F474095

General Info

Members Datasets Scaffolds Average Seq Length
670 273 670 388

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10189584|Ga0268266_101895841
Length 434
Sequence MNAIVIHYKELALKGRNRSWFVQQLVRNLRTAVAGLGVVAVRAVMGRIEIELQAPAVSPAAATGRSPAETSALGEIGAPGQVRLGSPSRGHSPASPPPGWAELRDRIGHVFGIANFSHAGRAPHEFAALASTILSDLGDTEASSFRVSARRADKQLPFTSPQIEREVGGLIKEARGWQVRLDDPELTIHVEMMPDHAFYYFGKEPGAGGLPTGTSGRVACLLSGGIDSPVAAYRMMRRGCPVLFIHFHSYPLLSRASQEKVREIATLLTRYQLRSRLHLVPFGELQQQVLLAVQPELRVVIYRRLMLRIAERLARRWKAGALVTGEVVGQVASQTLENMTTIAGATNLEILRPLVGMDKDEIIEQAQRLGTFPISIIPDQDCCQLFTPRHPATRARPEQIEAAERALPIAEMVDAAIAASVVEEFRFPMPSSPD

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
169 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
170 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
171 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
172 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
175 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
176 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
192 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
193 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
194 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 3.88
Rhizosphere 94.18
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10002791 3300002459 Bacteria 3514
2 JGI25406J46586_10000491 3300003203 Bacteria 18498
3 Ga0065712_10020821 3300005290 Unclassified 1713
4 Ga0065712_10026676 3300005290 Bacteria 1546
5 Ga0065712_10142213 3300005290 Unclassified 1440
6 Ga0065715_10094271 3300005293 Bacteria 4389
7 Ga0065715_10118756 3300005293 Unclassified 2296
8 Ga0065707_10001449 3300005295 Bacteria 11740
9 Ga0065707_10006518 3300005295 Bacteria 3337
10 Ga0065707_10009013 3300005295 Unclassified 3939
11 Ga0070676_10004192 3300005328 Bacteria 7571
12 Ga0070676_10021642 3300005328 Bacteria 3601
13 Ga0070676_10038590 3300005328 Bacteria 2759
14 Ga0070676_10038917 3300005328 Bacteria 2748
15 Ga0070683_100000702 3300005329 Bacteria 24327
16 Ga0070683_100119518 3300005329 Bacteria 2489
17 Ga0070683_100136965 3300005329 Bacteria 2319
18 Ga0070690_100131778 3300005330 Unclassified 1689
19 Ga0070670_100003306 3300005331 Bacteria 13341
20 Ga0070670_100014348 3300005331 Bacteria 6798
21 Ga0070670_100078964 3300005331 Bacteria 2828
22 Ga0070670_100098815 3300005331 Bacteria 2512
23 Ga0070670_100187951 3300005331 Unclassified 1794
24 Ga0070677_10005129 3300005333 Bacteria 4304
25 Ga0068869_100222030 3300005334 Bacteria 1498
26 Ga0070666_10004947 3300005335 Bacteria 8153
27 Ga0070666_10126739 3300005335 Bacteria 1772
28 Ga0070680_100041031 3300005336 Unclassified 3752
29 Ga0068868_100011616 3300005338 Bacteria 6414
30 Ga0068868_100095107 3300005338 Bacteria 2404
31 Ga0070660_100088263 3300005339 Bacteria 2442
32 Ga0070689_100069246 3300005340 Bacteria 2753
33 Ga0070689_100132421 3300005340 Bacteria 2000
34 Ga0070689_100199512 3300005340 Bacteria 1633
35 Ga0070691_10000473 3300005341 Bacteria 15007
36 Ga0070692_10094327 3300005345 Bacteria 1631
37 Ga0070668_100091583 3300005347 Bacteria 2397
38 Ga0070669_100060746 3300005353 Bacteria 2777
39 Ga0070669_100088294 3300005353 Bacteria 2320
40 Ga0070669_100168146 3300005353 Bacteria 1708
41 Ga0070675_100000202 3300005354 Bacteria 37748
42 Ga0070675_100038954 3300005354 Bacteria 3876
43 Ga0070675_100223235 3300005354 Bacteria 1641
44 Ga0070671_100061790 3300005355 Bacteria 3120
45 Ga0070671_100064146 3300005355 Bacteria 3060
46 Ga0070674_100024262 3300005356 Bacteria 3934
47 Ga0070674_100045893 3300005356 Bacteria 2987
48 Ga0070674_100133085 3300005356 Bacteria 1857
49 Ga0070674_100153363 3300005356 Bacteria 1740
50 Ga0070673_100000282 3300005364 Bacteria 26333
51 Ga0070673_100002528 3300005364 Bacteria 11171
52 Ga0070673_100071179 3300005364 Bacteria 2793
53 Ga0070688_100029128 3300005365 Bacteria 3303
54 Ga0070688_100115143 3300005365 Bacteria 1794
55 Ga0070659_100233553 3300005366 Bacteria 1520
56 Ga0070667_100013136 3300005367 Bacteria 6846
57 Ga0070667_100072801 3300005367 Bacteria 2929
58 Ga0070714_100020682 3300005435 Bacteria 5379
59 Ga0070714_100347481 3300005435 Unclassified 1392
60 Ga0070701_10014384 3300005438 Bacteria 3627
61 Ga0070705_100006359 3300005440 Bacteria 5787
62 Ga0070700_100006004 3300005441 Bacteria 6461
63 Ga0070700_100070143 3300005441 Bacteria 2234
64 Ga0070700_100079587 3300005441 Bacteria 2113
65 Ga0070700_100095906 3300005441 Bacteria 1945
66 Ga0070700_100125087 3300005441 Bacteria 1728
67 Ga0070694_100010880 3300005444 Bacteria 5629
68 Ga0070694_100079292 3300005444 Bacteria 2279
69 Ga0070708_100075792 3300005445 Bacteria 3036
70 Ga0070708_100275386 3300005445 Bacteria 1583
71 Ga0070678_100002631 3300005456 Bacteria 9880
72 Ga0070678_100028953 3300005456 Bacteria 3786
73 Ga0070662_100223431 3300005457 Bacteria 1504
74 Ga0070681_10019500 3300005458 Bacteria 6790
75 Ga0070681_10108226 3300005458 Bacteria 2720
76 Ga0068867_100009353 3300005459 Bacteria 6917
77 Ga0068867_100013323 3300005459 Bacteria 5825
78 Ga0068867_100025953 3300005459 Bacteria 4203
79 Ga0068867_100065776 3300005459 Bacteria 2699
80 Ga0070706_100000101 3300005467 Bacteria 104707
81 Ga0070706_100087293 3300005467 Bacteria 2891
82 Ga0070707_100014493 3300005468 Bacteria 7388
83 Ga0070707_100058637 3300005468 Bacteria 3692
84 Ga0070707_100079899 3300005468 Bacteria 3156
85 Ga0070707_100195747 3300005468 Unclassified 1970
86 Ga0070698_100029348 3300005471 Bacteria 5710
87 Ga0070698_100040293 3300005471 Bacteria 4801
88 Ga0070698_100054630 3300005471 Bacteria 4054
89 Ga0070698_100229468 3300005471 Unclassified 1790
90 Ga0070699_100003668 3300005518 Bacteria 13600
91 Ga0070699_100008689 3300005518 Bacteria 8804
92 Ga0070699_100030443 3300005518 Bacteria 4659
93 Ga0070699_100093431 3300005518 Bacteria 2632
94 Ga0070699_100172458 3300005518 Bacteria 1917
95 Ga0070679_100022602 3300005530 Bacteria 6148
96 Ga0070679_100174362 3300005530 Bacteria 2123
97 Ga0070684_100000068 3300005535 Bacteria 65538
98 Ga0070684_100009549 3300005535 Bacteria 7645
99 Ga0070697_100000189 3300005536 Bacteria 50813
100 Ga0070697_100038812 3300005536 Bacteria 3848
101 Ga0070697_100189167 3300005536 Bacteria 1747
102 Ga0070672_100029894 3300005543 Bacteria 4089
103 Ga0070695_100000785 3300005545 Bacteria 17066
104 Ga0070695_100014083 3300005545 Bacteria 4815
105 Ga0070696_100029118 3300005546 Bacteria 3771
106 Ga0070696_100058504 3300005546 Bacteria 2692
107 Ga0070696_100078877 3300005546 Bacteria 2329
108 Ga0070696_100125583 3300005546 Bacteria 1861
109 Ga0070693_100047782 3300005547 Bacteria 2436
110 Ga0070665_100006386 3300005548 Bacteria 12013
111 Ga0070665_100008967 3300005548 Bacteria 10134
112 Ga0070665_100010405 3300005548 Bacteria 9414
113 Ga0070665_100033210 3300005548 Bacteria 5192
114 Ga0070704_100001151 3300005549 Bacteria 13820
115 Ga0070704_100011495 3300005549 Bacteria 5427
116 Ga0070704_100055179 3300005549 Bacteria 2815
117 Ga0070704_100089098 3300005549 Bacteria 2294
118 Ga0070704_100103135 3300005549 Bacteria 2154
119 Ga0070704_100140567 3300005549 Unclassified 1884
120 Ga0070704_100146319 3300005549 Unclassified 1852
121 Ga0068855_100322533 3300005563 Bacteria 1707
122 Ga0070664_100008127 3300005564 Bacteria 8482
123 Ga0068857_100050996 3300005577 Bacteria 3670
124 Ga0068854_100050997 3300005578 Bacteria 2963
125 Ga0068854_100052821 3300005578 Bacteria 2916
126 Ga0070702_100001302 3300005615 Bacteria 10114
127 Ga0068859_100005666 3300005617 Bacteria 12714
128 Ga0068859_100024547 3300005617 Bacteria 6048
129 Ga0068859_100227254 3300005617 Bacteria 1954
130 Ga0068859_100266819 3300005617 Unclassified 1804
131 Ga0068859_100328683 3300005617 Bacteria 1623
132 Ga0068864_100006553 3300005618 Bacteria 9539
133 Ga0068866_10010359 3300005718 Bacteria 3994
134 Ga0068861_100003622 3300005719 Bacteria 10288
135 Ga0068863_100066986 3300005841 Bacteria 3396
136 Ga0068863_100140256 3300005841 Unclassified 2310
137 Ga0068863_100194278 3300005841 Bacteria 1951
138 Ga0068858_100005453 3300005842 Bacteria 12454
139 Ga0068858_100013146 3300005842 Bacteria 7805
140 Ga0068858_100034125 3300005842 Bacteria 4720
141 Ga0068858_100180904 3300005842 Bacteria 1991
142 Ga0068860_100061312 3300005843 Bacteria 3574
143 Ga0068860_100185959 3300005843 Bacteria 2009
144 Ga0068862_100016452 3300005844 Bacteria 6156
145 Ga0068862_100046267 3300005844 Bacteria 3712
146 Ga0068862_100234264 3300005844 Bacteria 1667
147 Ga0068862_100323912 3300005844 Bacteria 1423
148 Ga0081455_10013648 3300005937 Bacteria 8002
149 Ga0081455_10102180 3300005937 Unclassified 2299
150 Ga0081455_10116831 3300005937 Bacteria 2109
151 Ga0081538_10001528 3300005981 Bacteria 23736
152 Ga0081538_10058983 3300005981 Bacteria 2221
153 Ga0081539_10000093 3300005985 Bacteria 207314
154 Ga0075365_10007190 3300006038 Bacteria 6215
155 Ga0075364_10047399 3300006051 Bacteria 2799
156 Ga0075362_10000421 3300006177 Bacteria 12191
157 Ga0075367_10003356 3300006178 Bacteria 7615
158 Ga0075366_10013364 3300006195 Bacteria 4672
159 Ga0097621_100000477 3300006237 Bacteria 28162
160 Ga0097621_100002349 3300006237 Bacteria 12970
161 Ga0097621_100013417 3300006237 Bacteria 6107
162 Ga0097621_100022317 3300006237 Bacteria 4912
163 Ga0097621_100030260 3300006237 Bacteria 4284
164 Ga0097621_100040296 3300006237 Bacteria 3755
165 Ga0097621_100192429 3300006237 Unclassified 1767
166 Ga0075370_10006888 3300006353 Bacteria 5751
167 Ga0068871_100005279 3300006358 Bacteria 9044
168 Ga0068871_100012430 3300006358 Bacteria 6275
169 Ga0068871_100015114 3300006358 Bacteria 5771
170 Ga0068871_100032832 3300006358 Bacteria 4104
171 Ga0075428_100000080 3300006844 Bacteria 80349
172 Ga0075428_100032730 3300006844 Bacteria 5742
173 Ga0075428_100131866 3300006844 Bacteria 2717
174 Ga0075428_100414895 3300006844 Bacteria 1442
175 Ga0075430_100002473 3300006846 Bacteria 15388
176 Ga0075430_100078679 3300006846 Unclassified 2764
177 Ga0075431_100002515 3300006847 Bacteria 17677
178 Ga0075431_100011777 3300006847 Bacteria 8824
179 Ga0075431_100133808 3300006847 Unclassified 2556
180 Ga0075433_10007021 3300006852 Bacteria 8923
181 Ga0075433_10016600 3300006852 Bacteria 6075
182 Ga0075433_10129598 3300006852 Bacteria 2241
183 Ga0075434_100004294 3300006871 Bacteria 12804
184 Ga0075434_100005549 3300006871 Bacteria 11495
185 Ga0075434_100010893 3300006871 Bacteria 8550
186 Ga0075434_100035368 3300006871 Bacteria 4938
187 Ga0075434_100045559 3300006871 Bacteria 4351
188 Ga0075434_100059288 3300006871 Bacteria 3805
189 Ga0075434_100162802 3300006871 Bacteria 2251
190 Ga0075434_100302637 3300006871 Bacteria 1620
191 Ga0075429_100000156 3300006880 Bacteria 42804
192 Ga0075429_100001098 3300006880 Bacteria 21794
193 Ga0075429_100050306 3300006880 Bacteria 3626
194 Ga0075429_100093444 3300006880 Bacteria 2623
195 Ga0068865_100008148 3300006881 Bacteria 6466
196 Ga0068865_100039835 3300006881 Bacteria 3189
197 Ga0068865_100058204 3300006881 Bacteria 2698
198 Ga0068865_100089278 3300006881 Bacteria 2232
199 Ga0075436_100000295 3300006914 Bacteria 31676
200 Ga0075436_100007582 3300006914 Bacteria 7413
201 Ga0097620_100005666 3300006931 Bacteria 12714
202 Ga0097620_100024547 3300006931 Bacteria 6048
203 Ga0097620_100227264 3300006931 Bacteria 1954
204 Ga0097620_100266820 3300006931 Unclassified 1804
205 Ga0097620_100328726 3300006931 Bacteria 1623
206 Ga0075435_100000147 3300007076 Bacteria 39845
207 Ga0075435_100002656 3300007076 Bacteria 11922
208 Ga0075435_100030102 3300007076 Bacteria 4266
209 Ga0075435_100036648 3300007076 Bacteria 3900
210 Ga0075435_100037478 3300007076 Bacteria 3861
211 Ga0075435_100091312 3300007076 Bacteria 2513
212 Ga0075435_100149449 3300007076 Archaea 1963
213 Ga0105240_10011792 3300009093 Bacteria 12141
214 Ga0105240_10034088 3300009093 Bacteria 6571
215 Ga0105240_10178022 3300009093 Unclassified 2512
216 Ga0105240_10180230 3300009093 Bacteria 2494
217 Ga0105240_10197850 3300009093 Bacteria 2357
218 Ga0111539_10000059 3300009094 Bacteria 113645
219 Ga0111539_10000181 3300009094 Bacteria 73457
220 Ga0111539_10000209 3300009094 Bacteria 69503
221 Ga0111539_10002429 3300009094 Bacteria 24773
222 Ga0111539_10009783 3300009094 Bacteria 12103
223 Ga0111539_10043681 3300009094 Bacteria 5372
224 Ga0111539_10047449 3300009094 Bacteria 5132
225 Ga0111539_10100907 3300009094 Bacteria 3389
226 Ga0111539_10115071 3300009094 Bacteria 3155
227 Ga0111539_10137313 3300009094 Bacteria 2863
228 Ga0111539_10145053 3300009094 Bacteria 2779
229 Ga0111539_10164168 3300009094 Bacteria 2598
230 Ga0105245_10005530 3300009098 Bacteria 11098
231 Ga0105245_10324095 3300009098 Bacteria 1519
232 Ga0105247_10019812 3300009101 Bacteria 4041
233 Ga0105247_10031210 3300009101 Bacteria 3233
234 Ga0105247_10040093 3300009101 Unclassified 2862
235 Ga0114129_10000077 3300009147 Bacteria 90951
236 Ga0114129_10001820 3300009147 Bacteria 29050
237 Ga0114129_10009067 3300009147 Bacteria 14179
238 Ga0114129_10034155 3300009147 Bacteria 7183
239 Ga0114129_10036366 3300009147 Bacteria 6954
240 Ga0114129_10043732 3300009147 Bacteria 6302
241 Ga0114129_10106350 3300009147 Unclassified 3876
242 Ga0114129_10108011 3300009147 Bacteria 3842
243 Ga0114129_10112109 3300009147 Bacteria 3762
244 Ga0105243_10016882 3300009148 Bacteria 5520
245 Ga0105243_10054372 3300009148 Bacteria 3179
246 Ga0105242_10003632 3300009176 Bacteria 12008
247 Ga0105242_10027319 3300009176 Bacteria 4529
248 Ga0105242_10097791 3300009176 Bacteria 2482
249 Ga0105248_10004014 3300009177 Bacteria 16266
250 Ga0105248_10014318 3300009177 Bacteria 8730
251 Ga0105248_10018395 3300009177 Bacteria 7720
252 Ga0105248_10023744 3300009177 Bacteria 6814
253 Ga0105248_10033764 3300009177 Bacteria 5718
254 Ga0105248_10043896 3300009177 Bacteria 5014
255 Ga0105248_10148605 3300009177 Bacteria 2644
256 Ga0105248_10317020 3300009177 Bacteria 1756
257 Ga0105237_10176890 3300009545 Bacteria 2134
258 Ga0105249_10153421 3300009553 Bacteria 2219
259 Ga0105249_10154010 3300009553 Bacteria 2215
260 Ga0105249_10232698 3300009553 Unclassified 1818
261 Ga0157370_10278479 3300013104 Bacteria 1546
262 Ga0157374_10128612 3300013296 Bacteria 2450
263 Ga0157374_10305188 3300013296 Unclassified 1575
264 Ga0157378_10000578 3300013297 Bacteria 34492
265 Ga0157378_10023338 3300013297 Bacteria 5444
266 Ga0163162_10056599 3300013306 Bacteria 3949
267 Ga0157372_10140203 3300013307 Unclassified 2785
268 Ga0157375_10002741 3300013308 Bacteria 15224
269 Ga0157375_10028668 3300013308 Bacteria 5223
270 Ga0157375_10132350 3300013308 Unclassified 2614
271 Ga0157375_10218723 3300013308 Unclassified 2063
272 Ga0163163_10010892 3300014325 Bacteria 8216
273 Ga0163163_10013097 3300014325 Bacteria 7577
274 Ga0163163_10023177 3300014325 Bacteria 5890
275 Ga0157380_10034162 3300014326 Bacteria 3921
276 Ga0157380_10051633 3300014326 Bacteria 3253
277 Ga0157380_10065967 3300014326 Bacteria 2911
278 Ga0157380_10114672 3300014326 Bacteria 2271
279 Ga0157379_10000584 3300014968 Bacteria 29559
280 Ga0157379_10017975 3300014968 Bacteria 6231
281 Ga0157379_10018346 3300014968 Bacteria 6168
282 Ga0157379_10021777 3300014968 Bacteria 5678
283 Ga0157379_10044495 3300014968 Bacteria 3963
284 Ga0157379_10171473 3300014968 Bacteria 1959
285 Ga0157376_10019378 3300014969 Bacteria 5243
286 Ga0157376_10034338 3300014969 Bacteria 4095
287 Ga0157376_10041762 3300014969 Bacteria 3757
288 Ga0157376_10124749 3300014969 Bacteria 2288
289 Ga0207682_10011954 3300025893 Bacteria 3390
290 Ga0207682_10015468 3300025893 Unclassified 2970
291 Ga0207680_10004015 3300025903 Bacteria 6953
292 Ga0207680_10019777 3300025903 Bacteria 3609
293 Ga0207680_10030934 3300025903 Bacteria 3026
294 Ga0207680_10041021 3300025903 Bacteria 2698
295 Ga0207699_10077698 3300025906 Unclassified 2049
296 Ga0207645_10041479 3300025907 Bacteria 2945
297 Ga0207684_10000584 3300025910 Bacteria 44035
298 Ga0207684_10000607 3300025910 Bacteria 42607
299 Ga0207684_10214483 3300025910 Bacteria 1661
300 Ga0207684_10325909 3300025910 Unclassified 1323
301 Ga0207707_10036870 3300025912 Bacteria 4273
302 Ga0207707_10039875 3300025912 Unclassified 4103
303 Ga0207707_10230432 3300025912 Unclassified 1611
304 Ga0207695_10136275 3300025913 Unclassified 2408
305 Ga0207695_10165469 3300025913 Unclassified 2140
306 Ga0207671_10111125 3300025914 Bacteria 2085
307 Ga0207660_10029026 3300025917 Unclassified 3790
308 Ga0207662_10009833 3300025918 Bacteria 5277
309 Ga0207662_10064804 3300025918 Bacteria 2199
310 Ga0207657_10114870 3300025919 Bacteria 2219
311 Ga0207649_10022407 3300025920 Bacteria 3649
312 Ga0207652_10038008 3300025921 Unclassified 4078
313 Ga0207652_10210762 3300025921 Bacteria 1749
314 Ga0207646_10024832 3300025922 Bacteria 5485
315 Ga0207646_10036794 3300025922 Bacteria 4417
316 Ga0207646_10036937 3300025922 Bacteria 4407
317 Ga0207681_10012038 3300025923 Bacteria 5329
318 Ga0207681_10019225 3300025923 Bacteria 4314
319 Ga0207681_10244036 3300025923 Bacteria 1399
320 Ga0207650_10008008 3300025925 Bacteria 7201
321 Ga0207650_10030010 3300025925 Bacteria 3913
322 Ga0207650_10180756 3300025925 Bacteria 1681
323 Ga0207650_10188207 3300025925 Bacteria 1648
324 Ga0207659_10000076 3300025926 Bacteria 62373
325 Ga0207659_10017562 3300025926 Bacteria 4675
326 Ga0207659_10096939 3300025926 Bacteria 2214
327 Ga0207687_10008541 3300025927 Bacteria 6698
328 Ga0207664_10177549 3300025929 Unclassified 1827
329 Ga0207644_10022378 3300025931 Bacteria 4319
330 Ga0207706_10066896 3300025933 Bacteria 3162
331 Ga0207706_10084052 3300025933 Bacteria 2798
332 Ga0207706_10099614 3300025933 Bacteria 2557
333 Ga0207686_10017136 3300025934 Bacteria 4077
334 Ga0207686_10020853 3300025934 Bacteria 3751
335 Ga0207709_10048363 3300025935 Bacteria 2591
336 Ga0207670_10131699 3300025936 Bacteria 1833
337 Ga0207669_10015080 3300025937 Unclassified 3888
338 Ga0207669_10046761 3300025937 Bacteria 2559
339 Ga0207669_10062920 3300025937 Bacteria 2288
340 Ga0207669_10093624 3300025937 Unclassified 1964
341 Ga0207669_10221925 3300025937 Bacteria 1388
342 Ga0207704_10010703 3300025938 Bacteria 4486
343 Ga0207704_10062347 3300025938 Bacteria 2318
344 Ga0207704_10132313 3300025938 Bacteria 1730
345 Ga0207691_10000274 3300025940 Bacteria 51054
346 Ga0207691_10022903 3300025940 Bacteria 5887
347 Ga0207691_10095964 3300025940 Bacteria 2651
348 Ga0207711_10016158 3300025941 Bacteria 6196
349 Ga0207711_10030976 3300025941 Bacteria 4512
350 Ga0207711_10033697 3300025941 Bacteria 4335
351 Ga0207711_10042071 3300025941 Bacteria 3892
352 Ga0207711_10073136 3300025941 Unclassified 2979
353 Ga0207711_10091941 3300025941 Bacteria 2669
354 Ga0207711_10114557 3300025941 Bacteria 2401
355 Ga0207661_10002311 3300025944 Bacteria 13129
356 Ga0207661_10031293 3300025944 Bacteria 4108
357 Ga0207679_10002489 3300025945 Bacteria 11346
358 Ga0207679_10193752 3300025945 Bacteria 1692
359 Ga0207651_10000358 3300025960 Bacteria 19310
360 Ga0207668_10051113 3300025972 Bacteria 2853
361 Ga0207640_10026213 3300025981 Bacteria 3536
362 Ga0207640_10040545 3300025981 Bacteria 2955
363 Ga0207658_10053150 3300025986 Bacteria 2992
364 Ga0207677_10029159 3300026023 Bacteria 3503
365 Ga0207677_10038536 3300026023 Bacteria 3134
366 Ga0207677_10098597 3300026023 Bacteria 2144
367 Ga0207703_10021562 3300026035 Bacteria 5044
368 Ga0207703_10024618 3300026035 Bacteria 4735
369 Ga0207703_10136597 3300026035 Bacteria 2123
370 Ga0207703_10225785 3300026035 Bacteria 1676
371 Ga0207678_10030823 3300026067 Bacteria 4683
372 Ga0207708_10067610 3300026075 Bacteria 2734
373 Ga0207641_10001113 3300026088 Bacteria 27018
374 Ga0207641_10099587 3300026088 Bacteria 2558
375 Ga0207641_10188514 3300026088 Bacteria 1894
376 Ga0207648_10015198 3300026089 Bacteria 7085
377 Ga0207648_10017181 3300026089 Bacteria 6592
378 Ga0207648_10024699 3300026089 Bacteria 5360
379 Ga0207676_10090218 3300026095 Bacteria 2514
380 Ga0207676_10139761 3300026095 Bacteria 2072
381 Ga0207674_10102743 3300026116 Bacteria 2838
382 Ga0207675_100009497 3300026118 Bacteria 9103
383 Ga0207675_100015621 3300026118 Bacteria 7082
384 Ga0207675_100030251 3300026118 Bacteria 5043
385 Ga0207675_100044375 3300026118 Bacteria 4154
386 Ga0207683_10000220 3300026121 Bacteria 50064
387 Ga0207683_10078339 3300026121 Bacteria 2928
388 Ga0207683_10135318 3300026121 Unclassified 2218
389 Ga0207683_10198667 3300026121 Bacteria 1822
390 Ga0209974_10014515 3300027876 Bacteria 2621
391 Ga0207428_10000022 3300027907 Bacteria 273333
392 Ga0207428_10000558 3300027907 Bacteria 44040
393 Ga0207428_10010107 3300027907 Bacteria 8441
394 Ga0207428_10044726 3300027907 Bacteria 3570
395 Ga0207428_10113132 3300027907 Bacteria 2087
396 Ga0207428_10130250 3300027907 Bacteria 1925
397 Ga0207428_10215065 3300027907 Bacteria 1443
398 Ga0268266_10003789 3300028379 Bacteria 14802
399 Ga0268266_10013799 3300028379 Bacteria 6955
400 Ga0268266_10059104 3300028379 Bacteria 3303
401 Ga0268266_10189584 3300028379 Bacteria 1877
402 Ga0268265_10005243 3300028380 Bacteria 8869
403 Ga0268265_10015893 3300028380 Bacteria 5162
404 Ga0268265_10048093 3300028380 Bacteria 3200
405 Ga0268265_10084405 3300028380 Bacteria 2517
406 Ga0268264_10150375 3300028381 Bacteria 2087
407 Ga0268264_10183526 3300028381 Bacteria 1902
408 Ga0268264_10222629 3300028381 Bacteria 1738
409 Ga0307408_100014908 3300031548 Bacteria 5170
410 Ga0307408_100017734 3300031548 Bacteria 4769
411 Ga0307408_100028574 3300031548 Bacteria 3855
412 Ga0307408_100048714 3300031548 Bacteria 3040
413 Ga0307408_100174714 3300031548 Bacteria 1718
414 Ga0316576_10001732 3300031727 Bacteria 12009
415 Ga0316576_10012676 3300031727 Bacteria 5576
416 Ga0316576_10079178 3300031727 Bacteria 2436
417 Ga0316576_10097215 3300031727 Bacteria 2198
418 Ga0316578_10039372 3300031728 Bacteria 2730
419 Ga0316578_10045731 3300031728 Bacteria 2549
420 Ga0307405_10106539 3300031731 Unclassified 1891
421 Ga0307413_10011324 3300031824 Bacteria 4378
422 Ga0307410_10015511 3300031852 Bacteria 4522
423 Ga0307406_10006061 3300031901 Bacteria 6644
424 Ga0307406_10060683 3300031901 Bacteria 2439
425 Ga0307407_10083699 3300031903 Bacteria 1936
426 Ga0307407_10164637 3300031903 Bacteria 1454
427 Ga0307412_10056975 3300031911 Bacteria 2606
428 Ga0307412_10080319 3300031911 Bacteria 2252
429 Ga0307412_10257282 3300031911 Unclassified 1359
430 Ga0307409_100001383 3300031995 Bacteria 11838
431 Ga0307409_100015060 3300031995 Bacteria 5058
432 Ga0307409_100043912 3300031995 Bacteria 3361
433 Ga0307409_100099475 3300031995 Bacteria 2408
434 Ga0307409_100146814 3300031995 Bacteria 2041
435 Ga0307409_100169240 3300031995 Bacteria 1921
436 Ga0307416_100019816 3300032002 Bacteria 4780
437 Ga0307416_100042086 3300032002 Bacteria 3563
438 Ga0307416_100051044 3300032002 Bacteria 3301
439 Ga0307416_100128625 3300032002 Bacteria 2274
440 Ga0307416_100164779 3300032002 Unclassified 2054
441 Ga0307416_100225817 3300032002 Unclassified 1800
442 Ga0307416_100248288 3300032002 Bacteria 1730
443 Ga0307414_10003946 3300032004 Bacteria 7998
444 Ga0307414_10294894 3300032004 Bacteria 1369
445 Ga0307411_10013487 3300032005 Bacteria 4511
446 Ga0307411_10022704 3300032005 Bacteria 3700
447 Ga0307411_10040453 3300032005 Bacteria 2957
448 Ga0307415_100033261 3300032126 Bacteria 3346
449 Ga0307415_100036207 3300032126 Bacteria 3232
450 Ga0307415_100059500 3300032126 Bacteria 2635
451 Ga0307415_100070606 3300032126 Bacteria 2453
452 Ga0307415_100152678 3300032126 Unclassified 1779
453 Ga0307415_100155516 3300032126 Bacteria 1765
454 Ga0316585_10003409 3300032137 Bacteria 4382
455 Ga0373930_0005539 3300034816 Bacteria 2104
456 Ga0373948_0001144 3300034817 Bacteria 3590
457 Ga0373959_0003577 3300034820 Bacteria 2484
458 Ga0373938_0009930 3300034957 Bacteria 1735
459 Ga0373929_0001662 3300035085 Bacteria 4206
460 Ga0373949_0003851 3300035090 Bacteria 3486
461 Ga0373951_0001709 3300035091 Bacteria 5739
462 Ga0373952_0005960 3300035092 Bacteria 2242
463 Ga0373960_0001784 3300035121 Bacteria 4826
464 Ga0373960_0019621 3300035121 Unclassified 1778
465 Ga0373943_0014143 3300035170 Bacteria 3609
466 Ga0373943_0093508 3300035170 Bacteria 1561
467 Ga0373955_0062485 3300035172 Bacteria 2060
468 Ga0373942_0002156 3300035207 Bacteria 4857
469 Ga0373961_0001299 3300035241 Bacteria 7587
470 Ga0373962_0021759 3300035242 Bacteria 1694
471 Ga0316574_0005798 3300035398 Bacteria 6623
472 Ga0373931_0003301 3300035691 Bacteria 7222
473 Ga0373935_0001390 3300035692 Bacteria 13377
474 Ga0373927_0195421 3300035695 Unclassified 1328
475 Ga0373947_0019793 3300035725 Bacteria 3884
476 Ga0373947_0030984 3300035725 Bacteria 3145
477 Ga0373947_0061983 3300035725 Bacteria 2274
478 Ga0373937_0113098 3300036401 Unclassified 2526
479 Ga0373937_0130401 3300036401 Bacteria 2348
480 Ga0373937_0192147 3300036401 Bacteria 1918
481 Ga0373937_0324798 3300036401 Unclassified 1456
482 Ga0316584_0062827 3300036712 Unclassified 2781
483 Ga0316584_0147689 3300036712 Bacteria 1751
484 Ga0395901_0138426 3300038443 Bacteria 2559
485 Ga0400489_79885 3300039093 Bacteria 2165
486 Ga0439450_011231 3300042008 Bacteria 1750
487 Ga0450894_001322 3300042131 Bacteria 3596
488 Ga0450896_003414 3300042133 Bacteria 2108
489 Ga0439446_0005503 3300042156 Bacteria 3260
490 Ga0451577_0009300 3300042876 Bacteria 9473
491 Ga0453683_0101290 3300044673 Bacteria 1808
492 Ga0466963_0043121 3300044694 Bacteria 2965
493 Ga0453684_0189375 3300044712 Archaea 2408
494 Ga0451576_0085794 3300045051 Bacteria 3275
495 Ga0451576_0295006 3300045051 Bacteria 1695
496 Ga0466967_0120944 3300045976 Bacteria 2419
497 Ga0466967_0149774 3300045976 Archaea 2180
498 Ga0495592_0047193 3300046454 Bacteria 3208
499 Ga0495603_0077086 3300046455 Bacteria 1956
500 Ga0495603_0159939 3300046455 Unclassified 1306
501 Ga0495629_0138722 3300046459 Bacteria 1692
502 Ga0495653_0282290 3300046463 Bacteria 1089
503 Ga0495580_0004341 3300046472 Bacteria 11903
504 Ga0495580_0085690 3300046472 Bacteria 2194
505 Ga0495580_0168405 3300046472 Bacteria 1515
506 Ga0495582_0142071 3300046473 Bacteria 1361
507 Ga0495664_0046084 3300046477 Bacteria 2587
508 Ga0495664_0059719 3300046477 Bacteria 2270
509 Ga0495608_0011561 3300046511 Bacteria 6140
510 Ga0495628_0172061 3300046516 Bacteria 1642
511 Ga0495652_0118392 3300046529 Bacteria 2117
512 Ga0495586_0128782 3300046535 Bacteria 1417
513 Ga0495645_0007653 3300046543 Bacteria 7516
514 Ga0495645_0076832 3300046543 Bacteria 2401
515 Ga0495647_0023242 3300046681 Bacteria 2247
516 Ga0495647_0042692 3300046681 Bacteria 1733
517 Ga0495658_0022670 3300046683 Bacteria 3324
518 Ga0495658_0085015 3300046683 Bacteria 1864
519 Ga0495658_0104655 3300046683 Bacteria 1694
520 Ga0495669_0000990 3300046684 Bacteria 11874
521 Ga0495613_0004695 3300046689 Bacteria 10249
522 Ga0495613_0148506 3300046689 Bacteria 1673
523 Ga0495604_0017283 3300047317 Bacteria 5773
524 Ga0495674_0029729 3300047319 Bacteria 4972
525 Ga0495674_0172636 3300047319 Bacteria 1803
526 Ga0495684_0000228 3300047471 Bacteria 43929
527 Ga0496100_0026293 3300048903 Bacteria 3567
528 Ga0496101_0000348 3300048904 Bacteria 31198
529 Ga0496101_0064748 3300048904 Bacteria 2664
530 Ga0496102_0297390 3300048905 Bacteria 1521
531 Ga0496104_0005196 3300048907 Bacteria 11382
532 Ga0496104_0069587 3300048907 Bacteria 3345
533 Ga0496104_0084489 3300048907 Bacteria 3029
534 Ga0496104_0109714 3300048907 Unclassified 2645
535 Ga0496104_0217815 3300048907 Bacteria 1821
536 Ga0496106_0097866 3300048909 Bacteria 2272
537 Ga0496106_0265093 3300048909 Bacteria 1375
538 Ga0496107_0139087 3300048910 Bacteria 1795
539 Ga0496108_0021614 3300048911 Bacteria 5287
540 Ga0496108_0148650 3300048911 Bacteria 2021
541 Ga0496108_0284399 3300048911 Bacteria 1440
542 Ga0496109_0001290 3300048912 Bacteria 20786
543 Ga0496110_0008036 3300048913 Bacteria 8459
544 Ga0496110_0159285 3300048913 Bacteria 2046
545 Ga0496110_0277894 3300048913 Bacteria 1525
546 Ga0496112_0027070 3300048915 Bacteria 5527
547 Ga0496112_0091338 3300048915 Bacteria 3014
548 Ga0496114_0002236 3300048917 Bacteria 14743
549 Ga0496114_0002337 3300048917 Bacteria 14432
550 Ga0496114_0109399 3300048917 Unclassified 2367
551 Ga0496114_0211738 3300048917 Bacteria 1700
552 Ga0496115_0012077 3300048918 Bacteria 6495
553 Ga0501031_0040726 3300049568 Bacteria 3033
554 Ga0501036_0030546 3300049572 Bacteria 4550
555 Ga0501036_0156172 3300049572 Unclassified 1924
556 Ga0501036_0279895 3300049572 Unclassified 1396
557 Ga0501037_0119167 3300049573 Bacteria 1899
558 Ga0501040_0004841 3300049576 Bacteria 8723
559 Ga0501040_0201607 3300049576 Unclassified 1413
560 Ga0501041_0002942 3300049577 Bacteria 9771
561 Ga0501047_0072784 3300049581 Bacteria 3308
562 Ga0501048_0013517 3300049582 Bacteria 6057
563 Ga0501048_0042667 3300049582 Bacteria 3247
564 Ga0501071_0006201 3300049587 Bacteria 7754
565 Ga0501071_0016739 3300049587 Bacteria 5043
566 Ga0501071_0019329 3300049587 Bacteria 4727
567 Ga0501071_0022296 3300049587 Bacteria 4415
568 Ga0501072_0010004 3300049588 Bacteria 7213
569 Ga0501072_0017543 3300049588 Bacteria 5502
570 Ga0501072_0030128 3300049588 Bacteria 4242
571 Ga0501072_0048095 3300049588 Bacteria 3359
572 Ga0501074_0087231 3300049590 Bacteria 2235
573 Ga0501074_0111236 3300049590 Bacteria 1960
574 Ga0501075_0079644 3300049591 Bacteria 2479
575 Ga0501075_0105271 3300049591 Bacteria 2144
576 Ga0501076_0026029 3300049592 Bacteria 4527
577 Ga0501076_0164356 3300049592 Unclassified 1809
578 Ga0501076_0171279 3300049592 Bacteria 1769
579 Ga0501217_028030 3300049661 Bacteria 1370
580 Ga0501079_0007892 3300049741 Bacteria 8066
581 Ga0501079_0029175 3300049741 Bacteria 4234
582 Ga0501080_0055210 3300049742 Bacteria 3700
583 Ga0501081_0000406 3300049743 Bacteria 23901
584 Ga0501081_0136202 3300049743 Bacteria 1758
585 Ga0501081_0160036 3300049743 Unclassified 1622
586 Ga0501081_0177963 3300049743 Bacteria 1537
587 Ga0501083_0149519 3300049744 Bacteria 1529
588 Ga0501035_0076370 3300049822 Bacteria 2963
589 Ga0501045_0002648 3300049824 Bacteria 12203
590 Ga0501045_0007195 3300049824 Bacteria 7722
591 Ga0501045_0011015 3300049824 Bacteria 6338
592 Ga0501045_0193451 3300049824 Unclassified 1516
593 nmdc:mga03683_600_c2 3300050489 Bacteria 8045
594 nmdc:mga00v17_23721_c1 3300050491 Bacteria 3552
595 nmdc:mga00v17_4143_c1 3300050491 Bacteria 7506
596 nmdc:mga0yw44_4147_c1 3300050492 Bacteria 6583
597 nmdc:mga0yw44_61194_c1 3300050492 Bacteria 2309
598 nmdc:mga0k408_4679_c1 3300050493 Bacteria 7252
599 nmdc:mga05p37_121506_c1 3300050507 Unclassified 3208
600 nmdc:mga05p37_1796_c1 3300050507 Bacteria 25058
601 nmdc:mga05p37_200269_c1 3300050507 Archaea 2419
602 nmdc:mga05p37_2105_c1 3300050507 Bacteria 23247
603 nmdc:mga05p37_216566_c1 3300050507 Bacteria 2313
604 nmdc:mga05p37_235500_c1 3300050507 Bacteria 2204
605 nmdc:mga05p37_2819_c1 3300050507 Bacteria 20214
606 nmdc:mga05p37_34458_c1 3300050507 Bacteria 6202
607 nmdc:mga05p37_4142_c1 3300050507 Bacteria 16948
608 nmdc:mga05p37_48480_c1 3300050507 Bacteria 5224
609 nmdc:mga05p37_580882_c1 3300050507 Bacteria 1269
610 nmdc:mga09592_3401_c1 3300050508 Bacteria 12863
611 nmdc:mga09592_4431_c1 3300050508 Bacteria 11368
612 nmdc:mga0qj67_4824_c1 3300050509 Bacteria 9800
613 nmdc:mga0qj67_62847_c1 3300050509 Bacteria 2951
614 nmdc:mga06r32_134482_c1 3300050510 Bacteria 2447
615 nmdc:mga06r32_23254_c1 3300050510 Bacteria 5732
616 nmdc:mga06r32_6534_c1 3300050510 Bacteria 10474
617 nmdc:mga06r32_77179_c1 3300050510 Archaea 3236
618 nmdc:mga06r32_90676_c1 3300050510 Bacteria 2986
619 nmdc:mga08y16_10497_c1 3300050511 Bacteria 9716
620 nmdc:mga08y16_1066_c1 3300050511 Bacteria 26995
621 nmdc:mga08y16_108938_c1 3300050511 Bacteria 2884
622 nmdc:mga08y16_125304_c1 3300050511 Bacteria 2672
623 nmdc:mga08y16_1923_c1 3300050511 Bacteria 21184
624 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
625 nmdc:mga08y16_282095_c1 3300050511 Bacteria 1713
626 nmdc:mga08y16_35300_c1 3300050511 Bacteria 5251
627 nmdc:mga0n895_153202_c1 3300050512 Unclassified 2336
628 nmdc:mga0n895_2150_c1 3300050512 Bacteria 15218
629 nmdc:mga0n895_31871_c1 3300050512 Bacteria 5053
630 nmdc:mga0n895_3356_c1 3300050512 Bacteria 12873
631 nmdc:mga0n895_400504_c1 3300050512 Bacteria 1388
632 nmdc:mga0n895_59365_c1 3300050512 Bacteria 3774
633 nmdc:mga0n895_74231_c1 3300050512 Bacteria 3378
634 nmdc:mga0n895_97_c2 3300050512 Bacteria 37428
635 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
636 nmdc:mga0rr50_214006_c1 3300050513 Bacteria 1589
637 nmdc:mga0rr50_223155_c1 3300050513 Unclassified 1557
638 nmdc:mga0rr50_31819_c1 3300050513 Bacteria 3752
639 nmdc:mga0rr50_41109_c1 3300050513 Bacteria 3366
640 nmdc:mga0rr50_42681_c1 3300050513 Bacteria 3314
641 nmdc:mga0rr50_43911_c1 3300050513 Bacteria 3274
642 nmdc:mga0rr50_62346_c1 3300050513 Bacteria 2812
643 nmdc:mga08x19_178_c1 3300050514 Bacteria 51286
644 nmdc:mga08x19_41524_c1 3300050514 Bacteria 2930
645 nmdc:mga0a205_138041_c1 3300050515 Unclassified 2338
646 nmdc:mga0a205_249232_c1 3300050515 Bacteria 1656
647 nmdc:mga0a205_3446_c1 3300050515 Bacteria 14116
648 nmdc:mga0a205_41616_c1 3300050515 Bacteria 4425
649 Ga0495601_0086087 3300053077 Bacteria 2019
650 Ga0495619_0000422 3300053085 Bacteria 28636
651 Ga0495619_0038606 3300053085 Bacteria 3115
652 Ga0495619_0081819 3300053085 Bacteria 2175
653 Ga0495619_0090977 3300053085 Bacteria 2066
654 Ga0501084_0004142 3300054114 Bacteria 11817
655 Ga0501084_0004916 3300054114 Bacteria 10921
656 Ga0590071_000249 3300059421 Bacteria 15561
657 Ga0590071_000772 3300059421 Bacteria 8967
658 Ga0590071_006188 3300059421 Unclassified 2854
659 Ga0590071_009311 3300059421 Bacteria 2305
660 Ga0590074_000326 3300059423 Bacteria 6606
661 Ga0590075_000576 3300059424 Bacteria 9946
662 Ga0590075_001822 3300059424 Bacteria 5199
663 Ga0590077_000087 3300059426 Bacteria 23513
664 Ga0590077_002482 3300059426 Unclassified 3934
665 Ga0501082_0001528 3300060353 Bacteria 20359
666 Ga0501082_0013241 3300060353 Bacteria 7093
667 Ga0501082_0040443 3300060353 Bacteria 4022
668 Ga0501082_0169842 3300060353 Unclassified 1896
669 Ga0530510_0001387 3300061734 Bacteria 16257
670 Ga0530510_0036178 3300061734 Bacteria 3558

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048909 Ga0496106_0265093 Ga0496106_0265093_257_1345 321
2 3300050507 nmdc:mga05p37_216566_c1 nmdc:mga05p37_216566_c1_15_1070 326
3 3300026035 Ga0207703_10225785 Ga0207703_102257852 349
4 3300046463 Ga0495653_0282290 Ga0495653_0282290_19_1074 349
5 3300046689 Ga0495613_0148506 Ga0495613_0148506_17_1096 349
6 3300050511 nmdc:mga08y16_1923_c1 nmdc:mga08y16_1923_c1_20064_21122 349
7 3300049591 Ga0501075_0105271 Ga0501075_0105271_1072_2127 351
8 3300050509 nmdc:mga0qj67_62847_c1 nmdc:mga0qj67_62847_c1_18_1139 354
9 3300007076 Ga0075435_100002656 Ga0075435_1000026562 356
10 3300050513 nmdc:mga0rr50_214006_c1 nmdc:mga0rr50_214006_c1_273_1493 356
11 3300005328 Ga0070676_10038917 Ga0070676_100389172 357
12 3300005338 Ga0068868_100011616 Ga0068868_1000116162 357
13 3300005459 Ga0068867_100025953 Ga0068867_1000259534 357
14 3300005548 Ga0070665_100010405 Ga0070665_1000104057 357
15 3300005842 Ga0068858_100034125 Ga0068858_1000341256 357
16 3300006237 Ga0097621_100030260 Ga0097621_1000302603 357
17 3300006358 Ga0068871_100015114 Ga0068871_1000151141 357
18 3300006881 Ga0068865_100039835 Ga0068865_1000398353 357
19 3300009098 Ga0105245_10005530 Ga0105245_100055303 357
20 3300009176 Ga0105242_10027319 Ga0105242_100273193 357
21 3300009177 Ga0105248_10148605 Ga0105248_101486052 357
22 3300013306 Ga0163162_10056599 Ga0163162_100565992 357
23 3300025903 Ga0207680_10019777 Ga0207680_100197772 357
24 3300025927 Ga0207687_10008541 Ga0207687_100085415 357
25 3300025934 Ga0207686_10020853 Ga0207686_100208532 357
26 3300025938 Ga0207704_10010703 Ga0207704_100107033 357
27 3300025940 Ga0207691_10095964 Ga0207691_100959643 357
28 3300025941 Ga0207711_10030976 Ga0207711_100309766 357
29 3300025941 Ga0207711_10033697 Ga0207711_100336973 357
30 3300026023 Ga0207677_10029159 Ga0207677_100291592 357
31 3300026035 Ga0207703_10024618 Ga0207703_100246181 357
32 3300026089 Ga0207648_10017181 Ga0207648_100171815 357
33 3300026121 Ga0207683_10198667 Ga0207683_101986672 357
34 3300028379 Ga0268266_10013799 Ga0268266_100137996 357
35 3300034816 Ga0373930_0005539 Ga0373930_0005539_775_1995 357
36 3300034817 Ga0373948_0001144 Ga0373948_0001144_472_1692 357
37 3300034820 Ga0373959_0003577 Ga0373959_0003577_56_1276 357
38 3300034957 Ga0373938_0009930 Ga0373938_0009930_332_1552 357
39 3300035085 Ga0373929_0001662 Ga0373929_0001662_779_1999 357
40 3300035090 Ga0373949_0003851 Ga0373949_0003851_304_1524 357
41 3300035091 Ga0373951_0001709 Ga0373951_0001709_2642_3862 357
42 3300035092 Ga0373952_0005960 Ga0373952_0005960_324_1544 357
43 3300035121 Ga0373960_0001784 Ga0373960_0001784_937_2157 357
44 3300035207 Ga0373942_0002156 Ga0373942_0002156_3141_4361 357
45 3300035241 Ga0373961_0001299 Ga0373961_0001299_3579_4799 357
46 3300035242 Ga0373962_0021759 Ga0373962_0021759_292_1512 357
47 3300035691 Ga0373931_0003301 Ga0373931_0003301_3351_4571 357
48 3300045051 Ga0451576_0085794 Ga0451576_0085794_794_2014 357
49 3300048910 Ga0496107_0139087 Ga0496107_0139087_31_1224 357
50 3300048911 Ga0496108_0284399 Ga0496108_0284399_148_1308 357
51 3300005347 Ga0070668_100091583 Ga0070668_1000915832 358
52 3300005563 Ga0068855_100322533 Ga0068855_1003225332 358
53 3300005718 Ga0068866_10010359 Ga0068866_100103593 358
54 3300006237 Ga0097621_100022317 Ga0097621_1000223172 359
55 3300006358 Ga0068871_100032832 Ga0068871_1000328324 359
56 3300009094 Ga0111539_10043681 Ga0111539_100436812 359
57 3300027907 Ga0207428_10044726 Ga0207428_100447262 359
58 3300035170 Ga0373943_0093508 Ga0373943_0093508_57_1217 359
59 3300036401 Ga0373937_0192147 Ga0373937_0192147_247_1407 359
60 3300044694 Ga0466963_0043121 Ga0466963_0043121_681_1853 359
61 3300045976 Ga0466967_0149774 Ga0466967_0149774_800_1972 359
62 3300046681 Ga0495647_0023242 Ga0495647_0023242_418_1578 359
63 3300048903 Ga0496100_0026293 Ga0496100_0026293_2038_3198 359
64 3300048904 Ga0496101_0000348 Ga0496101_0000348_28332_29492 359
65 3300048917 Ga0496114_0002236 Ga0496114_0002236_13382_14542 359
66 3300050511 nmdc:mga08y16_10497_c1 nmdc:mga08y16_10497_c1_4576_5778 359
67 3300005549 Ga0070704_100055179 Ga0070704_1000551792 360
68 3300049743 Ga0501081_0136202 Ga0501081_0136202_493_1707 360
69 3300005471 Ga0070698_100229468 Ga0070698_1002294682 361
70 3300005841 Ga0068863_100194278 Ga0068863_1001942782 361
71 3300006881 Ga0068865_100089278 Ga0068865_1000892782 361
72 3300009177 Ga0105248_10018395 Ga0105248_100183954 361
73 3300014969 Ga0157376_10041762 Ga0157376_100417622 361
74 3300025938 Ga0207704_10062347 Ga0207704_100623471 361
75 3300035172 Ga0373955_0062485 Ga0373955_0062485_141_1310 361
76 3300042876 Ga0451577_0009300 Ga0451577_0009300_6478_7650 361
77 3300044712 Ga0453684_0189375 Ga0453684_0189375_176_1348 361
78 3300046535 Ga0495586_0128782 Ga0495586_0128782_87_1256 361
79 3300046683 Ga0495658_0104655 Ga0495658_0104655_152_1321 361
80 3300053077 Ga0495601_0086087 Ga0495601_0086087_197_1366 361
81 3300053085 Ga0495619_0090977 Ga0495619_0090977_378_1547 361
82 3300005841 Ga0068863_100066986 Ga0068863_1000669863 362
83 3300006852 Ga0075433_10007021 Ga0075433_100070216 362
84 3300006871 Ga0075434_100045559 Ga0075434_1000455593 362
85 3300026088 Ga0207641_10001113 Ga0207641_100011132 362
86 3300035121 Ga0373960_0019621 Ga0373960_0019621_468_1637 362
87 3300049581 Ga0501047_0072784 Ga0501047_0072784_1559_2731 362
88 3300050512 nmdc:mga0n895_31871_c1 nmdc:mga0n895_31871_c1_1154_2323 362
89 3300005328 Ga0070676_10004192 Ga0070676_100041922 364
90 3300005330 Ga0070690_100131778 Ga0070690_1001317782 364
91 3300005341 Ga0070691_10000473 Ga0070691_100004736 364
92 3300005353 Ga0070669_100088294 Ga0070669_1000882942 364
93 3300005356 Ga0070674_100024262 Ga0070674_1000242622 364
94 3300005364 Ga0070673_100071179 Ga0070673_1000711792 364
95 3300005438 Ga0070701_10014384 Ga0070701_100143842 364
96 3300005440 Ga0070705_100006359 Ga0070705_1000063592 364
97 3300005441 Ga0070700_100006004 Ga0070700_1000060043 364
98 3300005441 Ga0070700_100070143 Ga0070700_1000701432 364
99 3300005459 Ga0068867_100009353 Ga0068867_1000093535 364
100 3300005459 Ga0068867_100013323 Ga0068867_1000133234 364
101 3300005546 Ga0070696_100029118 Ga0070696_1000291182 364
102 3300005549 Ga0070704_100011495 Ga0070704_1000114952 364
103 3300005615 Ga0070702_100001302 Ga0070702_1000013022 364
104 3300005719 Ga0068861_100003622 Ga0068861_10000362210 364
105 3300006881 Ga0068865_100058204 Ga0068865_1000582042 364
106 3300009093 Ga0105240_10178022 Ga0105240_101780222 364
107 3300009148 Ga0105243_10016882 Ga0105243_100168821 364
108 3300009148 Ga0105243_10054372 Ga0105243_100543722 364
109 3300009176 Ga0105242_10097791 Ga0105242_100977912 364
110 3300025913 Ga0207695_10165469 Ga0207695_101654692 364
111 3300025923 Ga0207681_10244036 Ga0207681_102440361 364
112 3300025934 Ga0207686_10017136 Ga0207686_100171362 364
113 3300025935 Ga0207709_10048363 Ga0207709_100483632 364
114 3300025938 Ga0207704_10132313 Ga0207704_101323131 364
115 3300025981 Ga0207640_10026213 Ga0207640_100262133 364
116 3300026075 Ga0207708_10067610 Ga0207708_100676102 364
117 3300026089 Ga0207648_10015198 Ga0207648_100151982 364
118 3300026089 Ga0207648_10024699 Ga0207648_100246992 364
119 3300026118 Ga0207675_100009497 Ga0207675_1000094976 364
120 3300005335 Ga0070666_10004947 Ga0070666_100049475 365
121 3300005356 Ga0070674_100133085 Ga0070674_1001330852 365
122 3300005366 Ga0070659_100233553 Ga0070659_1002335531 365
123 3300005471 Ga0070698_100054630 Ga0070698_1000546302 365
124 3300005536 Ga0070697_100038812 Ga0070697_1000388123 365
125 3300005578 Ga0068854_100052821 Ga0068854_1000528213 365
126 3300005844 Ga0068862_100234264 Ga0068862_1002342642 365
127 3300006852 Ga0075433_10016600 Ga0075433_100166002 365
128 3300006871 Ga0075434_100004294 Ga0075434_1000042949 365
129 3300006871 Ga0075434_100035368 Ga0075434_1000353683 365
130 3300006871 Ga0075434_100059288 Ga0075434_1000592883 365
131 3300006914 Ga0075436_100000295 Ga0075436_10000029515 365
132 3300007076 Ga0075435_100000147 Ga0075435_10000014715 365
133 3300007076 Ga0075435_100037478 Ga0075435_1000374781 365
134 3300009093 Ga0105240_10197850 Ga0105240_101978502 365
135 3300009094 Ga0111539_10100907 Ga0111539_101009072 365
136 3300009147 Ga0114129_10001820 Ga0114129_1000182030 365
137 3300009147 Ga0114129_10034155 Ga0114129_100341554 365
138 3300025903 Ga0207680_10030934 Ga0207680_100309343 365
139 3300025910 Ga0207684_10325909 Ga0207684_103259091 365
140 3300025918 Ga0207662_10009833 Ga0207662_100098332 365
141 3300025923 Ga0207681_10012038 Ga0207681_100120382 365
142 3300025926 Ga0207659_10017562 Ga0207659_100175626 365
143 3300028380 Ga0268265_10005243 Ga0268265_100052437 365
144 3300048909 Ga0496106_0097866 Ga0496106_0097866_747_1967 365
145 3300050507 nmdc:mga05p37_2105_c1 nmdc:mga05p37_2105_c1_21812_23023 365
146 3300050507 nmdc:mga05p37_48480_c1 nmdc:mga05p37_48480_c1_2890_4059 365
147 3300050511 nmdc:mga08y16_35300_c1 nmdc:mga08y16_35300_c1_2475_3644 365
148 3300050512 nmdc:mga0n895_153202_c1 nmdc:mga0n895_153202_c1_856_2070 365
149 3300050512 nmdc:mga0n895_400504_c1 nmdc:mga0n895_400504_c1_101_1294 365
150 3300050512 nmdc:mga0n895_74231_c1 nmdc:mga0n895_74231_c1_907_2118 365
151 3300050512 nmdc:mga0n895_97_c2 nmdc:mga0n895_97_c2_6084_7286 365
152 3300050513 nmdc:mga0rr50_20_c1 nmdc:mga0rr50_20_c1_20214_21416 365
153 3300050513 nmdc:mga0rr50_31819_c1 nmdc:mga0rr50_31819_c1_19_1233 365
154 3300050514 nmdc:mga08x19_178_c1 nmdc:mga08x19_178_c1_20031_21233 365
155 3300050515 nmdc:mga0a205_3446_c1 nmdc:mga0a205_3446_c1_3584_4795 365
156 3300005328 Ga0070676_10038590 Ga0070676_100385902 366
157 3300005353 Ga0070669_100060746 Ga0070669_1000607462 366
158 3300005354 Ga0070675_100038954 Ga0070675_1000389542 366
159 3300005355 Ga0070671_100061790 Ga0070671_1000617903 366
160 3300005441 Ga0070700_100079587 Ga0070700_1000795872 366
161 3300005549 Ga0070704_100089098 Ga0070704_1000890982 366
162 3300005843 Ga0068860_100185959 Ga0068860_1001859592 366
163 3300005844 Ga0068862_100046267 Ga0068862_1000462672 366
164 3300006871 Ga0075434_100302637 Ga0075434_1003026371 366
165 3300025893 Ga0207682_10011954 Ga0207682_100119543 366
166 3300025907 Ga0207645_10041479 Ga0207645_100414792 366
167 3300025933 Ga0207706_10066896 Ga0207706_100668962 366
168 3300025937 Ga0207669_10221925 Ga0207669_102219252 366
169 3300025972 Ga0207668_10051113 Ga0207668_100511132 366
170 3300028380 Ga0268265_10084405 Ga0268265_100844052 366
171 3300028381 Ga0268264_10150375 Ga0268264_101503751 366
172 3300050513 nmdc:mga0rr50_223155_c1 nmdc:mga0rr50_223155_c1_86_1258 366
173 3300060353 Ga0501082_0169842 Ga0501082_0169842_530_1711 366
174 3300005468 Ga0070707_100195747 Ga0070707_1001957472 367
175 3300006871 Ga0075434_100005549 Ga0075434_10000554910 367
176 3300007076 Ga0075435_100091312 Ga0075435_1000913122 367
177 3300009147 Ga0114129_10108011 Ga0114129_101080112 367
178 3300026118 Ga0207675_100030251 Ga0207675_1000302513 367
179 3300050512 nmdc:mga0n895_3356_c1 nmdc:mga0n895_3356_c1_244_1446 367
180 3300050513 nmdc:mga0rr50_42681_c1 nmdc:mga0rr50_42681_c1_284_1486 367
181 3300050513 nmdc:mga0rr50_43911_c1 nmdc:mga0rr50_43911_c1_365_1549 367
182 3300050514 nmdc:mga08x19_41524_c1 nmdc:mga08x19_41524_c1_36_1238 367
183 3300005549 Ga0070704_100103135 Ga0070704_1001031352 368
184 3300007076 Ga0075435_100149449 Ga0075435_1001494492 369
185 3300049743 Ga0501081_0177963 Ga0501081_0177963_298_1509 369
186 3300049744 Ga0501083_0149519 Ga0501083_0149519_11_1129 369
187 3300050507 nmdc:mga05p37_200269_c1 nmdc:mga05p37_200269_c1_152_1348 369
188 3300005367 Ga0070667_100072801 Ga0070667_1000728012 370
189 3300005843 Ga0068860_100061312 Ga0068860_1000613122 370
190 3300009147 Ga0114129_10036366 Ga0114129_100363662 370
191 3300009147 Ga0114129_10112109 Ga0114129_101121093 370
192 3300009177 Ga0105248_10033764 Ga0105248_100337644 370
193 3300013308 Ga0157375_10028668 Ga0157375_100286683 370
194 3300014968 Ga0157379_10044495 Ga0157379_100444953 370
195 3300031548 Ga0307408_100014908 Ga0307408_1000149083 370
196 3300050507 nmdc:mga05p37_34458_c1 nmdc:mga05p37_34458_c1_4295_5482 370
197 3300050512 nmdc:mga0n895_59365_c1 nmdc:mga0n895_59365_c1_114_1322 370
198 3300009553 Ga0105249_10154010 Ga0105249_101540102 371
199 3300014326 Ga0157380_10034162 Ga0157380_100341621 371
200 3300014326 Ga0157380_10051633 Ga0157380_100516332 372
201 3300005445 Ga0070708_100275386 Ga0070708_1002753862 373
202 3300025986 Ga0207658_10053150 Ga0207658_100531503 373
203 3300005468 Ga0070707_100079899 Ga0070707_1000798991 375
204 3300009094 Ga0111539_10115071 Ga0111539_101150713 375
205 3300050511 nmdc:mga08y16_125304_c1 nmdc:mga08y16_125304_c1_550_1830 375
206 3300014968 Ga0157379_10000584 Ga0157379_100005846 376
207 3300031995 Ga0307409_100099475 Ga0307409_1000994751 376
208 3300035692 Ga0373935_0001390 Ga0373935_0001390_9964_11172 376
209 3300035725 Ga0373947_0061983 Ga0373947_0061983_306_1514 376
210 3300046472 Ga0495580_0004341 Ga0495580_0004341_2612_3820 376
211 3300003203 JGI25406J46586_10000491 JGI25406J46586_100004912 377
212 3300005985 Ga0081539_10000093 Ga0081539_10000093139 377
213 3300031731 Ga0307405_10106539 Ga0307405_101065392 377
214 3300032126 Ga0307415_100070606 Ga0307415_1000706062 377
215 3300042131 Ga0450894_001322 Ga0450894_001322_1808_2980 377
216 3300042133 Ga0450896_003414 Ga0450896_003414_696_1868 377
217 3300005617 Ga0068859_100024547 Ga0068859_1000245474 378
218 3300006931 Ga0097620_100024547 Ga0097620_1000245474 378
219 3300005329 Ga0070683_100136965 Ga0070683_1001369652 379
220 3300009093 Ga0105240_10011792 Ga0105240_100117923 379
221 3300013307 Ga0157372_10140203 Ga0157372_101402032 379
222 3300025922 Ga0207646_10036937 Ga0207646_100369373 380
223 3300032002 Ga0307416_100128625 Ga0307416_1001286252 380
224 3300005290 Ga0065712_10026676 Ga0065712_100266761 381
225 3300031903 Ga0307407_10164637 Ga0307407_101646372 381
226 3300031995 Ga0307409_100043912 Ga0307409_1000439121 381
227 3300035170 Ga0373943_0014143 Ga0373943_0014143_604_1755 383
228 3300035725 Ga0373947_0030984 Ga0373947_0030984_107_1258 383
229 3300046455 Ga0495603_0159939 Ga0495603_0159939_34_1251 383
230 3300005345 Ga0070692_10094327 Ga0070692_100943272 384
231 3300005467 Ga0070706_100000101 Ga0070706_10000010177 384
232 3300005467 Ga0070706_100087293 Ga0070706_1000872933 384
233 3300005468 Ga0070707_100014493 Ga0070707_1000144936 384
234 3300005471 Ga0070698_100040293 Ga0070698_1000402933 384
235 3300005518 Ga0070699_100008689 Ga0070699_1000086893 384
236 3300005518 Ga0070699_100093431 Ga0070699_1000934312 384
237 3300005536 Ga0070697_100000189 Ga0070697_10000018912 384
238 3300005549 Ga0070704_100140567 Ga0070704_1001405672 384
239 3300006847 Ga0075431_100011777 Ga0075431_10001177710 384
240 3300009098 Ga0105245_10324095 Ga0105245_103240952 384
241 3300025910 Ga0207684_10000584 Ga0207684_1000058432 384
242 3300025910 Ga0207684_10000607 Ga0207684_1000060727 384
243 3300025922 Ga0207646_10024832 Ga0207646_100248324 384
244 3300049587 Ga0501071_0006201 Ga0501071_0006201_6530_7714 384
245 3300049588 Ga0501072_0010004 Ga0501072_0010004_5498_6682 384
246 3300049592 Ga0501076_0171279 Ga0501076_0171279_45_1229 384
247 3300049824 Ga0501045_0002648 Ga0501045_0002648_5401_6585 384
248 3300050510 nmdc:mga06r32_134482_c1 nmdc:mga06r32_134482_c1_114_1391 384
249 3300059421 Ga0590071_000249 Ga0590071_000249_557_1741 384
250 3300005336 Ga0070680_100041031 Ga0070680_1000410313 385
251 3300005458 Ga0070681_10019500 Ga0070681_100195005 385
252 3300005530 Ga0070679_100022602 Ga0070679_1000226023 385
253 3300009545 Ga0105237_10176890 Ga0105237_101768902 385
254 3300025912 Ga0207707_10039875 Ga0207707_100398753 385
255 3300025914 Ga0207671_10111125 Ga0207671_101111252 385
256 3300025917 Ga0207660_10029026 Ga0207660_100290262 385
257 3300025921 Ga0207652_10038008 Ga0207652_100380082 385
258 3300031911 Ga0307412_10080319 Ga0307412_100803192 385
259 3300031995 Ga0307409_100169240 Ga0307409_1001692401 385
260 3300032002 Ga0307416_100019816 Ga0307416_1000198164 385
261 3300032005 Ga0307411_10022704 Ga0307411_100227042 385
262 3300032126 Ga0307415_100155516 Ga0307415_1001555162 385
263 3300036712 Ga0316584_0062827 Ga0316584_0062827_85_1296 385
264 3300044673 Ga0453683_0101290 Ga0453683_0101290_291_1454 385
265 3300005331 Ga0070670_100098815 Ga0070670_1000988152 386
266 3300005333 Ga0070677_10005129 Ga0070677_100051292 386
267 3300005334 Ga0068869_100222030 Ga0068869_1002220301 386
268 3300005355 Ga0070671_100064146 Ga0070671_1000641462 386
269 3300005356 Ga0070674_100045893 Ga0070674_1000458932 386
270 3300005456 Ga0070678_100028953 Ga0070678_1000289532 386
271 3300005546 Ga0070696_100058504 Ga0070696_1000585043 386
272 3300005548 Ga0070665_100033210 Ga0070665_1000332102 386
273 3300014969 Ga0157376_10124749 Ga0157376_101247492 386
274 3300025893 Ga0207682_10015468 Ga0207682_100154683 386
275 3300025925 Ga0207650_10180756 Ga0207650_101807562 386
276 3300025937 Ga0207669_10062920 Ga0207669_100629202 386
277 3300025937 Ga0207669_10093624 Ga0207669_100936242 386
278 3300026116 Ga0207674_10102743 Ga0207674_101027431 386
279 3300026121 Ga0207683_10078339 Ga0207683_100783392 386
280 3300026121 Ga0207683_10135318 Ga0207683_101353182 386
281 3300028379 Ga0268266_10059104 Ga0268266_100591043 386
282 3300045976 Ga0466967_0120944 Ga0466967_0120944_452_1612 386
283 3300046472 Ga0495580_0085690 Ga0495580_0085690_509_1726 386
284 3300048905 Ga0496102_0297390 Ga0496102_0297390_129_1295 386
285 3300048911 Ga0496108_0148650 Ga0496108_0148650_728_1894 386
286 3300048913 Ga0496110_0159285 Ga0496110_0159285_842_2008 386
287 3300005328 Ga0070676_10021642 Ga0070676_100216422 387
288 3300005331 Ga0070670_100014348 Ga0070670_1000143487 387
289 3300005340 Ga0070689_100199512 Ga0070689_1001995122 387
290 3300005353 Ga0070669_100168146 Ga0070669_1001681462 387
291 3300005354 Ga0070675_100223235 Ga0070675_1002232351 387
292 3300005356 Ga0070674_100153363 Ga0070674_1001533631 387
293 3300005364 Ga0070673_100000282 Ga0070673_10000028220 387
294 3300005367 Ga0070667_100013136 Ga0070667_1000131367 387
295 3300005435 Ga0070714_100020682 Ga0070714_1000206825 387
296 3300005456 Ga0070678_100002631 Ga0070678_1000026313 387
297 3300005458 Ga0070681_10108226 Ga0070681_101082262 387
298 3300005459 Ga0068867_100065776 Ga0068867_1000657761 387
299 3300005543 Ga0070672_100029894 Ga0070672_1000298944 387
300 3300005578 Ga0068854_100050997 Ga0068854_1000509972 387
301 3300006051 Ga0075364_10047399 Ga0075364_100473993 387
302 3300006177 Ga0075362_10000421 Ga0075362_100004214 387
303 3300006178 Ga0075367_10003356 Ga0075367_100033563 387
304 3300006195 Ga0075366_10013364 Ga0075366_100133642 387
305 3300006237 Ga0097621_100013417 Ga0097621_1000134177 387
306 3300006353 Ga0075370_10006888 Ga0075370_100068882 387
307 3300006358 Ga0068871_100005279 Ga0068871_1000052797 387
308 3300009094 Ga0111539_10000059 Ga0111539_1000005950 387
309 3300009553 Ga0105249_10153421 Ga0105249_101534213 387
310 3300013297 Ga0157378_10000578 Ga0157378_1000057813 387
311 3300013308 Ga0157375_10002741 Ga0157375_100027417 387
312 3300025903 Ga0207680_10004015 Ga0207680_100040156 387
313 3300025912 Ga0207707_10036870 Ga0207707_100368703 387
314 3300025925 Ga0207650_10030010 Ga0207650_100300104 387
315 3300025929 Ga0207664_10177549 Ga0207664_101775492 387
316 3300025931 Ga0207644_10022378 Ga0207644_100223782 387
317 3300025937 Ga0207669_10046761 Ga0207669_100467613 387
318 3300025940 Ga0207691_10000274 Ga0207691_1000027453 387
319 3300025960 Ga0207651_10000358 Ga0207651_1000035819 387
320 3300026121 Ga0207683_10000220 Ga0207683_100002208 387
321 3300027907 Ga0207428_10010107 Ga0207428_100101076 387
322 3300031548 Ga0307408_100048714 Ga0307408_1000487142 387
323 3300031911 Ga0307412_10257282 Ga0307412_102572821 387
324 3300031995 Ga0307409_100015060 Ga0307409_1000150603 387
325 3300032002 Ga0307416_100042086 Ga0307416_1000420865 387
326 3300032004 Ga0307414_10294894 Ga0307414_102948942 387
327 3300032005 Ga0307411_10040453 Ga0307411_100404532 387
328 3300032126 Ga0307415_100033261 Ga0307415_1000332612 387
329 3300032126 Ga0307415_100059500 Ga0307415_1000595001 387
330 3300048907 Ga0496104_0217815 Ga0496104_0217815_418_1599 387
331 3300048913 Ga0496110_0277894 Ga0496110_0277894_61_1242 387
332 3300048917 Ga0496114_0002337 Ga0496114_0002337_13236_14417 387
333 3300049824 Ga0501045_0193451 Ga0501045_0193451_163_1386 387
334 3300050489 nmdc:mga03683_600_c2 nmdc:mga03683_600_c2_2207_3370 387
335 3300050491 nmdc:mga00v17_23721_c1 nmdc:mga00v17_23721_c1_1730_2893 387
336 3300050491 nmdc:mga00v17_4143_c1 nmdc:mga00v17_4143_c1_1590_2753 387
337 3300050492 nmdc:mga0yw44_61194_c1 nmdc:mga0yw44_61194_c1_325_1488 387
338 3300050493 nmdc:mga0k408_4679_c1 nmdc:mga0k408_4679_c1_1958_3121 387
339 3300050510 nmdc:mga06r32_90676_c1 nmdc:mga06r32_90676_c1_1309_2511 387
340 3300050511 nmdc:mga08y16_1066_c1 nmdc:mga08y16_1066_c1_16837_18072 387
341 3300059421 Ga0590071_009311 Ga0590071_009311_947_2110 387
342 3300005339 Ga0070660_100088263 Ga0070660_1000882632 388
343 3300005340 Ga0070689_100069246 Ga0070689_1000692462 388
344 3300005435 Ga0070714_100347481 Ga0070714_1003474811 388
345 3300006237 Ga0097621_100040296 Ga0097621_1000402963 388
346 3300006844 Ga0075428_100032730 Ga0075428_1000327305 388
347 3300009093 Ga0105240_10034088 Ga0105240_100340886 388
348 3300009093 Ga0105240_10180230 Ga0105240_101802301 388
349 3300009094 Ga0111539_10164168 Ga0111539_101641681 388
350 3300013297 Ga0157378_10023338 Ga0157378_100233383 388
351 3300025913 Ga0207695_10136275 Ga0207695_101362752 388
352 3300025919 Ga0207657_10114870 Ga0207657_101148702 388
353 3300031548 Ga0307408_100017734 Ga0307408_1000177343 388
354 3300031903 Ga0307407_10083699 Ga0307407_100836992 388
355 3300032126 Ga0307415_100036207 Ga0307415_1000362072 388
356 3300048915 Ga0496112_0091338 Ga0496112_0091338_1477_2664 388
357 3300049587 Ga0501071_0022296 Ga0501071_0022296_1361_2527 388
358 3300049588 Ga0501072_0048095 Ga0501072_0048095_382_1548 388
359 3300049592 Ga0501076_0164356 Ga0501076_0164356_198_1364 388
360 3300059421 Ga0590071_006188 Ga0590071_006188_1593_2759 388
361 3300005290 Ga0065712_10142213 Ga0065712_101422131 389
362 3300005293 Ga0065715_10118756 Ga0065715_101187562 389
363 3300005295 Ga0065707_10001449 Ga0065707_1000144911 389
364 3300005329 Ga0070683_100000702 Ga0070683_10000070210 389
365 3300005331 Ga0070670_100187951 Ga0070670_1001879512 389
366 3300005535 Ga0070684_100000068 Ga0070684_10000006829 389
367 3300005547 Ga0070693_100047782 Ga0070693_1000477822 389
368 3300005549 Ga0070704_100146319 Ga0070704_1001463192 389
369 3300005564 Ga0070664_100008127 Ga0070664_1000081277 389
370 3300005842 Ga0068858_100180904 Ga0068858_1001809042 389
371 3300005844 Ga0068862_100016452 Ga0068862_1000164526 389
372 3300005937 Ga0081455_10102180 Ga0081455_101021802 389
373 3300009101 Ga0105247_10040093 Ga0105247_100400931 389
374 3300009177 Ga0105248_10014318 Ga0105248_100143187 389
375 3300013296 Ga0157374_10305188 Ga0157374_103051881 389
376 3300014325 Ga0163163_10023177 Ga0163163_100231772 389
377 3300014326 Ga0157380_10065967 Ga0157380_100659672 389
378 3300014968 Ga0157379_10018346 Ga0157379_100183465 389
379 3300025920 Ga0207649_10022407 Ga0207649_100224072 389
380 3300025925 Ga0207650_10008008 Ga0207650_100080085 389
381 3300025940 Ga0207691_10022903 Ga0207691_100229036 389
382 3300025941 Ga0207711_10042071 Ga0207711_100420712 389
383 3300025941 Ga0207711_10073136 Ga0207711_100731362 389
384 3300025944 Ga0207661_10002311 Ga0207661_1000231110 389
385 3300025945 Ga0207679_10002489 Ga0207679_100024893 389
386 3300026035 Ga0207703_10136597 Ga0207703_101365972 389
387 3300028380 Ga0268265_10048093 Ga0268265_100480933 389
388 3300031548 Ga0307408_100028574 Ga0307408_1000285743 389
389 3300031548 Ga0307408_100174714 Ga0307408_1001747142 389
390 3300032002 Ga0307416_100051044 Ga0307416_1000510441 389
391 3300032002 Ga0307416_100248288 Ga0307416_1002482882 389
392 3300039093 Ga0400489_79885 Ga0400489_79885_377_1582 389
393 3300042156 Ga0439446_0005503 Ga0439446_0005503_375_1568 389
394 3300045051 Ga0451576_0295006 Ga0451576_0295006_51_1241 389
395 3300048907 Ga0496104_0005196 Ga0496104_0005196_2348_3520 389
396 3300048911 Ga0496108_0021614 Ga0496108_0021614_3755_4927 389
397 3300048912 Ga0496109_0001290 Ga0496109_0001290_8670_9842 389
398 3300048913 Ga0496110_0008036 Ga0496110_0008036_5063_6235 389
399 3300048915 Ga0496112_0027070 Ga0496112_0027070_617_1786 389
400 3300049576 Ga0501040_0201607 Ga0501040_0201607_226_1395 389
401 3300049587 Ga0501071_0016739 Ga0501071_0016739_2645_3814 389
402 3300049590 Ga0501074_0111236 Ga0501074_0111236_486_1655 389
403 3300049741 Ga0501079_0007892 Ga0501079_0007892_4294_5463 389
404 3300049742 Ga0501080_0055210 Ga0501080_0055210_1711_2880 389
405 3300049743 Ga0501081_0160036 Ga0501081_0160036_143_1312 389
406 3300049824 Ga0501045_0007195 Ga0501045_0007195_5181_6350 389
407 3300050515 nmdc:mga0a205_249232_c1 nmdc:mga0a205_249232_c1_108_1277 389
408 3300053085 Ga0495619_0081819 Ga0495619_0081819_191_1360 389
409 3300054114 Ga0501084_0004142 Ga0501084_0004142_1081_2250 389
410 3300059421 Ga0590071_000772 Ga0590071_000772_4904_6073 389
411 3300059424 Ga0590075_001822 Ga0590075_001822_543_1712 389
412 3300059426 Ga0590077_002482 Ga0590077_002482_1551_2720 389
413 3300060353 Ga0501082_0040443 Ga0501082_0040443_92_1261 389
414 3300061734 Ga0530510_0001387 Ga0530510_0001387_7405_8574 389
415 3300005290 Ga0065712_10020821 Ga0065712_100208212 390
416 3300005331 Ga0070670_100003306 Ga0070670_1000033063 390
417 3300005365 Ga0070688_100029128 Ga0070688_1000291283 390
418 3300006844 Ga0075428_100414895 Ga0075428_1004148951 390
419 3300006871 Ga0075434_100010893 Ga0075434_10001089311 390
420 3300006880 Ga0075429_100093444 Ga0075429_1000934442 390
421 3300009094 Ga0111539_10047449 Ga0111539_100474491 390
422 3300009094 Ga0111539_10137313 Ga0111539_101373132 390
423 3300009553 Ga0105249_10232698 Ga0105249_102326982 390
424 3300013104 Ga0157370_10278479 Ga0157370_102784791 390
425 3300025912 Ga0207707_10230432 Ga0207707_102304321 390
426 3300025922 Ga0207646_10036794 Ga0207646_100367944 390
427 3300025937 Ga0207669_10015080 Ga0207669_100150803 390
428 3300026067 Ga0207678_10030823 Ga0207678_100308234 390
429 3300027876 Ga0209974_10014515 Ga0209974_100145154 390
430 3300031995 Ga0307409_100146814 Ga0307409_1001468142 390
431 3300032005 Ga0307411_10013487 Ga0307411_100134873 390
432 3300042008 Ga0439450_011231 Ga0439450_011231_314_1504 390
433 3300048904 Ga0496101_0064748 Ga0496101_0064748_158_1342 390
434 3300048917 Ga0496114_0211738 Ga0496114_0211738_228_1412 390
435 3300050507 nmdc:mga05p37_580882_c1 nmdc:mga05p37_580882_c1_37_1218 390
436 3300050511 nmdc:mga08y16_282095_c1 nmdc:mga08y16_282095_c1_234_1451 390
437 3300050512 nmdc:mga0n895_2150_c1 nmdc:mga0n895_2150_c1_133_1305 390
438 3300050515 nmdc:mga0a205_138041_c1 nmdc:mga0a205_138041_c1_599_1771 390
439 3300005295 Ga0065707_10009013 Ga0065707_100090133 391
440 3300005577 Ga0068857_100050996 Ga0068857_1000509963 391
441 3300005617 Ga0068859_100227254 Ga0068859_1002272542 391
442 3300005842 Ga0068858_100005453 Ga0068858_1000054534 391
443 3300005937 Ga0081455_10013648 Ga0081455_100136484 391
444 3300005981 Ga0081538_10001528 Ga0081538_1000152814 391
445 3300005981 Ga0081538_10058983 Ga0081538_100589832 391
446 3300006844 Ga0075428_100000080 Ga0075428_10000008010 391
447 3300006846 Ga0075430_100002473 Ga0075430_10000247310 391
448 3300006846 Ga0075430_100078679 Ga0075430_1000786792 391
449 3300006847 Ga0075431_100002515 Ga0075431_10000251515 391
450 3300006847 Ga0075431_100133808 Ga0075431_1001338081 391
451 3300006871 Ga0075434_100162802 Ga0075434_1001628022 391
452 3300006880 Ga0075429_100000156 Ga0075429_10000015617 391
453 3300006880 Ga0075429_100001098 Ga0075429_10000109819 391
454 3300006931 Ga0097620_100227264 Ga0097620_1002272642 391
455 3300007076 Ga0075435_100030102 Ga0075435_1000301023 391
456 3300009094 Ga0111539_10000181 Ga0111539_100001814 391
457 3300009094 Ga0111539_10009783 Ga0111539_100097836 391
458 3300009101 Ga0105247_10031210 Ga0105247_100312104 391
459 3300009147 Ga0114129_10000077 Ga0114129_1000007763 391
460 3300014968 Ga0157379_10017975 Ga0157379_100179754 391
461 3300025926 Ga0207659_10096939 Ga0207659_100969392 391
462 3300026035 Ga0207703_10021562 Ga0207703_100215624 391
463 3300027907 Ga0207428_10000558 Ga0207428_1000055810 391
464 3300028381 Ga0268264_10222629 Ga0268264_102226292 391
465 3300031727 Ga0316576_10001732 Ga0316576_100017323 391
466 3300031727 Ga0316576_10012676 Ga0316576_100126763 391
467 3300031727 Ga0316576_10079178 Ga0316576_100791783 391
468 3300031727 Ga0316576_10097215 Ga0316576_100972151 391
469 3300031728 Ga0316578_10039372 Ga0316578_100393722 391
470 3300031728 Ga0316578_10045731 Ga0316578_100457312 391
471 3300031901 Ga0307406_10060683 Ga0307406_100606832 391
472 3300032002 Ga0307416_100164779 Ga0307416_1001647791 391
473 3300032137 Ga0316585_10003409 Ga0316585_100034091 391
474 3300035398 Ga0316574_0005798 Ga0316574_0005798_235_1446 391
475 3300036712 Ga0316584_0147689 Ga0316584_0147689_229_1440 391
476 3300049572 Ga0501036_0156172 Ga0501036_0156172_505_1680 391
477 3300049661 Ga0501217_028030 Ga0501217_028030_172_1347 391
478 3300050507 nmdc:mga05p37_1796_c1 nmdc:mga05p37_1796_c1_18195_19442 391
479 3300050508 nmdc:mga09592_3401_c1 nmdc:mga09592_3401_c1_6451_7698 391
480 3300050508 nmdc:mga09592_4431_c1 nmdc:mga09592_4431_c1_2706_3881 391
481 3300050509 nmdc:mga0qj67_4824_c1 nmdc:mga0qj67_4824_c1_5072_6319 391
482 3300050510 nmdc:mga06r32_6534_c1 nmdc:mga06r32_6534_c1_2492_3739 391
483 3300050510 nmdc:mga06r32_77179_c1 nmdc:mga06r32_77179_c1_322_1497 391
484 3300005329 Ga0070683_100119518 Ga0070683_1001195182 392
485 3300005354 Ga0070675_100000202 Ga0070675_10000020232 392
486 3300005530 Ga0070679_100174362 Ga0070679_1001743622 392
487 3300005535 Ga0070684_100009549 Ga0070684_1000095498 392
488 3300005617 Ga0068859_100328683 Ga0068859_1003286832 392
489 3300006038 Ga0075365_10007190 Ga0075365_100071905 392
490 3300006237 Ga0097621_100000477 Ga0097621_1000004779 392
491 3300006358 Ga0068871_100012430 Ga0068871_1000124305 392
492 3300006931 Ga0097620_100328726 Ga0097620_1003287262 392
493 3300009094 Ga0111539_10145053 Ga0111539_101450532 392
494 3300009147 Ga0114129_10009067 Ga0114129_1000906712 392
495 3300025921 Ga0207652_10210762 Ga0207652_102107622 392
496 3300025926 Ga0207659_10000076 Ga0207659_1000007615 392
497 3300025944 Ga0207661_10031293 Ga0207661_100312935 392
498 3300027907 Ga0207428_10113132 Ga0207428_101131321 392
499 3300027907 Ga0207428_10130250 Ga0207428_101302502 392
500 3300028379 Ga0268266_10189584 Ga0268266_101895841 392
501 3300046472 Ga0495580_0168405 Ga0495580_0168405_309_1493 392
502 3300050492 nmdc:mga0yw44_4147_c1 nmdc:mga0yw44_4147_c1_522_1700 392
503 3300050507 nmdc:mga05p37_4142_c1 nmdc:mga05p37_4142_c1_14597_15835 392
504 3300050510 nmdc:mga06r32_23254_c1 nmdc:mga06r32_23254_c1_2227_3465 392
505 3300050511 nmdc:mga08y16_108938_c1 nmdc:mga08y16_108938_c1_956_2200 392
506 3300002459 JGI24751J29686_10002791 JGI24751J29686_100027913 393
507 3300005293 Ga0065715_10094271 Ga0065715_100942712 393
508 3300005295 Ga0065707_10006518 Ga0065707_100065182 393
509 3300005331 Ga0070670_100078964 Ga0070670_1000789643 393
510 3300005335 Ga0070666_10126739 Ga0070666_101267392 393
511 3300005338 Ga0068868_100095107 Ga0068868_1000951072 393
512 3300005340 Ga0070689_100132421 Ga0070689_1001324212 393
513 3300005364 Ga0070673_100002528 Ga0070673_1000025283 393
514 3300005365 Ga0070688_100115143 Ga0070688_1001151432 393
515 3300005441 Ga0070700_100095906 Ga0070700_1000959062 393
516 3300005441 Ga0070700_100125087 Ga0070700_1001250872 393
517 3300005444 Ga0070694_100010880 Ga0070694_1000108803 393
518 3300005444 Ga0070694_100079292 Ga0070694_1000792922 393
519 3300005445 Ga0070708_100075792 Ga0070708_1000757923 393
520 3300005457 Ga0070662_100223431 Ga0070662_1002234311 393
521 3300005468 Ga0070707_100058637 Ga0070707_1000586375 393
522 3300005471 Ga0070698_100029348 Ga0070698_1000293482 393
523 3300005518 Ga0070699_100003668 Ga0070699_10000366811 393
524 3300005518 Ga0070699_100030443 Ga0070699_1000304434 393
525 3300005518 Ga0070699_100172458 Ga0070699_1001724582 393
526 3300005536 Ga0070697_100189167 Ga0070697_1001891672 393
527 3300005545 Ga0070695_100000785 Ga0070695_10000078514 393
528 3300005545 Ga0070695_100014083 Ga0070695_1000140832 393
529 3300005546 Ga0070696_100078877 Ga0070696_1000788772 393
530 3300005546 Ga0070696_100125583 Ga0070696_1001255832 393
531 3300005548 Ga0070665_100006386 Ga0070665_1000063869 393
532 3300005548 Ga0070665_100008967 Ga0070665_1000089673 393
533 3300005549 Ga0070704_100001151 Ga0070704_10000115112 393
534 3300005617 Ga0068859_100005666 Ga0068859_10000566614 393
535 3300005617 Ga0068859_100266819 Ga0068859_1002668192 393
536 3300005618 Ga0068864_100006553 Ga0068864_1000065535 393
537 3300005841 Ga0068863_100140256 Ga0068863_1001402562 393
538 3300005842 Ga0068858_100013146 Ga0068858_1000131467 393
539 3300005844 Ga0068862_100323912 Ga0068862_1003239122 393
540 3300005937 Ga0081455_10116831 Ga0081455_101168312 393
541 3300006237 Ga0097621_100002349 Ga0097621_1000023495 393
542 3300006237 Ga0097621_100192429 Ga0097621_1001924292 393
543 3300006844 Ga0075428_100131866 Ga0075428_1001318662 393
544 3300006852 Ga0075433_10129598 Ga0075433_101295982 393
545 3300006880 Ga0075429_100050306 Ga0075429_1000503064 393
546 3300006881 Ga0068865_100008148 Ga0068865_1000081487 393
547 3300006914 Ga0075436_100007582 Ga0075436_1000075822 393
548 3300006931 Ga0097620_100005666 Ga0097620_1000056662 393
549 3300006931 Ga0097620_100266820 Ga0097620_1002668202 393
550 3300007076 Ga0075435_100036648 Ga0075435_1000366484 393
551 3300009094 Ga0111539_10000209 Ga0111539_1000020930 393
552 3300009094 Ga0111539_10002429 Ga0111539_1000242917 393
553 3300009101 Ga0105247_10019812 Ga0105247_100198122 393
554 3300009147 Ga0114129_10043732 Ga0114129_100437322 393
555 3300009147 Ga0114129_10106350 Ga0114129_101063502 393
556 3300009176 Ga0105242_10003632 Ga0105242_100036329 393
557 3300009177 Ga0105248_10004014 Ga0105248_1000401415 393
558 3300009177 Ga0105248_10023744 Ga0105248_100237442 393
559 3300009177 Ga0105248_10043896 Ga0105248_100438963 393
560 3300009177 Ga0105248_10317020 Ga0105248_103170202 393
561 3300013296 Ga0157374_10128612 Ga0157374_101286122 393
562 3300013308 Ga0157375_10132350 Ga0157375_101323502 393
563 3300013308 Ga0157375_10218723 Ga0157375_102187232 393
564 3300014325 Ga0163163_10010892 Ga0163163_100108925 393
565 3300014325 Ga0163163_10013097 Ga0163163_100130975 393
566 3300014326 Ga0157380_10114672 Ga0157380_101146722 393
567 3300014968 Ga0157379_10021777 Ga0157379_100217776 393
568 3300014968 Ga0157379_10171473 Ga0157379_101714732 393
569 3300014969 Ga0157376_10019378 Ga0157376_100193782 393
570 3300014969 Ga0157376_10034338 Ga0157376_100343383 393
571 3300025903 Ga0207680_10041021 Ga0207680_100410212 393
572 3300025906 Ga0207699_10077698 Ga0207699_100776982 393
573 3300025910 Ga0207684_10214483 Ga0207684_102144832 393
574 3300025918 Ga0207662_10064804 Ga0207662_100648042 393
575 3300025923 Ga0207681_10019225 Ga0207681_100192252 393
576 3300025925 Ga0207650_10188207 Ga0207650_101882071 393
577 3300025933 Ga0207706_10084052 Ga0207706_100840522 393
578 3300025933 Ga0207706_10099614 Ga0207706_100996144 393
579 3300025936 Ga0207670_10131699 Ga0207670_101316992 393
580 3300025941 Ga0207711_10016158 Ga0207711_100161582 393
581 3300025941 Ga0207711_10091941 Ga0207711_100919412 393
582 3300025941 Ga0207711_10114557 Ga0207711_101145572 393
583 3300025945 Ga0207679_10193752 Ga0207679_101937522 393
584 3300025981 Ga0207640_10040545 Ga0207640_100405452 393
585 3300026023 Ga0207677_10038536 Ga0207677_100385362 393
586 3300026023 Ga0207677_10098597 Ga0207677_100985971 393
587 3300026088 Ga0207641_10099587 Ga0207641_100995872 393
588 3300026088 Ga0207641_10188514 Ga0207641_101885142 393
589 3300026095 Ga0207676_10090218 Ga0207676_100902182 393
590 3300026095 Ga0207676_10139761 Ga0207676_101397612 393
591 3300026118 Ga0207675_100015621 Ga0207675_1000156212 393
592 3300026118 Ga0207675_100044375 Ga0207675_1000443754 393
593 3300027907 Ga0207428_10000022 Ga0207428_1000002230 393
594 3300027907 Ga0207428_10215065 Ga0207428_102150652 393
595 3300028379 Ga0268266_10003789 Ga0268266_100037894 393
596 3300028380 Ga0268265_10015893 Ga0268265_100158932 393
597 3300028381 Ga0268264_10183526 Ga0268264_101835262 393
598 3300031824 Ga0307413_10011324 Ga0307413_100113242 393
599 3300031852 Ga0307410_10015511 Ga0307410_100155113 393
600 3300031901 Ga0307406_10006061 Ga0307406_100060615 393
601 3300031911 Ga0307412_10056975 Ga0307412_100569752 393
602 3300031995 Ga0307409_100001383 Ga0307409_1000013839 393
603 3300032002 Ga0307416_100225817 Ga0307416_1002258171 393
604 3300032004 Ga0307414_10003946 Ga0307414_100039466 393
605 3300032126 Ga0307415_100152678 Ga0307415_1001526782 393
606 3300035695 Ga0373927_0195421 Ga0373927_0195421_94_1284 393
607 3300035725 Ga0373947_0019793 Ga0373947_0019793_1614_2804 393
608 3300036401 Ga0373937_0113098 Ga0373937_0113098_978_2168 393
609 3300036401 Ga0373937_0130401 Ga0373937_0130401_408_1604 393
610 3300036401 Ga0373937_0324798 Ga0373937_0324798_50_1261 393
611 3300038443 Ga0395901_0138426 Ga0395901_0138426_1082_2266 393
612 3300046454 Ga0495592_0047193 Ga0495592_0047193_167_1363 393
613 3300046455 Ga0495603_0077086 Ga0495603_0077086_381_1592 393
614 3300046459 Ga0495629_0138722 Ga0495629_0138722_206_1417 393
615 3300046473 Ga0495582_0142071 Ga0495582_0142071_56_1267 393
616 3300046477 Ga0495664_0046084 Ga0495664_0046084_841_2037 393
617 3300046477 Ga0495664_0059719 Ga0495664_0059719_359_1570 393
618 3300046511 Ga0495608_0011561 Ga0495608_0011561_2741_3937 393
619 3300046516 Ga0495628_0172061 Ga0495628_0172061_406_1617 393
620 3300046529 Ga0495652_0118392 Ga0495652_0118392_230_1426 393
621 3300046543 Ga0495645_0007653 Ga0495645_0007653_1413_2624 393
622 3300046543 Ga0495645_0076832 Ga0495645_0076832_637_1833 393
623 3300046681 Ga0495647_0042692 Ga0495647_0042692_11_1222 393
624 3300046683 Ga0495658_0022670 Ga0495658_0022670_351_1562 393
625 3300046683 Ga0495658_0085015 Ga0495658_0085015_609_1829 393
626 3300046684 Ga0495669_0000990 Ga0495669_0000990_6259_7455 393
627 3300046689 Ga0495613_0004695 Ga0495613_0004695_6801_7997 393
628 3300047317 Ga0495604_0017283 Ga0495604_0017283_4113_5309 393
629 3300047319 Ga0495674_0029729 Ga0495674_0029729_1670_2866 393
630 3300047319 Ga0495674_0172636 Ga0495674_0172636_32_1243 393
631 3300047471 Ga0495684_0000228 Ga0495684_0000228_1866_3062 393
632 3300048907 Ga0496104_0069587 Ga0496104_0069587_986_2197 393
633 3300048907 Ga0496104_0084489 Ga0496104_0084489_1646_2857 393
634 3300048907 Ga0496104_0109714 Ga0496104_0109714_22_1233 393
635 3300048917 Ga0496114_0109399 Ga0496114_0109399_1010_2221 393
636 3300048918 Ga0496115_0012077 Ga0496115_0012077_2462_3673 393
637 3300049568 Ga0501031_0040726 Ga0501031_0040726_428_1615 393
638 3300049572 Ga0501036_0030546 Ga0501036_0030546_1703_2899 393
639 3300049572 Ga0501036_0279895 Ga0501036_0279895_120_1307 393
640 3300049573 Ga0501037_0119167 Ga0501037_0119167_158_1345 393
641 3300049576 Ga0501040_0004841 Ga0501040_0004841_5381_6577 393
642 3300049577 Ga0501041_0002942 Ga0501041_0002942_1809_3005 393
643 3300049582 Ga0501048_0013517 Ga0501048_0013517_3907_5103 393
644 3300049582 Ga0501048_0042667 Ga0501048_0042667_546_1733 393
645 3300049587 Ga0501071_0019329 Ga0501071_0019329_2396_3592 393
646 3300049588 Ga0501072_0017543 Ga0501072_0017543_3393_4589 393
647 3300049588 Ga0501072_0030128 Ga0501072_0030128_990_2177 393
648 3300049590 Ga0501074_0087231 Ga0501074_0087231_638_1825 393
649 3300049591 Ga0501075_0079644 Ga0501075_0079644_16_1203 393
650 3300049592 Ga0501076_0026029 Ga0501076_0026029_1932_3128 393
651 3300049741 Ga0501079_0029175 Ga0501079_0029175_2150_3346 393
652 3300049743 Ga0501081_0000406 Ga0501081_0000406_20494_21690 393
653 3300049822 Ga0501035_0076370 Ga0501035_0076370_208_1404 393
654 3300049824 Ga0501045_0011015 Ga0501045_0011015_298_1485 393
655 3300050507 nmdc:mga05p37_121506_c1 nmdc:mga05p37_121506_c1_1242_2453 393
656 3300050507 nmdc:mga05p37_235500_c1 nmdc:mga05p37_235500_c1_275_1510 393
657 3300050507 nmdc:mga05p37_2819_c1 nmdc:mga05p37_2819_c1_6901_8091 393
658 3300050511 nmdc:mga08y16_21_c1 nmdc:mga08y16_21_c1_222907_224097 393
659 3300050513 nmdc:mga0rr50_41109_c1 nmdc:mga0rr50_41109_c1_2050_3252 393
660 3300050513 nmdc:mga0rr50_62346_c1 nmdc:mga0rr50_62346_c1_1573_2769 393
661 3300050515 nmdc:mga0a205_41616_c1 nmdc:mga0a205_41616_c1_2174_3364 393
662 3300053085 Ga0495619_0000422 Ga0495619_0000422_8008_9204 393
663 3300053085 Ga0495619_0038606 Ga0495619_0038606_303_1514 393
664 3300054114 Ga0501084_0004916 Ga0501084_0004916_632_1828 393
665 3300059423 Ga0590074_000326 Ga0590074_000326_2489_3700 393
666 3300059424 Ga0590075_000576 Ga0590075_000576_6542_7753 393
667 3300059426 Ga0590077_000087 Ga0590077_000087_1764_2975 393
668 3300060353 Ga0501082_0001528 Ga0501082_0001528_1844_3040 393
669 3300060353 Ga0501082_0013241 Ga0501082_0013241_34_1221 393
670 3300061734 Ga0530510_0036178 Ga0530510_0036178_1731_2927 393

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02568

ThiI

Thiamine biosynthesis protein (ThiI)

213

409

0.98

PF22025

ThiI_fer

ThiI ferredoxin-like domain

3

63

0.92

PF02926

THUMP

THUMP domain

122

201

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kr7-assembly1.cif.gz_A crystal structure of a 4-thiouridine synthetase - rna complex with bound atp 0.9154 1 384
2c5s-assembly1.cif.gz_A-2 crystal structure of bacillus anthracis thii, a trna-modifying enzyme containing the predicted rna-binding thump domain 0.9103 1 385
4kr7-assembly1.cif.gz_A crystal structure of a 4-thiouridine synthetase - rna complex with bound atp 0.9086 1 384
2c5s-assembly1.cif.gz_A-2 crystal structure of bacillus anthracis thii, a trna-modifying enzyme containing the predicted rna-binding thump domain 0.9033 1 385
1vbk-assembly1.cif.gz_B crystal structure of ph1313 from pyrococcus horikoshii ot3 0.8362 1 328
ID Description Score Start End Superfamily
af_Q2FXL1_175_403_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9641 171 390 3.40.50.620
4kr9B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9626 171 384 3.40.50.620
af_Q58341_186_381_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9508 171 364 3.40.50.620
2c5sA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9475 171 385 3.40.50.620
af_P77718_175_396_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9458 171 382 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A382X7T7-F1-model_v4 Thil AANH domain-containing protein 0.9942 192 387 GO:0002937
GO:0004810
GO:0005524
GO:0005829
GO:0052837
AF-A0A2V6WSR5-F1-model_v4 tRNA 4-thiouridine(8) synthase ThiI 0.9939 162 277 GO:0002937
GO:0004810
GO:0005524
GO:0005829
GO:0052837
AF-A0A1J1EQ10-F1-model_v4 deleted 0.9908 189 387
AF-A0A662PQ11-F1-model_v4 Probable tRNA sulfurtransferase (EC 2.8.1.4) (Sulfur carrier protein ThiS sulfurtransferase) (Thiamine biosynthesis protein ThiI) (tRNA 4-thiouridine synthase) 0.99 175 384 GO:0002937
GO:0004810
GO:0005524
GO:0005829
GO:0009228
GO:0009229
GO:0052837
GO:0140741
AF-A0A6B3H0H0-F1-model_v4 tRNA 4-thiouridine(8) synthase ThiI 0.9877 174 382 GO:0002937
GO:0004810
GO:0005524
GO:0005829
GO:0052837

Feature Viewer

pLDDT pTM Quality
93.5 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map