100006004 | Ga0070700_1000060043 | 364 |
| 98 | 3300005441 | Ga0070700_100070143 | Ga0070700_1000701432 | 364 |
| 99 | 3300005459 | Ga0068867_100009353 | Ga0068867_1000093535 | 364 |
| 100 | 3300005459 | Ga0068867_100013323 | Ga0068867_1000133234 | 364 |
| 101 | 3300005546 | Ga0070696_100029118 | Ga0070696_1000291182 | 364 |
| 102 | 3300005549 | Ga0070704_100011495 | Ga0070704_1000114952 | 364 |
| 103 | 3300005615 | Ga0070702_100001302 | Ga0070702_1000013022 | 364 |
| 104 | 3300005719 | Ga0068861_100003622 | Ga0068861_10000362210 | 364 |
| 105 | 3300006881 | Ga0068865_100058204 | Ga0068865_1000582042 | 364 |
| 106 | 3300009093 | Ga0105240_10178022 | Ga0105240_101780222 | 364 |
| 107 | 3300009148 | Ga0105243_10016882 | Ga0105243_100168821 | 364 |
| 108 | 3300009148 | Ga0105243_10054372 | Ga0105243_100543722 | 364 |
| 109 | 3300009176 | Ga0105242_10097791 | Ga0105242_100977912 | 364 |
| 110 | 3300025913 | Ga0207695_10165469 | Ga0207695_101654692 | 364 |
| 111 | 3300025923 | Ga0207681_10244036 | Ga0207681_102440361 | 364 |
| 112 | 3300025934 | Ga0207686_10017136 | Ga0207686_100171362 | 364 |
| 113 | 3300025935 | Ga0207709_10048363 | Ga0207709_100483632 | 364 |
| 114 | 3300025938 | Ga0207704_10132313 | Ga0207704_101323131 | 364 |
| 115 | 3300025981 | Ga0207640_10026213 | Ga0207640_100262133 | 364 |
| 116 | 3300026075 | Ga0207708_10067610 | Ga0207708_100676102 | 364 |
| 117 | 3300026089 | Ga0207648_10015198 | Ga0207648_100151982 | 364 |
| 118 | 3300026089 | Ga0207648_10024699 | Ga0207648_100246992 | 364 |
| 119 | 3300026118 | Ga0207675_100009497 | Ga0207675_1000094976 | 364 |
| 120 | 3300005335 | Ga0070666_10004947 | Ga0070666_100049475 | 365 |
| 121 | 3300005356 | Ga0070674_100133085 | Ga0070674_1001330852 | 365 |
| 122 | 3300005366 | Ga0070659_100233553 | Ga0070659_1002335531 | 365 |
| 123 | 3300005471 | Ga0070698_100054630 | Ga0070698_1000546302 | 365 |
| 124 | 3300005536 | Ga0070697_100038812 | Ga0070697_1000388123 | 365 |
| 125 | 3300005578 | Ga0068854_100052821 | Ga0068854_1000528213 | 365 |
| 126 | 3300005844 | Ga0068862_100234264 | Ga0068862_1002342642 | 365 |
| 127 | 3300006852 | Ga0075433_10016600 | Ga0075433_100166002 | 365 |
| 128 | 3300006871 | Ga0075434_100004294 | Ga0075434_1000042949 | 365 |
| 129 | 3300006871 | Ga0075434_100035368 | Ga0075434_1000353683 | 365 |
| 130 | 3300006871 | Ga0075434_100059288 | Ga0075434_1000592883 | 365 |
| 131 | 3300006914 | Ga0075436_100000295 | Ga0075436_10000029515 | 365 |
| 132 | 3300007076 | Ga0075435_100000147 | Ga0075435_10000014715 | 365 |
| 133 | 3300007076 | Ga0075435_100037478 | Ga0075435_1000374781 | 365 |
| 134 | 3300009093 | Ga0105240_10197850 | Ga0105240_101978502 | 365 |
| 135 | 3300009094 | Ga0111539_10100907 | Ga0111539_101009072 | 365 |
| 136 | 3300009147 | Ga0114129_10001820 | Ga0114129_1000182030 | 365 |
| 137 | 3300009147 | Ga0114129_10034155 | Ga0114129_100341554 | 365 |
| 138 | 3300025903 | Ga0207680_10030934 | Ga0207680_100309343 | 365 |
| 139 | 3300025910 | Ga0207684_10325909 | Ga0207684_103259091 | 365 |
| 140 | 3300025918 | Ga0207662_10009833 | Ga0207662_100098332 | 365 |
| 141 | 3300025923 | Ga0207681_10012038 | Ga0207681_100120382 | 365 |
| 142 | 3300025926 | Ga0207659_10017562 | Ga0207659_100175626 | 365 |
| 143 | 3300028380 | Ga0268265_10005243 | Ga0268265_100052437 | 365 |
| 144 | 3300048909 | Ga0496106_0097866 | Ga0496106_0097866_747_1967 | 365 |
| 145 | 3300050507 | nmdc:mga05p37_2105_c1 | nmdc:mga05p37_2105_c1_21812_23023 | 365 |
| 146 | 3300050507 | nmdc:mga05p37_48480_c1 | nmdc:mga05p37_48480_c1_2890_4059 | 365 |
| 147 | 3300050511 | nmdc:mga08y16_35300_c1 | nmdc:mga08y16_35300_c1_2475_3644 | 365 |
| 148 | 3300050512 | nmdc:mga0n895_153202_c1 | nmdc:mga0n895_153202_c1_856_2070 | 365 |
| 149 | 3300050512 | nmdc:mga0n895_400504_c1 | nmdc:mga0n895_400504_c1_101_1294 | 365 |
| 150 | 3300050512 | nmdc:mga0n895_74231_c1 | nmdc:mga0n895_74231_c1_907_2118 | 365 |
| 151 | 3300050512 | nmdc:mga0n895_97_c2 | nmdc:mga0n895_97_c2_6084_7286 | 365 |
| 152 | 3300050513 | nmdc:mga0rr50_20_c1 | nmdc:mga0rr50_20_c1_20214_21416 | 365 |
| 153 | 3300050513 | nmdc:mga0rr50_31819_c1 | nmdc:mga0rr50_31819_c1_19_1233 | 365 |
| 154 | 3300050514 | nmdc:mga08x19_178_c1 | nmdc:mga08x19_178_c1_20031_21233 | 365 |
| 155 | 3300050515 | nmdc:mga0a205_3446_c1 | nmdc:mga0a205_3446_c1_3584_4795 | 365 |
| 156 | 3300005328 | Ga0070676_10038590 | Ga0070676_100385902 | 366 |
| 157 | 3300005353 | Ga0070669_100060746 | Ga0070669_1000607462 | 366 |
| 158 | 3300005354 | Ga0070675_100038954 | Ga0070675_1000389542 | 366 |
| 159 | 3300005355 | Ga0070671_100061790 | Ga0070671_1000617903 | 366 |
| 160 | 3300005441 | Ga0070700_100079587 | Ga0070700_1000795872 | 366 |
| 161 | 3300005549 | Ga0070704_100089098 | Ga0070704_1000890982 | 366 |
| 162 | 3300005843 | Ga0068860_100185959 | Ga0068860_1001859592 | 366 |
| 163 | 3300005844 | Ga0068862_100046267 | Ga0068862_1000462672 | 366 |
| 164 | 3300006871 | Ga0075434_100302637 | Ga0075434_1003026371 | 366 |
| 165 | 3300025893 | Ga0207682_10011954 | Ga0207682_100119543 | 366 |
| 166 | 3300025907 | Ga0207645_10041479 | Ga0207645_100414792 | 366 |
| 167 | 3300025933 | Ga0207706_10066896 | Ga0207706_100668962 | 366 |
| 168 | 3300025937 | Ga0207669_10221925 | Ga0207669_102219252 | 366 |
| 169 | 3300025972 | Ga0207668_10051113 | Ga0207668_100511132 | 366 |
| 170 | 3300028380 | Ga0268265_10084405 | Ga0268265_100844052 | 366 |
| 171 | 3300028381 | Ga0268264_10150375 | Ga0268264_101503751 | 366 |
| 172 | 3300050513 | nmdc:mga0rr50_223155_c1 | nmdc:mga0rr50_223155_c1_86_1258 | 366 |
| 173 | 3300060353 | Ga0501082_0169842 | Ga0501082_0169842_530_1711 | 366 |
| 174 | 3300005468 | Ga0070707_100195747 | Ga0070707_1001957472 | 367 |
| 175 | 3300006871 | Ga0075434_100005549 | Ga0075434_10000554910 | 367 |
| 176 | 3300007076 | Ga0075435_100091312 | Ga0075435_1000913122 | 367 |
| 177 | 3300009147 | Ga0114129_10108011 | Ga0114129_101080112 | 367 |
| 178 | 3300026118 | Ga0207675_100030251 | Ga0207675_1000302513 | 367 |
| 179 | 3300050512 | nmdc:mga0n895_3356_c1 | nmdc:mga0n895_3356_c1_244_1446 | 367 |
| 180 | 3300050513 | nmdc:mga0rr50_42681_c1 | nmdc:mga0rr50_42681_c1_284_1486 | 367 |
| 181 | 3300050513 | nmdc:mga0rr50_43911_c1 | nmdc:mga0rr50_43911_c1_365_1549 | 367 |
| 182 | 3300050514 | nmdc:mga08x19_41524_c1 | nmdc:mga08x19_41524_c1_36_1238 | 367 |
| 183 | 3300005549 | Ga0070704_100103135 | Ga0070704_1001031352 | 368 |
| 184 | 3300007076 | Ga0075435_100149449 | Ga0075435_1001494492 | 369 |
| 185 | 3300049743 | Ga0501081_0177963 | Ga0501081_0177963_298_1509 | 369 |
| 186 | 3300049744 | Ga0501083_0149519 | Ga0501083_0149519_11_1129 | 369 |
| 187 | 3300050507 | nmdc:mga05p37_200269_c1 | nmdc:mga05p37_200269_c1_152_1348 | 369 |
| 188 | 3300005367 | Ga0070667_100072801 | Ga0070667_1000728012 | 370 |
| 189 | 3300005843 | Ga0068860_100061312 | Ga0068860_1000613122 | 370 |
| 190 | 3300009147 | Ga0114129_10036366 | Ga0114129_100363662 | 370 |
| 191 | 3300009147 | Ga0114129_10112109 | Ga0114129_101121093 | 370 |
| 192 | 3300009177 | Ga0105248_10033764 | Ga0105248_100337644 | 370 |
| 193 | 3300013308 | Ga0157375_10028668 | Ga0157375_100286683 | 370 |
| 194 | 3300014968 | Ga0157379_10044495 | Ga0157379_100444953 | 370 |
| 195 | 3300031548 | Ga0307408_100014908 | Ga0307408_1000149083 | 370 |
| 196 | 3300050507 | nmdc:mga05p37_34458_c1 | nmdc:mga05p37_34458_c1_4295_5482 | 370 |
| 197 | 3300050512 | nmdc:mga0n895_59365_c1 | nmdc:mga0n895_59365_c1_114_1322 | 370 |
| 198 | 3300009553 | Ga0105249_10154010 | Ga0105249_101540102 | 371 |
| 199 | 3300014326 | Ga0157380_10034162 | Ga0157380_100341621 | 371 |
| 200 | 3300014326 | Ga0157380_10051633 | Ga0157380_100516332 | 372 |
| 201 | 3300005445 | Ga0070708_100275386 | Ga0070708_1002753862 | 373 |
| 202 | 3300025986 | Ga0207658_10053150 | Ga0207658_100531503 | 373 |
| 203 | 3300005468 | Ga0070707_100079899 | Ga0070707_1000798991 | 375 |
| 204 | 3300009094 | Ga0111539_10115071 | Ga0111539_101150713 | 375 |
| 205 | 3300050511 | nmdc:mga08y16_125304_c1 | nmdc:mga08y16_125304_c1_550_1830 | 375 |
| 206 | 3300014968 | Ga0157379_10000584 | Ga0157379_100005846 | 376 |
| 207 | 3300031995 | Ga0307409_100099475 | Ga0307409_1000994751 | 376 |
| 208 | 3300035692 | Ga0373935_0001390 | Ga0373935_0001390_9964_11172 | 376 |
| 209 | 3300035725 | Ga0373947_0061983 | Ga0373947_0061983_306_1514 | 376 |
| 210 | 3300046472 | Ga0495580_0004341 | Ga0495580_0004341_2612_3820 | 376 |
| 211 | 3300003203 | JGI25406J46586_10000491 | JGI25406J46586_100004912 | 377 |
| 212 | 3300005985 | Ga0081539_10000093 | Ga0081539_10000093139 | 377 |
| 213 | 3300031731 | Ga0307405_10106539 | Ga0307405_101065392 | 377 |
| 214 | 3300032126 | Ga0307415_100070606 | Ga0307415_1000706062 | 377 |
| 215 | 3300042131 | Ga0450894_001322 | Ga0450894_001322_1808_2980 | 377 |
| 216 | 3300042133 | Ga0450896_003414 | Ga0450896_003414_696_1868 | 377 |
| 217 | 3300005617 | Ga0068859_100024547 | Ga0068859_1000245474 | 378 |
| 218 | 3300006931 | Ga0097620_100024547 | Ga0097620_1000245474 | 378 |
| 219 | 3300005329 | Ga0070683_100136965 | Ga0070683_1001369652 | 379 |
| 220 | 3300009093 | Ga0105240_10011792 | Ga0105240_100117923 | 379 |
| 221 | 3300013307 | Ga0157372_10140203 | Ga0157372_101402032 | 379 |
| 222 | 3300025922 | Ga0207646_10036937 | Ga0207646_100369373 | 380 |
| 223 | 3300032002 | Ga0307416_100128625 | Ga0307416_1001286252 | 380 |
| 224 | 3300005290 | Ga0065712_10026676 | Ga0065712_100266761 | 381 |
| 225 | 3300031903 | Ga0307407_10164637 | Ga0307407_101646372 | 381 |
| 226 | 3300031995 | Ga0307409_100043912 | Ga0307409_1000439121 | 381 |
| 227 | 3300035170 | Ga0373943_0014143 | Ga0373943_0014143_604_1755 | 383 |
| 228 | 3300035725 | Ga0373947_0030984 | Ga0373947_0030984_107_1258 | 383 |
| 229 | 3300046455 | Ga0495603_0159939 | Ga0495603_0159939_34_1251 | 383 |
| 230 | 3300005345 | Ga0070692_10094327 | Ga0070692_100943272 | 384 |
| 231 | 3300005467 | Ga0070706_100000101 | Ga0070706_10000010177 | 384 |
| 232 | 3300005467 | Ga0070706_100087293 | Ga0070706_1000872933 | 384 |
| 233 | 3300005468 | Ga0070707_100014493 | Ga0070707_1000144936 | 384 |
| 234 | 3300005471 | Ga0070698_100040293 | Ga0070698_1000402933 | 384 |
| 235 | 3300005518 | Ga0070699_100008689 | Ga0070699_1000086893 | 384 |
| 236 | 3300005518 | Ga0070699_100093431 | Ga0070699_1000934312 | 384 |
| 237 | 3300005536 | Ga0070697_100000189 | Ga0070697_10000018912 | 384 |
| 238 | 3300005549 | Ga0070704_100140567 | Ga0070704_1001405672 | 384 |
| 239 | 3300006847 | Ga0075431_100011777 | Ga0075431_10001177710 | 384 |
| 240 | 3300009098 | Ga0105245_10324095 | Ga0105245_103240952 | 384 |
| 241 | 3300025910 | Ga0207684_10000584 | Ga0207684_1000058432 | 384 |
| 242 | 3300025910 | Ga0207684_10000607 | Ga0207684_1000060727 | 384 |
| 243 | 3300025922 | Ga0207646_10024832 | Ga0207646_100248324 | 384 |
| 244 | 3300049587 | Ga0501071_0006201 | Ga0501071_0006201_6530_7714 | 384 |
| 245 | 3300049588 | Ga0501072_0010004 | Ga0501072_0010004_5498_6682 | 384 |
| 246 | 3300049592 | Ga0501076_0171279 | Ga0501076_0171279_45_1229 | 384 |
| 247 | 3300049824 | Ga0501045_0002648 | Ga0501045_0002648_5401_6585 | 384 |
| 248 | 3300050510 | nmdc:mga06r32_134482_c1 | nmdc:mga06r32_134482_c1_114_1391 | 384 |
| 249 | 3300059421 | Ga0590071_000249 | Ga0590071_000249_557_1741 | 384 |
| 250 | 3300005336 | Ga0070680_100041031 | Ga0070680_1000410313 | 385 |
| 251 | 3300005458 | Ga0070681_10019500 | Ga0070681_100195005 | 385 |
| 252 | 3300005530 | Ga0070679_100022602 | Ga0070679_1000226023 | 385 |
| 253 | 3300009545 | Ga0105237_10176890 | Ga0105237_101768902 | 385 |
| 254 | 3300025912 | Ga0207707_10039875 | Ga0207707_100398753 | 385 |
| 255 | 3300025914 | Ga0207671_10111125 | Ga0207671_101111252 | 385 |
| 256 | 3300025917 | Ga0207660_10029026 | Ga0207660_100290262 | 385 |
| 257 | 3300025921 | Ga0207652_10038008 | Ga0207652_100380082 | 385 |
| 258 | 3300031911 | Ga0307412_10080319 | Ga0307412_100803192 | 385 |
| 259 | 3300031995 | Ga0307409_100169240 | Ga0307409_1001692401 | 385 |
| 260 | 3300032002 | Ga0307416_100019816 | Ga0307416_1000198164 | 385 |
| 261 | 3300032005 | Ga0307411_10022704 | Ga0307411_100227042 | 385 |
| 262 | 3300032126 | Ga0307415_100155516 | Ga0307415_1001555162 | 385 |
| 263 | 3300036712 | Ga0316584_0062827 | Ga0316584_0062827_85_1296 | 385 |
| 264 | 3300044673 | Ga0453683_0101290 | Ga0453683_0101290_291_1454 | 385 |
| 265 | 3300005331 | Ga0070670_100098815 | Ga0070670_1000988152 | 386 |
| 266 | 3300005333 | Ga0070677_10005129 | Ga0070677_100051292 | 386 |
| 267 | 3300005334 | Ga0068869_100222030 | Ga0068869_1002220301 | 386 |
| 268 | 3300005355 | Ga0070671_100064146 | Ga0070671_1000641462 | 386 |
| 269 | 3300005356 | Ga0070674_100045893 | Ga0070674_1000458932 | 386 |
| 270 | 3300005456 | Ga0070678_100028953 | Ga0070678_1000289532 | 386 |
| 271 | 3300005546 | Ga0070696_100058504 | Ga0070696_1000585043 | 386 |
| 272 | 3300005548 | Ga0070665_100033210 | Ga0070665_1000332102 | 386 |
| 273 | 3300014969 | Ga0157376_10124749 | Ga0157376_101247492 | 386 |
| 274 | 3300025893 | Ga0207682_10015468 | Ga0207682_100154683 | 386 |
| 275 | 3300025925 | Ga0207650_10180756 | Ga0207650_101807562 | 386 |
| 276 | 3300025937 | Ga0207669_10062920 | Ga0207669_100629202 | 386 |
| 277 | 3300025937 | Ga0207669_10093624 | Ga0207669_100936242 | 386 |
| 278 | 3300026116 | Ga0207674_10102743 | Ga0207674_101027431 | 386 |
| 279 | 3300026121 | Ga0207683_10078339 | Ga0207683_100783392 | 386 |
| 280 | 3300026121 | Ga0207683_10135318 | Ga0207683_101353182 | 386 |
| 281 | 3300028379 | Ga0268266_10059104 | Ga0268266_100591043 | 386 |
| 282 | 3300045976 | Ga0466967_0120944 | Ga0466967_0120944_452_1612 | 386 |
| 283 | 3300046472 | Ga0495580_0085690 | Ga0495580_0085690_509_1726 | 386 |
| 284 | 3300048905 | Ga0496102_0297390 | Ga0496102_0297390_129_1295 | 386 |
| 285 | 3300048911 | Ga0496108_0148650 | Ga0496108_0148650_728_1894 | 386 |
| 286 | 3300048913 | Ga0496110_0159285 | Ga0496110_0159285_842_2008 | 386 |
| 287 | 3300005328 | Ga0070676_10021642 | Ga0070676_100216422 | 387 |
| 288 | 3300005331 | Ga0070670_100014348 | Ga0070670_1000143487 | 387 |
| 289 | 3300005340 | Ga0070689_100199512 | Ga0070689_1001995122 | 387 |
| 290 | 3300005353 | Ga0070669_100168146 | Ga0070669_1001681462 | 387 |
| 291 | 3300005354 | Ga0070675_100223235 | Ga0070675_1002232351 | 387 |
| 292 | 3300005356 | Ga0070674_100153363 | Ga0070674_1001533631 | 387 |
| 293 | 3300005364 | Ga0070673_100000282 | Ga0070673_10000028220 | 387 |
| 294 | 3300005367 | Ga0070667_100013136 | Ga0070667_1000131367 | 387 |
| 295 | 3300005435 | Ga0070714_100020682 | Ga0070714_1000206825 | 387 |
| 296 | 3300005456 | Ga0070678_100002631 | Ga0070678_1000026313 | 387 |
| 297 | 3300005458 | Ga0070681_10108226 | Ga0070681_101082262 | 387 |
| 298 | 3300005459 | Ga0068867_100065776 | Ga0068867_1000657761 | 387 |
| 299 | 3300005543 | Ga0070672_100029894 | Ga0070672_1000298944 | 387 |
| 300 | 3300005578 | Ga0068854_100050997 | Ga0068854_1000509972 | 387 |
| 301 | 3300006051 | Ga0075364_10047399 | Ga0075364_100473993 | 387 |
| 302 | 3300006177 | Ga0075362_10000421 | Ga0075362_100004214 | 387 |
| 303 | 3300006178 | Ga0075367_10003356 | Ga0075367_100033563 | 387 |
| 304 | 3300006195 | Ga0075366_10013364 | Ga0075366_100133642 | 387 |
| 305 | 3300006237 | Ga0097621_100013417 | Ga0097621_1000134177 | 387 |
| 306 | 3300006353 | Ga0075370_10006888 | Ga0075370_100068882 | 387 |
| 307 | 3300006358 | Ga0068871_100005279 | Ga0068871_1000052797 | 387 |
| 308 | 3300009094 | Ga0111539_10000059 | Ga0111539_1000005950 | 387 |
| 309 | 3300009553 | Ga0105249_10153421 | Ga0105249_101534213 | 387 |
| 310 | 3300013297 | Ga0157378_10000578 | Ga0157378_1000057813 | 387 |
| 311 | 3300013308 | Ga0157375_10002741 | Ga0157375_100027417 | 387 |
| 312 | 3300025903 | Ga0207680_10004015 | Ga0207680_100040156 | 387 |
| 313 | 3300025912 | Ga0207707_10036870 | Ga0207707_100368703 | 387 |
| 314 | 3300025925 | Ga0207650_10030010 | Ga0207650_100300104 | 387 |
| 315 | 3300025929 | Ga0207664_10177549 | Ga0207664_101775492 | 387 |
| 316 | 3300025931 | Ga0207644_10022378 | Ga0207644_100223782 | 387 |
| 317 | 3300025937 | Ga0207669_10046761 | Ga0207669_100467613 | 387 |
| 318 | 3300025940 | Ga0207691_10000274 | Ga0207691_1000027453 | 387 |
| 319 | 3300025960 | Ga0207651_10000358 | Ga0207651_1000035819 | 387 |
| 320 | 3300026121 | Ga0207683_10000220 | Ga0207683_100002208 | 387 |
| 321 | 3300027907 | Ga0207428_10010107 | Ga0207428_100101076 | 387 |
| 322 | 3300031548 | Ga0307408_100048714 | Ga0307408_1000487142 | 387 |
| 323 | 3300031911 | Ga0307412_10257282 | Ga0307412_102572821 | 387 |
| 324 | 3300031995 | Ga0307409_100015060 | Ga0307409_1000150603 | 387 |
| 325 | 3300032002 | Ga0307416_100042086 | Ga0307416_1000420865 | 387 |
| 326 | 3300032004 | Ga0307414_10294894 | Ga0307414_102948942 | 387 |
| 327 | 3300032005 | Ga0307411_10040453 | Ga0307411_100404532 | 387 |
| 328 | 3300032126 | Ga0307415_100033261 | Ga0307415_1000332612 | 387 |
| 329 | 3300032126 | Ga0307415_100059500 | Ga0307415_1000595001 | 387 |
| 330 | 3300048907 | Ga0496104_0217815 | Ga0496104_0217815_418_1599 | 387 |
| 331 | 3300048913 | Ga0496110_0277894 | Ga0496110_0277894_61_1242 | 387 |
| 332 | 3300048917 | Ga0496114_0002337 | Ga0496114_0002337_13236_14417 | 387 |
| 333 | 3300049824 | Ga0501045_0193451 | Ga0501045_0193451_163_1386 | 387 |
| 334 | 3300050489 | nmdc:mga03683_600_c2 | nmdc:mga03683_600_c2_2207_3370 | 387 |
| 335 | 3300050491 | nmdc:mga00v17_23721_c1 | nmdc:mga00v17_23721_c1_1730_2893 | 387 |
| 336 | 3300050491 | nmdc:mga00v17_4143_c1 | nmdc:mga00v17_4143_c1_1590_2753 | 387 |
| 337 | 3300050492 | nmdc:mga0yw44_61194_c1 | nmdc:mga0yw44_61194_c1_325_1488 | 387 |
| 338 | 3300050493 | nmdc:mga0k408_4679_c1 | nmdc:mga0k408_4679_c1_1958_3121 | 387 |
| 339 | 3300050510 | nmdc:mga06r32_90676_c1 | nmdc:mga06r32_90676_c1_1309_2511 | 387 |
| 340 | 3300050511 | nmdc:mga08y16_1066_c1 | nmdc:mga08y16_1066_c1_16837_18072 | 387 |
| 341 | 3300059421 | Ga0590071_009311 | Ga0590071_009311_947_2110 | 387 |
| 342 | 3300005339 | Ga0070660_100088263 | Ga0070660_1000882632 | 388 |
| 343 | 3300005340 | Ga0070689_100069246 | Ga0070689_1000692462 | 388 |
| 344 | 3300005435 | Ga0070714_100347481 | Ga0070714_1003474811 | 388 |
| 345 | 3300006237 | Ga0097621_100040296 | Ga0097621_1000402963 | 388 |
| 346 | 3300006844 | Ga0075428_100032730 | Ga0075428_1000327305 | 388 |
| 347 | 3300009093 | Ga0105240_10034088 | Ga0105240_100340886 | 388 |
| 348 | 3300009093 | Ga0105240_10180230 | Ga0105240_101802301 | 388 |
| 349 | 3300009094 | Ga0111539_10164168 | Ga0111539_101641681 | 388 |
| 350 | 3300013297 | Ga0157378_10023338 | Ga0157378_100233383 | 388 |
| 351 | 3300025913 | Ga0207695_10136275 | Ga0207695_101362752 | 388 |
| 352 | 3300025919 | Ga0207657_10114870 | Ga0207657_101148702 | 388 |
| 353 | 3300031548 | Ga0307408_100017734 | Ga0307408_1000177343 | 388 |
| 354 | 3300031903 | Ga0307407_10083699 | Ga0307407_100836992 | 388 |
| 355 | 3300032126 | Ga0307415_100036207 | Ga0307415_1000362072 | 388 |
| 356 | 3300048915 | Ga0496112_0091338 | Ga0496112_0091338_1477_2664 | 388 |
| 357 | 3300049587 | Ga0501071_0022296 | Ga0501071_0022296_1361_2527 | 388 |
| 358 | 3300049588 | Ga0501072_0048095 | Ga0501072_0048095_382_1548 | 388 |
| 359 | 3300049592 | Ga0501076_0164356 | Ga0501076_0164356_198_1364 | 388 |
| 360 | 3300059421 | Ga0590071_006188 | Ga0590071_006188_1593_2759 | 388 |
| 361 | 3300005290 | Ga0065712_10142213 | Ga0065712_101422131 | 389 |
| 362 | 3300005293 | Ga0065715_10118756 | Ga0065715_101187562 | 389 |
| 363 | 3300005295 | Ga0065707_10001449 | Ga0065707_1000144911 | 389 |
| 364 | 3300005329 | Ga0070683_100000702 | Ga0070683_10000070210 | 389 |
| 365 | 3300005331 | Ga0070670_100187951 | Ga0070670_1001879512 | 389 |
| 366 | 3300005535 | Ga0070684_100000068 | Ga0070684_10000006829 | 389 |
| 367 | 3300005547 | Ga0070693_100047782 | Ga0070693_1000477822 | 389 |
| 368 | 3300005549 | Ga0070704_100146319 | Ga0070704_1001463192 | 389 |
| 369 | 3300005564 | Ga0070664_100008127 | Ga0070664_1000081277 | 389 |
| 370 | 3300005842 | Ga0068858_100180904 | Ga0068858_1001809042 | 389 |
| 371 | 3300005844 | Ga0068862_100016452 | Ga0068862_1000164526 | 389 |
| 372 | 3300005937 | Ga0081455_10102180 | Ga0081455_101021802 | 389 |
| 373 | 3300009101 | Ga0105247_10040093 | Ga0105247_100400931 | 389 |
| 374 | 3300009177 | Ga0105248_10014318 | Ga0105248_100143187 | 389 |
| 375 | 3300013296 | Ga0157374_10305188 | Ga0157374_103051881 | 389 |
| 376 | 3300014325 | Ga0163163_10023177 | Ga0163163_100231772 | 389 |
| 377 | 3300014326 | Ga0157380_10065967 | Ga0157380_100659672 | 389 |
| 378 | 3300014968 | Ga0157379_10018346 | Ga0157379_100183465 | 389 |
| 379 | 3300025920 | Ga0207649_10022407 | Ga0207649_100224072 | 389 |
| 380 | 3300025925 | Ga0207650_10008008 | Ga0207650_100080085 | 389 |
| 381 | 3300025940 | Ga0207691_10022903 | Ga0207691_100229036 | 389 |
| 382 | 3300025941 | Ga0207711_10042071 | Ga0207711_100420712 | 389 |
| 383 | 3300025941 | Ga0207711_10073136 | Ga0207711_100731362 | 389 |
| 384 | 3300025944 | Ga0207661_10002311 | Ga0207661_1000231110 | 389 |
| 385 | 3300025945 | Ga0207679_10002489 | Ga0207679_100024893 | 389 |
| 386 | 3300026035 | Ga0207703_10136597 | Ga0207703_101365972 | 389 |
| 387 | 3300028380 | Ga0268265_10048093 | Ga0268265_100480933 | 389 |
| 388 | 3300031548 | Ga0307408_100028574 | Ga0307408_1000285743 | 389 |
| 389 | 3300031548 | Ga0307408_100174714 | Ga0307408_1001747142 | 389 |
| 390 | 3300032002 | Ga0307416_100051044 | Ga0307416_1000510441 | 389 |
| 391 | 3300032002 | Ga0307416_100248288 | Ga0307416_1002482882 | 389 |
| 392 | 3300039093 | Ga0400489_79885 | Ga0400489_79885_377_1582 | 389 |
| 393 | 3300042156 | Ga0439446_0005503 | Ga0439446_0005503_375_1568 | 389 |
| 394 | 3300045051 | Ga0451576_0295006 | Ga0451576_0295006_51_1241 | 389 |
| 395 | 3300048907 | Ga0496104_0005196 | Ga0496104_0005196_2348_3520 | 389 |
| 396 | 3300048911 | Ga0496108_0021614 | Ga0496108_0021614_3755_4927 | 389 |
| 397 | 3300048912 | Ga0496109_0001290 | Ga0496109_0001290_8670_9842 | 389 |
| 398 | 3300048913 | Ga0496110_0008036 | Ga0496110_0008036_5063_6235 | 389 |
| 399 | 3300048915 | Ga0496112_0027070 | Ga0496112_0027070_617_1786 | 389 |
| 400 | 3300049576 | Ga0501040_0201607 | Ga0501040_0201607_226_1395 | 389 |
| 401 | 3300049587 | Ga0501071_0016739 | Ga0501071_0016739_2645_3814 | 389 |
| 402 | 3300049590 | Ga0501074_0111236 | Ga0501074_0111236_486_1655 | 389 |
| 403 | 3300049741 | Ga0501079_0007892 | Ga0501079_0007892_4294_5463 | 389 |
| 404 | 3300049742 | Ga0501080_0055210 | Ga0501080_0055210_1711_2880 | 389 |
| 405 | 3300049743 | Ga0501081_0160036 | Ga0501081_0160036_143_1312 | 389 |
| 406 | 3300049824 | Ga0501045_0007195 | Ga0501045_0007195_5181_6350 | 389 |
| 407 | 3300050515 | nmdc:mga0a205_249232_c1 | nmdc:mga0a205_249232_c1_108_1277 | 389 |
| 408 | 3300053085 | Ga0495619_0081819 | Ga0495619_0081819_191_1360 | 389 |
| 409 | 3300054114 | Ga0501084_0004142 | Ga0501084_0004142_1081_2250 | 389 |
| 410 | 3300059421 | Ga0590071_000772 | Ga0590071_000772_4904_6073 | 389 |
| 411 | 3300059424 | Ga0590075_001822 | Ga0590075_001822_543_1712 | 389 |
| 412 | 3300059426 | Ga0590077_002482 | Ga0590077_002482_1551_2720 | 389 |
| 413 | 3300060353 | Ga0501082_0040443 | Ga0501082_0040443_92_1261 | 389 |
| 414 | 3300061734 | Ga0530510_0001387 | Ga0530510_0001387_7405_8574 | 389 |
| 415 | 3300005290 | Ga0065712_10020821 | Ga0065712_100208212 | 390 |
| 416 | 3300005331 | Ga0070670_100003306 | Ga0070670_1000033063 | 390 |
| 417 | 3300005365 | Ga0070688_100029128 | Ga0070688_1000291283 | 390 |
| 418 | 3300006844 | Ga0075428_100414895 | Ga0075428_1004148951 | 390 |
| 419 | 3300006871 | Ga0075434_100010893 | Ga0075434_10001089311 | 390 |
| 420 | 3300006880 | Ga0075429_100093444 | Ga0075429_1000934442 | 390 |
| 421 | 3300009094 | Ga0111539_10047449 | Ga0111539_100474491 | 390 |
| 422 | 3300009094 | Ga0111539_10137313 | Ga0111539_101373132 | 390 |
| 423 | 3300009553 | Ga0105249_10232698 | Ga0105249_102326982 | 390 |
| 424 | 3300013104 | Ga0157370_10278479 | Ga0157370_102784791 | 390 |
| 425 | 3300025912 | Ga0207707_10230432 | Ga0207707_102304321 | 390 |
| 426 | 3300025922 | Ga0207646_10036794 | Ga0207646_100367944 | 390 |
| 427 | 3300025937 | Ga0207669_10015080 | Ga0207669_100150803 | 390 |
| 428 | 3300026067 | Ga0207678_10030823 | Ga0207678_100308234 | 390 |
| 429 | 3300027876 | Ga0209974_10014515 | Ga0209974_100145154 | 390 |
| 430 | 3300031995 | Ga0307409_100146814 | Ga0307409_1001468142 | 390 |
| 431 | 3300032005 | Ga0307411_10013487 | Ga0307411_100134873 | 390 |
| 432 | 3300042008 | Ga0439450_011231 | Ga0439450_011231_314_1504 | 390 |
| 433 | 3300048904 | Ga0496101_0064748 | Ga0496101_0064748_158_1342 | 390 |
| 434 | 3300048917 | Ga0496114_0211738 | Ga0496114_0211738_228_1412 | 390 |
| 435 | 3300050507 | nmdc:mga05p37_580882_c1 | nmdc:mga05p37_580882_c1_37_1218 | 390 |
| 436 | 3300050511 | nmdc:mga08y16_282095_c1 | nmdc:mga08y16_282095_c1_234_1451 | 390 |
| 437 | 3300050512 | nmdc:mga0n895_2150_c1 | nmdc:mga0n895_2150_c1_133_1305 | 390 |
| 438 | 3300050515 | nmdc:mga0a205_138041_c1 | nmdc:mga0a205_138041_c1_599_1771 | 390 |
| 439 | 3300005295 | Ga0065707_10009013 | Ga0065707_100090133 | 391 |
| 440 | 3300005577 | Ga0068857_100050996 | Ga0068857_1000509963 | 391 |
| 441 | 3300005617 | Ga0068859_100227254 | Ga0068859_1002272542 | 391 |
| 442 | 3300005842 | Ga0068858_100005453 | Ga0068858_1000054534 | 391 |
| 443 | 3300005937 | Ga0081455_10013648 | Ga0081455_100136484 | 391 |
| 444 | 3300005981 | Ga0081538_10001528 | Ga0081538_1000152814 | 391 |
| 445 | 3300005981 | Ga0081538_10058983 | Ga0081538_100589832 | 391 |
| 446 | 3300006844 | Ga0075428_100000080 | Ga0075428_10000008010 | 391 |
| 447 | 3300006846 | Ga0075430_100002473 | Ga0075430_10000247310 | 391 |
| 448 | 3300006846 | Ga0075430_100078679 | Ga0075430_1000786792 | 391 |
| 449 | 3300006847 | Ga0075431_100002515 | Ga0075431_10000251515 | 391 |
| 450 | 3300006847 | Ga0075431_100133808 | Ga0075431_1001338081 | 391 |
| 451 | 3300006871 | Ga0075434_100162802 | Ga0075434_1001628022 | 391 |
| 452 | 3300006880 | Ga0075429_100000156 | Ga0075429_10000015617 | 391 |
| 453 | 3300006880 | Ga0075429_100001098 | Ga0075429_10000109819 | 391 |
| 454 | 3300006931 | Ga0097620_100227264 | Ga0097620_1002272642 | 391 |
| 455 | 3300007076 | Ga0075435_100030102 | Ga0075435_1000301023 | 391 |
| 456 | 3300009094 | Ga0111539_10000181 | Ga0111539_100001814 | 391 |
| 457 | 3300009094 | Ga0111539_10009783 | Ga0111539_100097836 | 391 |
| 458 | 3300009101 | Ga0105247_10031210 | Ga0105247_100312104 | 391 |
| 459 | 3300009147 | Ga0114129_10000077 | Ga0114129_1000007763 | 391 |
| 460 | 3300014968 | Ga0157379_10017975 | Ga0157379_100179754 | 391 |
| 461 | 3300025926 | Ga0207659_10096939 | Ga0207659_100969392 | 391 |
| 462 | 3300026035 | Ga0207703_10021562 | Ga0207703_100215624 | 391 |
| 463 | 3300027907 | Ga0207428_10000558 | Ga0207428_1000055810 | 391 |
| 464 | 3300028381 | Ga0268264_10222629 | Ga0268264_102226292 | 391 |
| 465 | 3300031727 | Ga0316576_10001732 | Ga0316576_100017323 | 391 |
| 466 | 3300031727 | Ga0316576_10012676 | Ga0316576_100126763 | 391 |
| 467 | 3300031727 | Ga0316576_10079178 | Ga0316576_100791783 | 391 |
| 468 | 3300031727 | Ga0316576_10097215 | Ga0316576_100972151 | 391 |
| 469 | 3300031728 | Ga0316578_10039372 | Ga0316578_100393722 | 391 |
| 470 | 3300031728 | Ga0316578_10045731 | Ga0316578_100457312 | 391 |
| 471 | 3300031901 | Ga0307406_10060683 | Ga0307406_100606832 | 391 |
| 472 | 3300032002 | Ga0307416_100164779 | Ga0307416_1001647791 | 391 |
| 473 | 3300032137 | Ga0316585_10003409 | Ga0316585_100034091 | 391 |
| 474 | 3300035398 | Ga0316574_0005798 | Ga0316574_0005798_235_1446 | 391 |
| 475 | 3300036712 | Ga0316584_0147689 | Ga0316584_0147689_229_1440 | 391 |
| 476 | 3300049572 | Ga0501036_0156172 | Ga0501036_0156172_505_1680 | 391 |
| 477 | 3300049661 | Ga0501217_028030 | Ga0501217_028030_172_1347 | 391 |
| 478 | 3300050507 | nmdc:mga05p37_1796_c1 | nmdc:mga05p37_1796_c1_18195_19442 | 391 |
| 479 | 3300050508 | nmdc:mga09592_3401_c1 | nmdc:mga09592_3401_c1_6451_7698 | 391 |
| 480 | 3300050508 | nmdc:mga09592_4431_c1 | nmdc:mga09592_4431_c1_2706_3881 | 391 |
| 481 | 3300050509 | nmdc:mga0qj67_4824_c1 | nmdc:mga0qj67_4824_c1_5072_6319 | 391 |
| 482 | 3300050510 | nmdc:mga06r32_6534_c1 | nmdc:mga06r32_6534_c1_2492_3739 | 391 |
| 483 | 3300050510 | nmdc:mga06r32_77179_c1 | nmdc:mga06r32_77179_c1_322_1497 | 391 |
| 484 | 3300005329 | Ga0070683_100119518 | Ga0070683_1001195182 | 392 |
| 485 | 3300005354 | Ga0070675_100000202 | Ga0070675_10000020232 | 392 |
| 486 | 3300005530 | Ga0070679_100174362 | Ga0070679_1001743622 | 392 |
| 487 | 3300005535 | Ga0070684_100009549 | Ga0070684_1000095498 | 392 |
| 488 | 3300005617 | Ga0068859_100328683 | Ga0068859_1003286832 | 392 |
| 489 | 3300006038 | Ga0075365_10007190 | Ga0075365_100071905 | 392 |
| 490 | 3300006237 | Ga0097621_100000477 | Ga0097621_1000004779 | 392 |
| 491 | 3300006358 | Ga0068871_100012430 | Ga0068871_1000124305 | 392 |
| 492 | 3300006931 | Ga0097620_100328726 | Ga0097620_1003287262 | 392 |
| 493 | 3300009094 | Ga0111539_10145053 | Ga0111539_101450532 | 392 |
| 494 | 3300009147 | Ga0114129_10009067 | Ga0114129_1000906712 | 392 |
| 495 | 3300025921 | Ga0207652_10210762 | Ga0207652_102107622 | 392 |
| 496 | 3300025926 | Ga0207659_10000076 | Ga0207659_1000007615 | 392 |
| 497 | 3300025944 | Ga0207661_10031293 | Ga0207661_100312935 | 392 |
| 498 | 3300027907 | Ga0207428_10113132 | Ga0207428_101131321 | 392 |
| 499 | 3300027907 | Ga0207428_10130250 | Ga0207428_101302502 | 392 |
| 500 | 3300028379 | Ga0268266_10189584 | Ga0268266_101895841 | 392 |
| 501 | 3300046472 | Ga0495580_0168405 | Ga0495580_0168405_309_1493 | 392 |
| 502 | 3300050492 | nmdc:mga0yw44_4147_c1 | nmdc:mga0yw44_4147_c1_522_1700 | 392 |
| 503 | 3300050507 | nmdc:mga05p37_4142_c1 | nmdc:mga05p37_4142_c1_14597_15835 | 392 |
| 504 | 3300050510 | nmdc:mga06r32_23254_c1 | nmdc:mga06r32_23254_c1_2227_3465 | 392 |
| 505 | 3300050511 | nmdc:mga08y16_108938_c1 | nmdc:mga08y16_108938_c1_956_2200 | 392 |
| 506 | 3300002459 | JGI24751J29686_10002791 | JGI24751J29686_100027913 | 393 |
| 507 | 3300005293 | Ga0065715_10094271 | Ga0065715_100942712 | 393 |
| 508 | 3300005295 | Ga0065707_10006518 | Ga0065707_100065182 | 393 |
| 509 | 3300005331 | Ga0070670_100078964 | Ga0070670_1000789643 | 393 |
| 510 | 3300005335 | Ga0070666_10126739 | Ga0070666_101267392 | 393 |
| 511 | 3300005338 | Ga0068868_100095107 | Ga0068868_1000951072 | 393 |
| 512 | 3300005340 | Ga0070689_100132421 | Ga0070689_1001324212 | 393 |
| 513 | 3300005364 | Ga0070673_100002528 | Ga0070673_1000025283 | 393 |
| 514 | 3300005365 | Ga0070688_100115143 | Ga0070688_1001151432 | 393 |
| 515 | 3300005441 | Ga0070700_100095906 | Ga0070700_1000959062 | 393 |
| 516 | 3300005441 | Ga0070700_100125087 | Ga0070700_1001250872 | 393 |
| 517 | 3300005444 | Ga0070694_100010880 | Ga0070694_1000108803 | 393 |
| 518 | 3300005444 | Ga0070694_100079292 | Ga0070694_1000792922 | 393 |
| 519 | 3300005445 | Ga0070708_100075792 | Ga0070708_1000757923 | 393 |
| 520 | 3300005457 | Ga0070662_100223431 | Ga0070662_1002234311 | 393 |
| 521 | 3300005468 | Ga0070707_100058637 | Ga0070707_1000586375 | 393 |
| 522 | 3300005471 | Ga0070698_100029348 | Ga0070698_1000293482 | 393 |
| 523 | 3300005518 | Ga0070699_100003668 | Ga0070699_10000366811 | 393 |
| 524 | 3300005518 | Ga0070699_100030443 | Ga0070699_1000304434 | 393 |
| 525 | 3300005518 | Ga0070699_100172458 | Ga0070699_1001724582 | 393 |
| 526 | 3300005536 | Ga0070697_100189167 | Ga0070697_1001891672 | 393 |
| 527 | 3300005545 | Ga0070695_100000785 | Ga0070695_10000078514 | 393 |
| 528 | 3300005545 | Ga0070695_100014083 | Ga0070695_1000140832 | 393 |
| 529 | 3300005546 | Ga0070696_100078877 | Ga0070696_1000788772 | 393 |
| 530 | 3300005546 | Ga0070696_100125583 | Ga0070696_1001255832 | 393 |
| 531 | 3300005548 | Ga0070665_100006386 | Ga0070665_1000063869 | 393 |
| 532 | 3300005548 | Ga0070665_100008967 | Ga0070665_1000089673 | 393 |
| 533 | 3300005549 | Ga0070704_100001151 | Ga0070704_10000115112 | 393 |
| 534 | 3300005617 | Ga0068859_100005666 | Ga0068859_10000566614 | 393 |
| 535 | 3300005617 | Ga0068859_100266819 | Ga0068859_1002668192 | 393 |
| 536 | 3300005618 | Ga0068864_100006553 | Ga0068864_1000065535 | 393 |
| 537 | 3300005841 | Ga0068863_100140256 | Ga0068863_1001402562 | 393 |
| 538 | 3300005842 | Ga0068858_100013146 | Ga0068858_1000131467 | 393 |
| 539 | 3300005844 | Ga0068862_100323912 | Ga0068862_1003239122 | 393 |
| 540 | 3300005937 | Ga0081455_10116831 | Ga0081455_101168312 | 393 |
| 541 | 3300006237 | Ga0097621_100002349 | Ga0097621_1000023495 | 393 |
| 542 | 3300006237 | Ga0097621_100192429 | Ga0097621_1001924292 | 393 |
| 543 | 3300006844 | Ga0075428_100131866 | Ga0075428_1001318662 | 393 |
| 544 | 3300006852 | Ga0075433_10129598 | Ga0075433_101295982 | 393 |
| 545 | 3300006880 | Ga0075429_100050306 | Ga0075429_1000503064 | 393 |
| 546 | 3300006881 | Ga0068865_100008148 | Ga0068865_1000081487 | 393 |
| 547 | 3300006914 | Ga0075436_100007582 | Ga0075436_1000075822 | 393 |
| 548 | 3300006931 | Ga0097620_100005666 | Ga0097620_1000056662 | 393 |
| 549 | 3300006931 | Ga0097620_100266820 | Ga0097620_1002668202 | 393 |
| 550 | 3300007076 | Ga0075435_100036648 | Ga0075435_1000366484 | 393 |
| 551 | 3300009094 | Ga0111539_10000209 | Ga0111539_1000020930 | 393 |
| 552 | 3300009094 | Ga0111539_10002429 | Ga0111539_1000242917 | 393 |
| 553 | 3300009101 | Ga0105247_10019812 | Ga0105247_100198122 | 393 |
| 554 | 3300009147 | Ga0114129_10043732 | Ga0114129_100437322 | 393 |
| 555 | 3300009147 | Ga0114129_10106350 | Ga0114129_101063502 | 393 |
| 556 | 3300009176 | Ga0105242_10003632 | Ga0105242_100036329 | 393 |
| 557 | 3300009177 | Ga0105248_10004014 | Ga0105248_1000401415 | 393 |
| 558 | 3300009177 | Ga0105248_10023744 | Ga0105248_100237442 | 393 |
| 559 | 3300009177 | Ga0105248_10043896 | Ga0105248_100438963 | 393 |
| 560 | 3300009177 | Ga0105248_10317020 | Ga0105248_103170202 | 393 |
| 561 | 3300013296 | Ga0157374_10128612 | Ga0157374_101286122 | 393 |
| 562 | 3300013308 | Ga0157375_10132350 | Ga0157375_101323502 | 393 |
| 563 | 3300013308 | Ga0157375_10218723 | Ga0157375_102187232 | 393 |
| 564 | 3300014325 | Ga0163163_10010892 | Ga0163163_100108925 | 393 |
| 565 | 3300014325 | Ga0163163_10013097 | Ga0163163_100130975 | 393 |
| 566 | 3300014326 | Ga0157380_10114672 | Ga0157380_101146722 | 393 |
| 567 | 3300014968 | Ga0157379_10021777 | Ga0157379_100217776 | 393 |
| 568 | 3300014968 | Ga0157379_10171473 | Ga0157379_101714732 | 393 |
| 569 | 3300014969 | Ga0157376_10019378 | Ga0157376_100193782 | 393 |
| 570 | 3300014969 | Ga0157376_10034338 | Ga0157376_100343383 | 393 |
| 571 | 3300025903 | Ga0207680_10041021 | Ga0207680_100410212 | 393 |
| 572 | 3300025906 | Ga0207699_10077698 | Ga0207699_100776982 | 393 |
| 573 | 3300025910 | Ga0207684_10214483 | Ga0207684_102144832 | 393 |
| 574 | 3300025918 | Ga0207662_10064804 | Ga0207662_100648042 | 393 |
| 575 | 3300025923 | Ga0207681_10019225 | Ga0207681_100192252 | 393 |
| 576 | 3300025925 | Ga0207650_10188207 | Ga0207650_101882071 | 393 |
| 577 | 3300025933 | Ga0207706_10084052 | Ga0207706_100840522 | 393 |
| 578 | 3300025933 | Ga0207706_10099614 | Ga0207706_100996144 | 393 |
| 579 | 3300025936 | Ga0207670_10131699 | Ga0207670_101316992 | 393 |
| 580 | 3300025941 | Ga0207711_10016158 | Ga0207711_100161582 | 393 |
| 581 | 3300025941 | Ga0207711_10091941 | Ga0207711_100919412 | 393 |
| 582 | 3300025941 | Ga0207711_10114557 | Ga0207711_101145572 | 393 |
| 583 | 3300025945 | Ga0207679_10193752 | Ga0207679_101937522 | 393 |
| 584 | 3300025981 | Ga0207640_10040545 | Ga0207640_100405452 | 393 |
| 585 | 3300026023 | Ga0207677_10038536 | Ga0207677_100385362 | 393 |
| 586 | 3300026023 | Ga0207677_10098597 | Ga0207677_100985971 | 393 |
| 587 | 3300026088 | Ga0207641_10099587 | Ga0207641_100995872 | 393 |
| 588 | 3300026088 | Ga0207641_10188514 | Ga0207641_101885142 | 393 |
| 589 | 3300026095 | Ga0207676_10090218 | Ga0207676_100902182 | 393 |
| 590 | 3300026095 | Ga0207676_10139761 | Ga0207676_101397612 | 393 |
| 591 | 3300026118 | Ga0207675_100015621 | Ga0207675_1000156212 | 393 |
| 592 | 3300026118 | Ga0207675_100044375 | Ga0207675_1000443754 | 393 |
| 593 | 3300027907 | Ga0207428_10000022 | Ga0207428_1000002230 | 393 |
| 594 | 3300027907 | Ga0207428_10215065 | Ga0207428_102150652 | 393 |
| 595 | 3300028379 | Ga0268266_10003789 | Ga0268266_100037894 | 393 |
| 596 | 3300028380 | Ga0268265_10015893 | Ga0268265_100158932 | 393 |
| 597 | 3300028381 | Ga0268264_10183526 | Ga0268264_101835262 | 393 |
| 598 | 3300031824 | Ga0307413_10011324 | Ga0307413_100113242 | 393 |
| 599 | 3300031852 | Ga0307410_10015511 | Ga0307410_100155113 | 393 |
| 600 | 3300031901 | Ga0307406_10006061 | Ga0307406_100060615 | 393 |
| 601 | 3300031911 | Ga0307412_10056975 | Ga0307412_100569752 | 393 |
| 602 | 3300031995 | Ga0307409_100001383 | Ga0307409_1000013839 | 393 |
| 603 | 3300032002 | Ga0307416_100225817 | Ga0307416_1002258171 | 393 |
| 604 | 3300032004 | Ga0307414_10003946 | Ga0307414_100039466 | 393 |
| 605 | 3300032126 | Ga0307415_100152678 | Ga0307415_1001526782 | 393 |
| 606 | 3300035695 | Ga0373927_0195421 | Ga0373927_0195421_94_1284 | 393 |
| 607 | 3300035725 | Ga0373947_0019793 | Ga0373947_0019793_1614_2804 | 393 |
| 608 | 3300036401 | Ga0373937_0113098 | Ga0373937_0113098_978_2168 | 393 |
| 609 | 3300036401 | Ga0373937_0130401 | Ga0373937_0130401_408_1604 | 393 |
| 610 | 3300036401 | Ga0373937_0324798 | Ga0373937_0324798_50_1261 | 393 |
| 611 | 3300038443 | Ga0395901_0138426 | Ga0395901_0138426_1082_2266 | 393 |
| 612 | 3300046454 | Ga0495592_0047193 | Ga0495592_0047193_167_1363 | 393 |
| 613 | 3300046455 | Ga0495603_0077086 | Ga0495603_0077086_381_1592 | 393 |
| 614 | 3300046459 | Ga0495629_0138722 | Ga0495629_0138722_206_1417 | 393 |
| 615 | 3300046473 | Ga0495582_0142071 | Ga0495582_0142071_56_1267 | 393 |
| 616 | 3300046477 | Ga0495664_0046084 | Ga0495664_0046084_841_2037 | 393 |
| 617 | 3300046477 | Ga0495664_0059719 | Ga0495664_0059719_359_1570 | 393 |
| 618 | 3300046511 | Ga0495608_0011561 | Ga0495608_0011561_2741_3937 | 393 |
| 619 | 3300046516 | Ga0495628_0172061 | Ga0495628_0172061_406_1617 | 393 |
| 620 | 3300046529 | Ga0495652_0118392 | Ga0495652_0118392_230_1426 | 393 |
| 621 | 3300046543 | Ga0495645_0007653 | Ga0495645_0007653_1413_2624 | 393 |
| 622 | 3300046543 | Ga0495645_0076832 | Ga0495645_0076832_637_1833 | 393 |
| 623 | 3300046681 | Ga0495647_0042692 | Ga0495647_0042692_11_1222 | 393 |
| 624 | 3300046683 | Ga0495658_0022670 | Ga0495658_0022670_351_1562 | 393 |
| 625 | 3300046683 | Ga0495658_0085015 | Ga0495658_0085015_609_1829 | 393 |
| 626 | 3300046684 | Ga0495669_0000990 | Ga0495669_0000990_6259_7455 | 393 |
| 627 | 3300046689 | Ga0495613_0004695 | Ga0495613_0004695_6801_7997 | 393 |
| 628 | 3300047317 | Ga0495604_0017283 | Ga0495604_0017283_4113_5309 | 393 |
| 629 | 3300047319 | Ga0495674_0029729 | Ga0495674_0029729_1670_2866 | 393 |
| 630 | 3300047319 | Ga0495674_0172636 | Ga0495674_0172636_32_1243 | 393 |
| 631 | 3300047471 | Ga0495684_0000228 | Ga0495684_0000228_1866_3062 | 393 |
| 632 | 3300048907 | Ga0496104_0069587 | Ga0496104_0069587_986_2197 | 393 |
| 633 | 3300048907 | Ga0496104_0084489 | Ga0496104_0084489_1646_2857 | 393 |
| 634 | 3300048907 | Ga0496104_0109714 | Ga0496104_0109714_22_1233 | 393 |
| 635 | 3300048917 | Ga0496114_0109399 | Ga0496114_0109399_1010_2221 | 393 |
| 636 | 3300048918 | Ga0496115_0012077 | Ga0496115_0012077_2462_3673 | 393 |
| 637 | 3300049568 | Ga0501031_0040726 | Ga0501031_0040726_428_1615 | 393 |
| 638 | 3300049572 | Ga0501036_0030546 | Ga0501036_0030546_1703_2899 | 393 |
| 639 | 3300049572 | Ga0501036_0279895 | Ga0501036_0279895_120_1307 | 393 |
| 640 | 3300049573 | Ga0501037_0119167 | Ga0501037_0119167_158_1345 | 393 |
| 641 | 3300049576 | Ga0501040_0004841 | Ga0501040_0004841_5381_6577 | 393 |
| 642 | 3300049577 | Ga0501041_0002942 | Ga0501041_0002942_1809_3005 | 393 |
| 643 | 3300049582 | Ga0501048_0013517 | Ga0501048_0013517_3907_5103 | 393 |
| 644 | 3300049582 | Ga0501048_0042667 | Ga0501048_0042667_546_1733 | 393 |
| 645 | 3300049587 | Ga0501071_0019329 | Ga0501071_0019329_2396_3592 | 393 |
| 646 | 3300049588 | Ga0501072_0017543 | Ga0501072_0017543_3393_4589 | 393 |
| 647 | 3300049588 | Ga0501072_0030128 | Ga0501072_0030128_990_2177 | 393 |
| 648 | 3300049590 | Ga0501074_0087231 | Ga0501074_0087231_638_1825 | 393 |
| 649 | 3300049591 | Ga0501075_0079644 | Ga0501075_0079644_16_1203 | 393 |
| 650 | 3300049592 | Ga0501076_0026029 | Ga0501076_0026029_1932_3128 | 393 |
| 651 | 3300049741 | Ga0501079_0029175 | Ga0501079_0029175_2150_3346 | 393 |
| 652 | 3300049743 | Ga0501081_0000406 | Ga0501081_0000406_20494_21690 | 393 |
| 653 | 3300049822 | Ga0501035_0076370 | Ga0501035_0076370_208_1404 | 393 |
| 654 | 3300049824 | Ga0501045_0011015 | Ga0501045_0011015_298_1485 | 393 |
| 655 | 3300050507 | nmdc:mga05p37_121506_c1 | nmdc:mga05p37_121506_c1_1242_2453 | 393 |
| 656 | 3300050507 | nmdc:mga05p37_235500_c1 | nmdc:mga05p37_235500_c1_275_1510 | 393 |
| 657 | 3300050507 | nmdc:mga05p37_2819_c1 | nmdc:mga05p37_2819_c1_6901_8091 | 393 |
| 658 | 3300050511 | nmdc:mga08y16_21_c1 | nmdc:mga08y16_21_c1_222907_224097 | 393 |
| 659 | 3300050513 | nmdc:mga0rr50_41109_c1 | nmdc:mga0rr50_41109_c1_2050_3252 | 393 |
| 660 | 3300050513 | nmdc:mga0rr50_62346_c1 | nmdc:mga0rr50_62346_c1_1573_2769 | 393 |
| 661 | 3300050515 | nmdc:mga0a205_41616_c1 | nmdc:mga0a205_41616_c1_2174_3364 | 393 |
| 662 | 3300053085 | Ga0495619_0000422 | Ga0495619_0000422_8008_9204 | 393 |
| 663 | 3300053085 | Ga0495619_0038606 | Ga0495619_0038606_303_1514 | 393 |
| 664 | 3300054114 | Ga0501084_0004916 | Ga0501084_0004916_632_1828 | 393 |
| 665 | 3300059423 | Ga0590074_000326 | Ga0590074_000326_2489_3700 | 393 |
| 666 | 3300059424 | Ga0590075_000576 | Ga0590075_000576_6542_7753 | 393 |
| 667 | 3300059426 | Ga0590077_000087 | Ga0590077_000087_1764_2975 | 393 |
| 668 | 3300060353 | Ga0501082_0001528 | Ga0501082_0001528_1844_3040 | 393 |
| 669 | 3300060353 | Ga0501082_0013241 | Ga0501082_0013241_34_1221 | 393 |
| 670 | 3300061734 | Ga0530510_0036178 | Ga0530510_0036178_1731_2927 | 393 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kr7-assembly1.cif.gz_A | crystal structure of a 4-thiouridine synthetase - rna complex with bound atp | 0.9154 | 1 | 384 |
| 2c5s-assembly1.cif.gz_A-2 | crystal structure of bacillus anthracis thii, a trna-modifying enzyme containing the predicted rna-binding thump domain | 0.9103 | 1 | 385 |
| 4kr7-assembly1.cif.gz_A | crystal structure of a 4-thiouridine synthetase - rna complex with bound atp | 0.9086 | 1 | 384 |
| 2c5s-assembly1.cif.gz_A-2 | crystal structure of bacillus anthracis thii, a trna-modifying enzyme containing the predicted rna-binding thump domain | 0.9033 | 1 | 385 |
| 1vbk-assembly1.cif.gz_B | crystal structure of ph1313 from pyrococcus horikoshii ot3 | 0.8362 | 1 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXL1_175_403_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9641 | 171 | 390 | 3.40.50.620 |
| 4kr9B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9626 | 171 | 384 | 3.40.50.620 |
| af_Q58341_186_381_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9508 | 171 | 364 | 3.40.50.620 |
| 2c5sA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9475 | 171 | 385 | 3.40.50.620 |
| af_P77718_175_396_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9458 | 171 | 382 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382X7T7-F1-model_v4 | Thil AANH domain-containing protein | 0.9942 | 192 | 387 |
GO:0002937
GO:0004810 GO:0005524 GO:0005829 GO:0052837 |
| AF-A0A2V6WSR5-F1-model_v4 | tRNA 4-thiouridine(8) synthase ThiI | 0.9939 | 162 | 277 |
GO:0002937
GO:0004810 GO:0005524 GO:0005829 GO:0052837 |
| AF-A0A1J1EQ10-F1-model_v4 | deleted | 0.9908 | 189 | 387 |
|
| AF-A0A662PQ11-F1-model_v4 | Probable tRNA sulfurtransferase (EC 2.8.1.4) (Sulfur carrier protein ThiS sulfurtransferase) (Thiamine biosynthesis protein ThiI) (tRNA 4-thiouridine synthase) | 0.99 | 175 | 384 |
GO:0002937
GO:0004810 GO:0005524 GO:0005829 GO:0009228 GO:0009229 GO:0052837 GO:0140741 |
| AF-A0A6B3H0H0-F1-model_v4 | tRNA 4-thiouridine(8) synthase ThiI | 0.9877 | 174 | 382 |
GO:0002937
GO:0004810 GO:0005524 GO:0005829 GO:0052837 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar