F474100

General Info

Members Datasets Scaffolds Average Seq Length
670 329 1340 136

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100875419|Ga0307409_1008754192
Length 133
Sequence MILGLGSDTIDIRRIEKTIDRYGERFLNRLFTDIERGKSDRRRDRAASYAKRFAAKEACSKALGTGMHGVAWRDMGVVNLPSGKPTMQLTGKAAERLAAMTPAGHRPQIDISLTDDFPLAQAIVIISAVPDAG

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
162 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
172 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
179 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
180 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
287 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
288 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
289 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
290 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
291 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
292 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
293 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
294 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
295 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
296 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
297 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
298 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
299 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
303 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
304 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
305 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
306 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
307 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
308 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
309 2643221568 Rhizobium sp. Root564 Isolate Unclassified
310 2643221640 Caulobacter sp. Root342 Isolate Unclassified
311 2643221642 Caulobacter sp. Root343 Isolate Unclassified
312 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
313 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
314 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
315 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
316 2849560528 Caulobacter zeae 410 Isolate Unclassified
317 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
318 2851153111 Caulobacter radicis 736 Isolate Unclassified
319 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
320 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
321 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
322 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
323 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
324 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
325 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
326 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
327 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
328 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
329 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.97
Metatranscriptomes 0
Isolates 4.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 2.24
Nodule 0.75
Rhizoplane 6.42
Rhizosphere 87.16
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100875419 3300031995 Bacteria 910
2 MBSR1b_contig_7412730 2162886012 Bacteria 1385
3 ARcpr5yngRDRAFT_c004757 3300000043 Bacteria 1271
4 Ga0065715_10268011 3300005293 Bacteria 1119
5 Ga0070683_100130330 3300005329 Bacteria 2380
6 Ga0070683_102056422 3300005329 Bacteria 549
7 Ga0070690_101176865 3300005330 Bacteria 611
8 Ga0070666_10061030 3300005335 Bacteria 2552
9 Ga0070666_10182350 3300005335 Bacteria 1473
10 Ga0070680_100003662 3300005336 Bacteria 11484
11 Ga0070680_100059149 3300005336 Bacteria 3134
12 Ga0068868_100902311 3300005338 Bacteria 803
13 Ga0068868_101848624 3300005338 Bacteria 571
14 Ga0070660_100448761 3300005339 Bacteria 1070
15 Ga0070689_100197493 3300005340 Bacteria 1641
16 Ga0070689_100295999 3300005340 Bacteria 1346
17 Ga0070691_10013483 3300005341 Bacteria 3744
18 Ga0070691_10960660 3300005341 Bacteria 531
19 Ga0070687_100751074 3300005343 Bacteria 686
20 Ga0070661_100885912 3300005344 Bacteria 736
21 Ga0070692_10210158 3300005345 Bacteria 1145
22 Ga0070668_100021251 3300005347 Bacteria 4906
23 Ga0070668_100027626 3300005347 Bacteria 4308
24 Ga0070668_100917510 3300005347 Bacteria 784
25 Ga0070669_100218271 3300005353 Bacteria 1507
26 Ga0070674_100006467 3300005356 Bacteria 6838
27 Ga0070673_100256128 3300005364 Bacteria 1527
28 Ga0070659_100543691 3300005366 Bacteria 994
29 Ga0070667_100017619 3300005367 Bacteria 5917
30 Ga0070667_100337057 3300005367 Bacteria 1363
31 Ga0070667_100684794 3300005367 Bacteria 948
32 Ga0070703_10051303 3300005406 Bacteria 1320
33 Ga0070714_102441231 3300005435 Bacteria 508
34 Ga0070701_10014155 3300005438 Bacteria 3650
35 Ga0070711_100247284 3300005439 Bacteria 1397
36 Ga0070705_100000171 3300005440 Bacteria 37880
37 Ga0070705_100279459 3300005440 Bacteria 1186
38 Ga0070705_100630295 3300005440 Bacteria 833
39 Ga0070700_100000482 3300005441 Bacteria 19974
40 Ga0070700_100095903 3300005441 Bacteria 1945
41 Ga0070700_100531114 3300005441 Bacteria 910
42 Ga0070694_100000555 3300005444 Bacteria 20563
43 Ga0070694_100096916 3300005444 Bacteria 2080
44 Ga0070708_100013464 3300005445 Bacteria 6700
45 Ga0070708_100664097 3300005445 Bacteria 982
46 Ga0070663_100002218 3300005455 Bacteria 10873
47 Ga0070663_100175047 3300005455 Bacteria 1661
48 Ga0070662_100029376 3300005457 Bacteria 3836
49 Ga0070662_100034999 3300005457 Bacteria 3544
50 Ga0070662_100052162 3300005457 Bacteria 2956
51 Ga0070662_100081080 3300005457 Bacteria 2417
52 Ga0070681_10004750 3300005458 Bacteria 13015
53 Ga0070681_11155119 3300005458 Bacteria 696
54 Ga0068867_101238439 3300005459 Bacteria 687
55 Ga0070707_100267680 3300005468 Bacteria 1662
56 Ga0070707_100285734 3300005468 Bacteria 1603
57 Ga0070707_102105393 3300005468 Bacteria 532
58 Ga0070698_100228289 3300005471 Bacteria 1795
59 Ga0070698_100492073 3300005471 Bacteria 1164
60 Ga0070699_100000167 3300005518 Bacteria 63239
61 Ga0068853_101322548 3300005539 Bacteria 697
62 Ga0070672_100928853 3300005543 Bacteria 769
63 Ga0070686_100258268 3300005544 Bacteria 1276
64 Ga0070695_100192066 3300005545 Bacteria 1454
65 Ga0070696_100000097 3300005546 Bacteria 44009
66 Ga0070696_100292825 3300005546 Bacteria 1244
67 Ga0070696_100795984 3300005546 Bacteria 778
68 Ga0070693_100057111 3300005547 Bacteria 2255
69 Ga0070693_100235970 3300005547 Bacteria 1205
70 Ga0070665_100004744 3300005548 Bacteria 14149
71 Ga0070665_100248732 3300005548 Bacteria 1778
72 Ga0070665_101282120 3300005548 Bacteria 743
73 Ga0070704_100000566 3300005549 Bacteria 17827
74 Ga0070704_100134290 3300005549 Bacteria 1923
75 Ga0070704_100650864 3300005549 Bacteria 930
76 Ga0068855_100089464 3300005563 Bacteria 3554
77 Ga0068857_100009356 3300005577 Bacteria 8508
78 Ga0068854_100521173 3300005578 Bacteria 1004
79 Ga0068856_101400144 3300005614 Bacteria 714
80 Ga0070702_100027411 3300005615 Bacteria 3074
81 Ga0070702_100149780 3300005615 Bacteria 1496
82 Ga0068852_100152582 3300005616 Bacteria 2150
83 Ga0068859_100001658 3300005617 Bacteria 22662
84 Ga0068859_100018700 3300005617 Bacteria 6962
85 Ga0068859_100138423 3300005617 Bacteria 2508
86 Ga0068864_100230011 3300005618 Bacteria 1714
87 Ga0068864_100322093 3300005618 Bacteria 1452
88 Ga0068864_100654863 3300005618 Bacteria 1023
89 Ga0068864_100927009 3300005618 Bacteria 861
90 Ga0068861_100055890 3300005719 Bacteria 3011
91 Ga0068861_100076482 3300005719 Bacteria 2609
92 Ga0068861_100078434 3300005719 Bacteria 2579
93 Ga0068851_10285585 3300005834 Bacteria 945
94 Ga0068863_100027165 3300005841 Bacteria 5459
95 Ga0068863_101289689 3300005841 Bacteria 737
96 Ga0068858_100066089 3300005842 Bacteria 3347
97 Ga0068858_100247091 3300005842 Bacteria 1694
98 Ga0068858_100287720 3300005842 Bacteria 1566
99 Ga0068858_100377541 3300005842 Bacteria 1360
100 Ga0068858_101216245 3300005842 Bacteria 741
101 Ga0068860_100001592 3300005843 Bacteria 24376
102 Ga0068860_100044929 3300005843 Bacteria 4210
103 Ga0068860_100069279 3300005843 Bacteria 3353
104 Ga0068860_100900984 3300005843 Bacteria 900
105 Ga0068862_100001428 3300005844 Bacteria 22066
106 Ga0068862_100033211 3300005844 Bacteria 4360
107 Ga0068862_100403506 3300005844 Bacteria 1279
108 Ga0070712_100495967 3300006175 Bacteria 1023
109 Ga0097621_100464354 3300006237 Bacteria 1142
110 Ga0097621_100784503 3300006237 Bacteria 882
111 Ga0068871_101154379 3300006358 Bacteria 725
112 Ga0075428_101035473 3300006844 Bacteria 868
113 Ga0075430_100545958 3300006846 Bacteria 956
114 Ga0075431_100000652 3300006847 Bacteria 29451
115 Ga0075431_100414498 3300006847 Bacteria 1347
116 Ga0075433_10024314 3300006852 Bacteria 5111
117 Ga0075433_10480909 3300006852 Bacteria 1094
118 Ga0075434_100228066 3300006871 Bacteria 1882
119 Ga0068865_100248755 3300006881 Bacteria 1402
120 Ga0068865_100620588 3300006881 Bacteria 916
121 Ga0097620_100001658 3300006931 Bacteria 22662
122 Ga0097620_100018700 3300006931 Bacteria 6962
123 Ga0097620_100138424 3300006931 Bacteria 2508
124 Ga0075435_100577628 3300007076 Bacteria 974
125 Ga0075435_100746974 3300007076 Bacteria 851
126 Ga0075435_100902436 3300007076 Bacteria 771
127 Ga0105240_10135001 3300009093 Bacteria 2955
128 Ga0105240_10195588 3300009093 Bacteria 2375
129 Ga0105240_10301352 3300009093 Bacteria 1833
130 Ga0105240_10360470 3300009093 Bacteria 1647
131 Ga0111539_10018884 3300009094 Bacteria 8529
132 Ga0105245_10151876 3300009098 Bacteria 2191
133 Ga0105245_10306002 3300009098 Bacteria 1561
134 Ga0105245_10451541 3300009098 Bacteria 1294
135 Ga0105245_10587001 3300009098 Bacteria 1139
136 Ga0114129_10189058 3300009147 Bacteria 2797
137 Ga0114129_10353743 3300009147 Bacteria 1945
138 Ga0114129_10436153 3300009147 Bacteria 1720
139 Ga0114129_10751688 3300009147 Bacteria 1248
140 Ga0105243_10090794 3300009148 Bacteria 2514
141 Ga0105243_10240159 3300009148 Bacteria 1612
142 Ga0105243_10400778 3300009148 Bacteria 1274
143 Ga0105243_10441408 3300009148 Bacteria 1219
144 Ga0105242_10157289 3300009176 Bacteria 1986
145 Ga0105248_10161255 3300009177 Bacteria 2529
146 Ga0105248_10360308 3300009177 Bacteria 1637
147 Ga0105248_12072374 3300009177 Bacteria 647
148 Ga0105238_10001483 3300009551 Bacteria 23558
149 Ga0105238_10335262 3300009551 Bacteria 1500
150 Ga0105249_10037438 3300009553 Bacteria 4403
151 Ga0105249_10043257 3300009553 Bacteria 4097
152 Ga0105249_10554876 3300009553 Bacteria 1200
153 Ga0105249_10903075 3300009553 Bacteria 950
154 Ga0105239_10168691 3300010375 Bacteria 2447
155 Ga0105239_10234600 3300010375 Bacteria 2059
156 Ga0105239_10276437 3300010375 Bacteria 1890
157 Ga0105239_10628665 3300010375 Bacteria 1225
158 Ga0105239_11645035 3300010375 Bacteria 743
159 Ga0105246_10004309 3300011119 Bacteria 8653
160 Ga0105246_10011521 3300011119 Bacteria 5489
161 Ga0105246_10244580 3300011119 Bacteria 1420
162 Ga0105246_11375049 3300011119 Bacteria 658
163 Ga0157338_1006018 3300012515 Bacteria 1110
164 Ga0157373_10282672 3300013100 Bacteria 1176
165 Ga0157371_11235545 3300013102 Bacteria 577
166 Ga0157369_10396633 3300013105 Bacteria 1432
167 Ga0157369_11484844 3300013105 Bacteria 690
168 Ga0157378_10084611 3300013297 Bacteria 2872
169 Ga0157378_10200142 3300013297 Bacteria 1889
170 Ga0157378_10421139 3300013297 Bacteria 1320
171 Ga0163162_10126833 3300013306 Bacteria 2659
172 Ga0163162_10205282 3300013306 Bacteria 2100
173 Ga0163162_10822745 3300013306 Bacteria 1045
174 Ga0163162_10893931 3300013306 Bacteria 1002
175 Ga0157372_10258767 3300013307 Bacteria 2021
176 Ga0157372_10297153 3300013307 Bacteria 1878
177 Ga0157372_10515495 3300013307 Bacteria 1394
178 Ga0157375_10072994 3300013308 Bacteria 3450
179 Ga0157375_10126363 3300013308 Bacteria 2672
180 Ga0157375_10324228 3300013308 Bacteria 1705
181 Ga0163163_10202242 3300014325 Bacteria 2035
182 Ga0163163_10229598 3300014325 Bacteria 1905
183 Ga0163163_10428995 3300014325 Bacteria 1381
184 Ga0163163_10840053 3300014325 Bacteria 982
185 Ga0163163_12596501 3300014325 Bacteria 564
186 Ga0157380_10266891 3300014326 Bacteria 1558
187 Ga0157379_10016306 3300014968 Bacteria 6536
188 Ga0157379_11214016 3300014968 Bacteria 726
189 Ga0163161_10025400 3300017792 Bacteria 4192
190 Ga0163161_10425344 3300017792 Bacteria 1069
191 Ga0163161_10473732 3300017792 Bacteria 1015
192 Ga0163161_10997841 3300017792 Bacteria 715
193 Ga0213872_10102986 3300021361 Bacteria 1271
194 Ga0213874_10132935 3300021377 Bacteria 856
195 Ga0207653_10002541 3300025885 Bacteria 5795
196 Ga0207680_10031608 3300025903 Bacteria 3000
197 Ga0207647_10145415 3300025904 Bacteria 1388
198 Ga0207645_10417234 3300025907 Bacteria 904
199 Ga0207654_10428162 3300025911 Bacteria 925
200 Ga0207707_10451114 3300025912 Bacteria 1100
201 Ga0207695_10061810 3300025913 Bacteria 3870
202 Ga0207695_10182630 3300025913 Bacteria 2018
203 Ga0207695_10403838 3300025913 Bacteria 1251
204 Ga0207671_10231775 3300025914 Bacteria 1449
205 Ga0207671_10824738 3300025914 Bacteria 735
206 Ga0207693_10077348 3300025915 Bacteria 2605
207 Ga0207660_10005384 3300025917 Bacteria 8309
208 Ga0207660_10472934 3300025917 Bacteria 1015
209 Ga0207660_10689114 3300025917 Bacteria 833
210 Ga0207662_10624943 3300025918 Bacteria 751
211 Ga0207657_10187880 3300025919 Bacteria 1668
212 Ga0207657_10312121 3300025919 Bacteria 1244
213 Ga0207646_10229402 3300025922 Bacteria 1678
214 Ga0207646_10325578 3300025922 Bacteria 1389
215 Ga0207646_11102143 3300025922 Bacteria 699
216 Ga0207681_10725594 3300025923 Bacteria 827
217 Ga0207694_10001304 3300025924 Bacteria 21470
218 Ga0207694_10139461 3300025924 Bacteria 1949
219 Ga0207687_10093656 3300025927 Bacteria 2197
220 Ga0207664_10845821 3300025929 Bacteria 822
221 Ga0207644_10962154 3300025931 Bacteria 716
222 Ga0207690_10847107 3300025932 Bacteria 757
223 Ga0207706_10110067 3300025933 Bacteria 2424
224 Ga0207706_10129735 3300025933 Bacteria 2217
225 Ga0207706_10340257 3300025933 Bacteria 1305
226 Ga0207686_10283761 3300025934 Bacteria 1223
227 Ga0207686_10552103 3300025934 Bacteria 901
228 Ga0207709_10041366 3300025935 Bacteria 2765
229 Ga0207709_10102890 3300025935 Bacteria 1892
230 Ga0207709_10105095 3300025935 Bacteria 1875
231 Ga0207670_10071600 3300025936 Bacteria 2398
232 Ga0207670_10271815 3300025936 Bacteria 1318
233 Ga0207669_10254159 3300025937 Bacteria 1310
234 Ga0207704_10575280 3300025938 Bacteria 919
235 Ga0207704_11259257 3300025938 Bacteria 632
236 Ga0207691_10883181 3300025940 Bacteria 749
237 Ga0207711_10219152 3300025941 Bacteria 1740
238 Ga0207711_10369988 3300025941 Bacteria 1329
239 Ga0207711_11151744 3300025941 Bacteria 717
240 Ga0207689_10046017 3300025942 Bacteria 3608
241 Ga0207661_10096634 3300025944 Bacteria 2472
242 Ga0207667_10390040 3300025949 Bacteria 1418
243 Ga0207667_10553330 3300025949 Bacteria 1163
244 Ga0207651_11468162 3300025960 Bacteria 614
245 Ga0207712_10024078 3300025961 Bacteria 4027
246 Ga0207712_10340422 3300025961 Bacteria 1244
247 Ga0207712_10489577 3300025961 Bacteria 1049
248 Ga0207712_10859900 3300025961 Bacteria 800
249 Ga0207668_10003322 3300025972 Bacteria 9419
250 Ga0207668_10038442 3300025972 Bacteria 3212
251 Ga0207668_10399489 3300025972 Bacteria 1162
252 Ga0207640_10130889 3300025981 Bacteria 1813
253 Ga0207640_10995842 3300025981 Bacteria 737
254 Ga0207658_10553779 3300025986 Bacteria 1029
255 Ga0207658_10653662 3300025986 Bacteria 948
256 Ga0207658_10693462 3300025986 Bacteria 920
257 Ga0207677_10313038 3300026023 Bacteria 1302
258 Ga0207703_10050402 3300026035 Bacteria 3369
259 Ga0207703_10201848 3300026035 Bacteria 1767
260 Ga0207703_10259977 3300026035 Bacteria 1569
261 Ga0207703_10962798 3300026035 Bacteria 818
262 Ga0207703_11831716 3300026035 Bacteria 583
263 Ga0207639_11218992 3300026041 Bacteria 706
264 Ga0207678_10005726 3300026067 Bacteria 11092
265 Ga0207678_10142618 3300026067 Bacteria 2045
266 Ga0207678_10800125 3300026067 Bacteria 832
267 Ga0207708_10000296 3300026075 Bacteria 39206
268 Ga0207708_10071218 3300026075 Bacteria 2663
269 Ga0207708_10553389 3300026075 Bacteria 970
270 Ga0207708_10683620 3300026075 Bacteria 876
271 Ga0207702_11591522 3300026078 Bacteria 647
272 Ga0207641_10022099 3300026088 Bacteria 5234
273 Ga0207641_11271775 3300026088 Bacteria 736
274 Ga0207648_10294933 3300026089 Bacteria 1453
275 Ga0207676_10067986 3300026095 Bacteria 2848
276 Ga0207676_10070220 3300026095 Bacteria 2808
277 Ga0207676_10556027 3300026095 Bacteria 1097
278 Ga0207676_10885382 3300026095 Bacteria 875
279 Ga0207674_10004822 3300026116 Bacteria 16164
280 Ga0207674_10185022 3300026116 Bacteria 2034
281 Ga0207674_11431300 3300026116 Bacteria 660
282 Ga0207675_100012855 3300026118 Bacteria 7819
283 Ga0207675_100043436 3300026118 Bacteria 4197
284 Ga0207675_100086733 3300026118 Bacteria 2939
285 Ga0207675_100302590 3300026118 Bacteria 1558
286 Ga0207675_100621088 3300026118 Bacteria 1085
287 Ga0207675_100741210 3300026118 Bacteria 993
288 Ga0207683_10023066 3300026121 Bacteria 5348
289 Ga0268266_10003259 3300028379 Bacteria 16360
290 Ga0268266_10076843 3300028379 Bacteria 2902
291 Ga0268266_10106531 3300028379 Bacteria 2478
292 Ga0268265_10000508 3300028380 Bacteria 40027
293 Ga0268265_10232233 3300028380 Bacteria 1622
294 Ga0268265_10331466 3300028380 Bacteria 1382
295 Ga0268265_10432025 3300028380 Bacteria 1225
296 Ga0268264_10003796 3300028381 Bacteria 12956
297 Ga0268264_10036495 3300028381 Bacteria 4050
298 Ga0268264_10751625 3300028381 Bacteria 971
299 Ga0268264_11073943 3300028381 Bacteria 813
300 Ga0268264_11091014 3300028381 Bacteria 806
301 Ga0265330_10380382 3300031235 Bacteria 597
302 Ga0265325_10066791 3300031241 Bacteria 1813
303 Ga0265340_10383306 3300031247 Bacteria 620
304 Ga0265331_10000129 3300031250 Bacteria 99170
305 Ga0265327_10000292 3300031251 Bacteria 97787
306 Ga0307513_10014267 3300031456 Bacteria 9714
307 Ga0307408_100048660 3300031548 Bacteria 3042
308 Ga0265313_10232980 3300031595 Bacteria 756
309 Ga0316579_10058415 3300031691 Bacteria 1812
310 Ga0265314_10021087 3300031711 Bacteria 5019
311 Ga0316576_10139416 3300031727 Bacteria 1825
312 Ga0307405_10148725 3300031731 Bacteria 1644
313 Ga0307413_10238592 3300031824 Bacteria 1341
314 Ga0307410_11045101 3300031852 Bacteria 706
315 Ga0307406_10527221 3300031901 Bacteria 962
316 Ga0307412_11780681 3300031911 Unclassified 566
317 Ga0316583_10015512 3300032133 Bacteria 2741
318 Ga0316580_10054191 3300032139 Bacteria 1234
319 Ga0373939_0274975 3300035114 Bacteria 663
320 Ga0373945_0069025 3300035116 Bacteria 1334
321 Ga0373946_0077239 3300035171 Bacteria 1451
322 Ga0373961_0210164 3300035241 Bacteria 690
323 Ga0373962_0097976 3300035242 Bacteria 911
324 Ga0373931_0024643 3300035691 Bacteria 3050
325 Ga0373935_0089753 3300035692 Bacteria 2010
326 Ga0373927_0766353 3300035695 Bacteria 637
327 Ga0316582_0706051 3300036647 Bacteria 692
328 Ga0316584_0210669 3300036712 Bacteria 1430
329 Ga0395899_0019749 3300037312 Bacteria 5116
330 Ga0436364_0530473 3300037853 Bacteria 1071
331 Ga0436364_0747645 3300037853 Bacteria 2045
332 Ga0436360_0247471 3300039438 Bacteria 826
333 Ga0436360_1199555 3300039438 Bacteria 588
334 Ga0436361_0045550 3300039447 Bacteria 6059
335 Ga0436363_1456083 3300039450 Bacteria 1652
336 Ga0439453_0024997 3300041408 Bacteria 1100
337 Ga0451802_0507537 3300041460 Bacteria 590
338 Ga0451841_1012353 3300041498 Bacteria 773
339 Ga0439435_0002941 3300042436 Bacteria 3464
340 Ga0439459_0233306 3300042438 Bacteria 514
341 Ga0466966_0024751 3300044684 Bacteria 3927
342 Ga0466961_0375228 3300044693 Bacteria 864
343 Ga0466971_0047201 3300044719 Bacteria 1936
344 Ga0466957_0701650 3300044842 Bacteria 714
345 Ga0466959_0204156 3300045049 Bacteria 1375
346 Ga0451576_1161003 3300045051 Bacteria 807
347 Ga0451576_2343035 3300045051 Bacteria 547
348 Ga0466958_0152517 3300045836 Bacteria 1458
349 Ga0495617_241172 3300046452 Bacteria 558
350 Ga0495603_0000627 3300046455 Bacteria 19818
351 Ga0495629_0007106 3300046459 Bacteria 8248
352 Ga0495641_0007313 3300046461 Bacteria 6916
353 Ga0495580_0000299 3300046472 Bacteria 40203
354 Ga0495639_0002035 3300046475 Bacteria 8950
355 Ga0495584_0026383 3300046491 Bacteria 2943
356 Ga0495584_0400180 3300046491 Bacteria 698
357 Ga0495585_0109548 3300046492 Bacteria 1470
358 Ga0495594_0000131 3300046499 Bacteria 35452
359 Ga0495607_0387675 3300046501 Bacteria 638
360 Ga0495608_0473015 3300046511 Bacteria 761
361 Ga0495616_0133079 3300046513 Bacteria 1138
362 Ga0495616_0278684 3300046513 Bacteria 711
363 Ga0495637_0101299 3300046520 Bacteria 1125
364 Ga0495665_0002454 3300046531 Bacteria 10015
365 Ga0495587_0066743 3300046536 Bacteria 2098
366 Ga0495609_0349414 3300046538 Bacteria 597
367 Ga0495622_0004321 3300046557 Bacteria 6615
368 Ga0495656_0017177 3300046615 Bacteria 2758
369 Ga0495668_0474763 3300046616 Bacteria 689
370 Ga0495634_0017557 3300046642 Bacteria 5103
371 Ga0495625_0221462 3300046660 Bacteria 1240
372 Ga0495661_0253567 3300046665 Bacteria 897
373 Ga0495588_0000613 3300046674 Bacteria 16801
374 Ga0495658_0002461 3300046683 Bacteria 9324
375 Ga0495669_0506806 3300046684 Bacteria 587
376 Ga0495624_0177926 3300046690 Bacteria 1297
377 Ga0495670_0807314 3300046691 Bacteria 512
378 Ga0495581_0000843 3300047315 Bacteria 16344
379 Ga0495581_0598538 3300047315 Bacteria 639
380 Ga0495672_0099357 3300047320 Bacteria 1582
381 Ga0495675_0513036 3300047444 Bacteria 687
382 Ga0495677_0048043 3300047445 Bacteria 1568
383 Ga0495684_0485136 3300047471 Bacteria 853
384 Ga0495602_0266929 3300048088 Bacteria 1267
385 Ga0495614_0000595 3300048089 Bacteria 15125
386 Ga0496100_0088386 3300048903 Bacteria 2109
387 Ga0496100_0230180 3300048903 Bacteria 1363
388 Ga0496101_0275972 3300048904 Bacteria 1313
389 Ga0496101_1155395 3300048904 Bacteria 607
390 Ga0496101_1186577 3300048904 Bacteria 598
391 Ga0496102_0003290 3300048905 Bacteria 13702
392 Ga0496102_0009775 3300048905 Bacteria 8250
393 Ga0496102_0114053 3300048905 Bacteria 2521
394 Ga0496102_0450756 3300048905 Bacteria 1207
395 Ga0496103_0003743 3300048906 Bacteria 9250
396 Ga0496103_0008489 3300048906 Bacteria 6104
397 Ga0496104_0023377 3300048907 Bacteria 5683
398 Ga0496104_0306877 3300048907 Bacteria 1499
399 Ga0496104_0735116 3300048907 Bacteria 894
400 Ga0496104_0837724 3300048907 Bacteria 825
401 Ga0496105_0315015 3300048908 Bacteria 1255
402 Ga0496105_0728021 3300048908 Bacteria 759
403 Ga0496106_0013938 3300048909 Bacteria 5944
404 Ga0496106_0023578 3300048909 Bacteria 4570
405 Ga0496106_0070147 3300048909 Bacteria 2676
406 Ga0496106_0264884 3300048909 Bacteria 1375
407 Ga0496107_0001227 3300048910 Bacteria 15652
408 Ga0496107_0024412 3300048910 Bacteria 4276
409 Ga0496107_0058795 3300048910 Bacteria 2780
410 Ga0496108_0117227 3300048911 Bacteria 2282
411 Ga0496108_0189284 3300048911 Bacteria 1783
412 Ga0496108_1011418 3300048911 Bacteria 709
413 Ga0496109_0011144 3300048912 Bacteria 7711
414 Ga0496109_0023962 3300048912 Bacteria 5421
415 Ga0496109_0063870 3300048912 Bacteria 3368
416 Ga0496110_0093793 3300048913 Bacteria 2687
417 Ga0496110_0484000 3300048913 Bacteria 1127
418 Ga0496111_0359525 3300048914 Bacteria 1077
419 Ga0496112_0012419 3300048915 Bacteria 7831
420 Ga0496112_0229806 3300048915 Bacteria 1810
421 Ga0496112_0904927 3300048915 Bacteria 804
422 Ga0496112_1084745 3300048915 Bacteria 719
423 Ga0496112_1127120 3300048915 Bacteria 702
424 Ga0496113_0065408 3300048916 Bacteria 2752
425 Ga0496113_0211701 3300048916 Bacteria 1543
426 Ga0496114_0006475 3300048917 Bacteria 9229
427 Ga0496115_0065176 3300048918 Bacteria 2942
428 Ga0496121_0686703 3300048924 Bacteria 618
429 Ga0496126_0301478 3300048929 Bacteria 1322
430 Ga0496126_1022797 3300048929 Bacteria 619
431 Ga0501031_0038071 3300049568 Bacteria 3139
432 Ga0501031_0496849 3300049568 Bacteria 787
433 Ga0501031_0961442 3300049568 Bacteria 546
434 Ga0501032_0025300 3300049569 Bacteria 4093
435 Ga0501032_0193534 3300049569 Bacteria 1329
436 Ga0501032_0406552 3300049569 Bacteria 874
437 Ga0501033_0111113 3300049570 Bacteria 1994
438 Ga0501033_0603605 3300049570 Bacteria 752
439 Ga0501033_0687574 3300049570 Bacteria 697
440 Ga0501034_0004261 3300049571 Bacteria 15956
441 Ga0501034_0005961 3300049571 Bacteria 13193
442 Ga0501034_0018906 3300049571 Bacteria 7058
443 Ga0501034_0231328 3300049571 Bacteria 1797
444 Ga0501036_0070372 3300049572 Bacteria 2958
445 Ga0501036_0094129 3300049572 Bacteria 2532
446 Ga0501036_0171298 3300049572 Bacteria 1829
447 Ga0501036_0179190 3300049572 Bacteria 1784
448 Ga0501036_0380133 3300049572 Bacteria 1179
449 Ga0501037_0352891 3300049573 Bacteria 1014
450 Ga0501037_0477216 3300049573 Bacteria 848
451 Ga0501037_0822883 3300049573 Bacteria 612
452 Ga0501038_0011728 3300049574 Bacteria 7995
453 Ga0501038_0062640 3300049574 Bacteria 3178
454 Ga0501038_0110360 3300049574 Bacteria 2279
455 Ga0501038_0339780 3300049574 Bacteria 1171
456 Ga0501038_0398767 3300049574 Bacteria 1065
457 Ga0501039_0042416 3300049575 Bacteria 3515
458 Ga0501039_0061840 3300049575 Bacteria 2900
459 Ga0501039_0089351 3300049575 Bacteria 2401
460 Ga0501039_0178067 3300049575 Bacteria 1672
461 Ga0501039_0183921 3300049575 Bacteria 1643
462 Ga0501039_0733426 3300049575 Bacteria 772
463 Ga0501039_1398429 3300049575 Bacteria 539
464 Ga0501040_0027155 3300049576 Bacteria 3852
465 Ga0501040_0085580 3300049576 Bacteria 2188
466 Ga0501040_0090293 3300049576 Bacteria 2129
467 Ga0501040_0249267 3300049576 Bacteria 1266
468 Ga0501040_0290747 3300049576 Bacteria 1168
469 Ga0501040_0652483 3300049576 Bacteria 760
470 Ga0501041_0017902 3300049577 Bacteria 4216
471 Ga0501041_0320879 3300049577 Bacteria 977
472 Ga0501042_0087966 3300049578 Bacteria 2229
473 Ga0501042_0093570 3300049578 Bacteria 2158
474 Ga0501042_0109144 3300049578 Bacteria 1992
475 Ga0501043_0037738 3300049579 Bacteria 3800
476 Ga0501043_0079525 3300049579 Bacteria 2576
477 Ga0501043_0127109 3300049579 Bacteria 1999
478 Ga0501043_0176369 3300049579 Bacteria 1666
479 Ga0501043_0179370 3300049579 Bacteria 1650
480 Ga0501043_0491061 3300049579 Bacteria 918
481 Ga0501046_0005370 3300049580 Bacteria 11456
482 Ga0501046_0043143 3300049580 Bacteria 3592
483 Ga0501046_0065978 3300049580 Bacteria 2822
484 Ga0501046_0112238 3300049580 Bacteria 2081
485 Ga0501046_0210691 3300049580 Bacteria 1443
486 Ga0501046_0494448 3300049580 Bacteria 876
487 Ga0501047_0102782 3300049581 Bacteria 2737
488 Ga0501047_0129543 3300049581 Bacteria 2403
489 Ga0501047_0154272 3300049581 Bacteria 2171
490 Ga0501047_0179097 3300049581 Bacteria 1986
491 Ga0501047_0310190 3300049581 Bacteria 1418
492 Ga0501047_0329015 3300049581 Bacteria 1367
493 Ga0501047_0406822 3300049581 Bacteria 1193
494 Ga0501048_0012118 3300049582 Bacteria 6425
495 Ga0501048_0019338 3300049582 Bacteria 4998
496 Ga0501048_0094546 3300049582 Bacteria 2108
497 Ga0501048_0210649 3300049582 Bacteria 1378
498 Ga0501048_0263931 3300049582 Bacteria 1223
499 Ga0501048_0673930 3300049582 Bacteria 743
500 Ga0501048_0716363 3300049582 Bacteria 719
501 Ga0501067_0001416 3300049583 Bacteria 13004
502 Ga0501067_0046177 3300049583 Bacteria 2418
503 Ga0501068_0056384 3300049584 Bacteria 2382
504 Ga0501068_0149739 3300049584 Bacteria 1466
505 Ga0501069_0431211 3300049585 Bacteria 782
506 Ga0501070_0211820 3300049586 Bacteria 1590
507 Ga0501071_0189680 3300049587 Bacteria 1541
508 Ga0501071_0281108 3300049587 Bacteria 1259
509 Ga0501071_0350578 3300049587 Bacteria 1123
510 Ga0501071_0390866 3300049587 Bacteria 1061
511 Ga0501071_0842714 3300049587 Bacteria 707
512 Ga0501072_0014249 3300049588 Bacteria 6091
513 Ga0501072_0108051 3300049588 Bacteria 2213
514 Ga0501072_0547296 3300049588 Bacteria 914
515 Ga0501072_0821301 3300049588 Bacteria 727
516 Ga0501072_1039086 3300049588 Bacteria 638
517 Ga0501072_1116412 3300049588 Bacteria 613
518 Ga0501073_0014072 3300049589 Bacteria 5812
519 Ga0501073_0146493 3300049589 Bacteria 1636
520 Ga0501073_0194547 3300049589 Bacteria 1403
521 Ga0501073_0295487 3300049589 Bacteria 1118
522 Ga0501073_0400517 3300049589 Bacteria 948
523 Ga0501073_0530605 3300049589 Bacteria 813
524 Ga0501074_0035756 3300049590 Bacteria 3599
525 Ga0501074_0056825 3300049590 Bacteria 2820
526 Ga0501074_0168670 3300049590 Bacteria 1563
527 Ga0501074_0367731 3300049590 Bacteria 1020
528 Ga0501074_0699541 3300049590 Bacteria 715
529 Ga0501075_0171395 3300049591 Bacteria 1656
530 Ga0501075_0453870 3300049591 Bacteria 977
531 Ga0501075_0765425 3300049591 Bacteria 735
532 Ga0501075_1548174 3300049591 Bacteria 502
533 Ga0501076_0029662 3300049592 Bacteria 4255
534 Ga0501076_0040748 3300049592 Bacteria 3650
535 Ga0501076_0098084 3300049592 Bacteria 2361
536 Ga0501076_0177808 3300049592 Bacteria 1734
537 Ga0501076_0211185 3300049592 Bacteria 1586
538 Ga0501076_0412659 3300049592 Bacteria 1111
539 Ga0501076_0556244 3300049592 Bacteria 946
540 Ga0501076_1138538 3300049592 Bacteria 642
541 Ga0501076_1492929 3300049592 Bacteria 555
542 Ga0501077_0012381 3300049593 Bacteria 5343
543 Ga0501077_0068503 3300049593 Bacteria 2249
544 Ga0501077_0103895 3300049593 Bacteria 1800
545 Ga0501077_0166759 3300049593 Bacteria 1399
546 Ga0501077_0185905 3300049593 Bacteria 1320
547 Ga0501077_0195592 3300049593 Bacteria 1284
548 Ga0501077_0703827 3300049593 Bacteria 649
549 Ga0501079_0014826 3300049741 Bacteria 5941
550 Ga0501079_0088493 3300049741 Bacteria 2398
551 Ga0501079_0210132 3300049741 Bacteria 1520
552 Ga0501079_0211701 3300049741 Bacteria 1514
553 Ga0501079_0263041 3300049741 Bacteria 1348
554 Ga0501080_0492198 3300049742 Bacteria 1096
555 Ga0501080_0627889 3300049742 Bacteria 952
556 Ga0501080_0831263 3300049742 Bacteria 808
557 Ga0501080_1001771 3300049742 Bacteria 725
558 Ga0501080_1297626 3300049742 Bacteria 623
559 Ga0501081_0003077 3300049743 Bacteria 10592
560 Ga0501081_0012801 3300049743 Bacteria 5515
561 Ga0501081_0043930 3300049743 Bacteria 3066
562 Ga0501081_0110113 3300049743 Bacteria 1954
563 Ga0501081_0117405 3300049743 Bacteria 1892
564 Ga0501081_1351364 3300049743 Bacteria 541
565 Ga0501083_0003409 3300049744 Bacteria 11117
566 Ga0501083_0014402 3300049744 Bacteria 5529
567 Ga0501083_0045435 3300049744 Bacteria 2971
568 Ga0501083_0099967 3300049744 Bacteria 1913
569 Ga0501083_0129767 3300049744 Bacteria 1652
570 Ga0501083_0249577 3300049744 Bacteria 1155
571 Ga0501083_0327259 3300049744 Bacteria 996
572 Ga0501083_0366336 3300049744 Bacteria 937
573 Ga0501280_003723 3300049776 Bacteria 2310
574 Ga0501035_0034629 3300049822 Bacteria 4587
575 Ga0501035_0094712 3300049822 Bacteria 2625
576 Ga0501035_0211090 3300049822 Bacteria 1661
577 Ga0501035_0328378 3300049822 Bacteria 1284
578 Ga0501044_0028936 3300049823 Bacteria 5844
579 Ga0501044_0056089 3300049823 Bacteria 4045
580 Ga0501044_0212229 3300049823 Bacteria 1889
581 Ga0501044_0289188 3300049823 Bacteria 1571
582 Ga0501044_0335099 3300049823 Bacteria 1435
583 Ga0501044_0444007 3300049823 Bacteria 1205
584 Ga0501044_1044403 3300049823 Bacteria 688
585 Ga0501045_0022567 3300049824 Bacteria 4507
586 Ga0501045_0049850 3300049824 Bacteria 3054
587 Ga0501045_0168582 3300049824 Bacteria 1631
588 Ga0501045_0545046 3300049824 Bacteria 860
589 nmdc:mga05p37_1445357_c1 3300050507 Bacteria 689
590 nmdc:mga05p37_354393_c1 3300050507 Bacteria 1727
591 nmdc:mga05p37_562706_c1 3300050507 Bacteria 1295
592 nmdc:mga0qj67_555104_c1 3300050509 Bacteria 921
593 nmdc:mga0qj67_8450_c1 3300050509 Bacteria 7639
594 nmdc:mga06r32_1315_c1 3300050510 Bacteria 22385
595 nmdc:mga06r32_404575_c1 3300050510 Bacteria 1347
596 nmdc:mga08y16_114430_c1 3300050511 Bacteria 2808
597 nmdc:mga08y16_328932_c1 3300050511 Bacteria 1572
598 nmdc:mga0n895_348068_c1 3300050512 Bacteria 1501
599 nmdc:mga0rr50_1141444_c1 3300050513 Bacteria 662
600 nmdc:mga0a205_489308_c1 3300050515 Bacteria 1088
601 nmdc:mga0a205_75071_c1 3300050515 Bacteria 3266
602 Ga0495612_0146744 3300053078 Bacteria 1025
603 Ga0495612_0211089 3300053078 Bacteria 858
604 Ga0495655_0083809 3300053083 Bacteria 916
605 Ga0495619_0004904 3300053085 Bacteria 8497
606 Ga0495619_0046494 3300053085 Bacteria 2854
607 Ga0500583_0124548 3300053092 Bacteria 1276
608 Ga0500651_0296726 3300053093 Bacteria 928
609 Ga0500566_0062953 3300053094 Bacteria 2096
610 Ga0500641_0079550 3300053096 Bacteria 1390
611 Ga0500554_081610 3300053102 Bacteria 1066
612 Ga0500555_116509 3300053103 Bacteria 669
613 Ga0500556_0000903 3300053104 Bacteria 16509
614 Ga0500562_019830 3300053108 Bacteria 1743
615 Ga0500595_030648 3300053119 Bacteria 1810
616 Ga0500642_0058722 3300053130 Bacteria 1721
617 Ga0500573_0000050 3300053140 Bacteria 95598
618 Ga0500588_0135843 3300053146 Bacteria 880
619 Ga0500616_0000139 3300053153 Bacteria 123841
620 Ga0500616_0013071 3300053153 Bacteria 4834
621 Ga0500627_0134264 3300053158 Bacteria 1118
622 Ga0501084_0009497 3300054114 Bacteria 8049
623 Ga0501084_0048742 3300054114 Bacteria 3545
624 Ga0501084_0080943 3300054114 Bacteria 2723
625 Ga0501084_0211690 3300054114 Bacteria 1635
626 Ga0501084_0335243 3300054114 Bacteria 1277
627 Ga0501084_0490384 3300054114 Bacteria 1038
628 Ga0501084_1611793 3300054114 Bacteria 543
629 Ga0501082_0007775 3300060353 Bacteria 9250
630 Ga0501082_0020366 3300060353 Bacteria 5718
631 Ga0501082_0078325 3300060353 Bacteria 2851
632 Ga0501082_0192855 3300060353 Bacteria 1772
633 Ga0501082_0405337 3300060353 Bacteria 1190
634 Ga0501082_0515768 3300060353 Bacteria 1045
635 Ga0501082_0540745 3300060353 Bacteria 1019
636 Ga0501082_0668604 3300060353 Bacteria 909
637 Ga0501082_1122709 3300060353 Bacteria 687
638 Ga0501082_1133969 3300060353 Bacteria 683
639 Ga0501082_1562402 3300060353 Bacteria 576
640 Ga0501082_1612446 3300060353 Bacteria 566
641 Ga0530510_0020365 3300061734 Bacteria 4716
642 Ga0530510_0035380 3300061734 Bacteria 3599
643 Ga0530510_0713812 3300061734 Bacteria 764
644 2511171774 2510917026 Bacteria 7046020
645 2585199256 2582581293 Bacteria 5907401
646 2585995045 2585427633 Bacteria 6413184
647 2585999589 2585427634 Bacteria 6455027
648 2587919690 2585428106 Bacteria 5179711
649 2616298206 2615840624 Bacteria 6557588
650 2643855923 2643221568 Bacteria 5187270
651 2644226376 2643221640 Bacteria 5258820
652 2644235864 2643221642 Bacteria 5357871
653 2792459614 2791355048 Bacteria 5832535
654 2819684196 2818991461 Bacteria 7026071
655 2842334773 2842333319 Bacteria 8899485
656 2843747269 2843744320 Bacteria 5659202
657 2849560808 2849560528 Bacteria 5393480
658 2849574326 2849573788 Bacteria 5421256
659 2851158048 2851153111 Bacteria 5542585
660 2883357569 2883354860 Bacteria 5865246
661 2884963926 2884960567 Bacteria 5437054
662 2898333438 2898329390 Bacteria 5168154
663 2919167311 2919166419 Bacteria 4952238
664 2919171497 2919171160 Bacteria 6499771
665 2978973744 2978969890 Bacteria 5400756
666 2984592015 2984587000 Bacteria 5263363
667 8005251382 8005246636 Bacteria 4933972
668 8018131281 8018127388 Bacteria 7351159
669 8054461845 8054460903 Bacteria 4872905
670 8054568500 8054563764 Bacteria 5592885
671 Ga0307409_100875419
672 MBSR1b_contig_7412730
673 ARcpr5yngRDRAFT_c004757
674 Ga0065715_10268011
675 Ga0070683_100130330
676 Ga0070683_102056422
677 Ga0070690_101176865
678 Ga0070666_10061030
679 Ga0070666_10182350
680 Ga0070680_100003662
681 Ga0070680_100059149
682 Ga0068868_100902311
683 Ga0068868_101848624
684 Ga0070660_100448761
685 Ga0070689_100197493
686 Ga0070689_100295999
687 Ga0070691_10013483
688 Ga0070691_10960660
689 Ga0070687_100751074
690 Ga0070661_100885912
691 Ga0070692_10210158
692 Ga0070668_100021251
693 Ga0070668_100027626
694 Ga0070668_100917510
695 Ga0070669_100218271
696 Ga0070674_100006467
697 Ga0070673_100256128
698 Ga0070659_100543691
699 Ga0070667_100017619
700 Ga0070667_100337057
701 Ga0070667_100684794
702 Ga0070703_10051303
703 Ga0070714_102441231
704 Ga0070701_10014155
705 Ga0070711_100247284
706 Ga0070705_100000171
707 Ga0070705_100279459
708 Ga0070705_100630295
709 Ga0070700_100000482
710 Ga0070700_100095903
711 Ga0070700_100531114
712 Ga0070694_100000555
713 Ga0070694_100096916
714 Ga0070708_100013464
715 Ga0070708_100664097
716 Ga0070663_100002218
717 Ga0070663_100175047
718 Ga0070662_100029376
719 Ga0070662_100034999
720 Ga0070662_100052162
721 Ga0070662_100081080
722 Ga0070681_10004750
723 Ga0070681_11155119
724 Ga0068867_101238439
725 Ga0070707_100267680
726 Ga0070707_100285734
727 Ga0070707_102105393
728 Ga0070698_100228289
729 Ga0070698_100492073
730 Ga0070699_100000167
731 Ga0068853_101322548
732 Ga0070672_100928853
733 Ga0070686_100258268
734 Ga0070695_100192066
735 Ga0070696_100000097
736 Ga0070696_100292825
737 Ga0070696_100795984
738 Ga0070693_100057111
739 Ga0070693_100235970
740 Ga0070665_100004744
741 Ga0070665_100248732
742 Ga0070665_101282120
743 Ga0070704_100000566
744 Ga0070704_100134290
745 Ga0070704_100650864
746 Ga0068855_100089464
747 Ga0068857_100009356
748 Ga0068854_100521173
749 Ga0068856_101400144
750 Ga0070702_100027411
751 Ga0070702_100149780
752 Ga0068852_100152582
753 Ga0068859_100001658
754 Ga0068859_100018700
755 Ga0068859_100138423
756 Ga0068864_100230011
757 Ga0068864_100322093
758 Ga0068864_100654863
759 Ga0068864_100927009
760 Ga0068861_100055890
761 Ga0068861_100076482
762 Ga0068861_100078434
763 Ga0068851_10285585
764 Ga0068863_100027165
765 Ga0068863_101289689
766 Ga0068858_100066089
767 Ga0068858_100247091
768 Ga0068858_100287720
769 Ga0068858_100377541
770 Ga0068858_101216245
771 Ga0068860_100001592
772 Ga0068860_100044929
773 Ga0068860_100069279
774 Ga0068860_100900984
775 Ga0068862_100001428
776 Ga0068862_100033211
777 Ga0068862_100403506
778 Ga0070712_100495967
779 Ga0097621_100464354
780 Ga0097621_100784503
781 Ga0068871_101154379
782 Ga0075428_101035473
783 Ga0075430_100545958
784 Ga0075431_100000652
785 Ga0075431_100414498
786 Ga0075433_10024314
787 Ga0075433_10480909
788 Ga0075434_100228066
789 Ga0068865_100248755
790 Ga0068865_100620588
791 Ga0097620_100001658
792 Ga0097620_100018700
793 Ga0097620_100138424
794 Ga0075435_100577628
795 Ga0075435_100746974
796 Ga0075435_100902436
797 Ga0105240_10135001
798 Ga0105240_10195588
799 Ga0105240_10301352
800 Ga0105240_10360470
801 Ga0111539_10018884
802 Ga0105245_10151876
803 Ga0105245_10306002
804 Ga0105245_10451541
805 Ga0105245_10587001
806 Ga0114129_10189058
807 Ga0114129_10353743
808 Ga0114129_10436153
809 Ga0114129_10751688
810 Ga0105243_10090794
811 Ga0105243_10240159
812 Ga0105243_10400778
813 Ga0105243_10441408
814 Ga0105242_10157289
815 Ga0105248_10161255
816 Ga0105248_10360308
817 Ga0105248_12072374
818 Ga0105238_10001483
819 Ga0105238_10335262
820 Ga0105249_10037438
821 Ga0105249_10043257
822 Ga0105249_10554876
823 Ga0105249_10903075
824 Ga0105239_10168691
825 Ga0105239_10234600
826 Ga0105239_10276437
827 Ga0105239_10628665
828 Ga0105239_11645035
829 Ga0105246_10004309
830 Ga0105246_10011521
831 Ga0105246_10244580
832 Ga0105246_11375049
833 Ga0157338_1006018
834 Ga0157373_10282672
835 Ga0157371_11235545
836 Ga0157369_10396633
837 Ga0157369_11484844
838 Ga0157378_10084611
839 Ga0157378_10200142
840 Ga0157378_10421139
841 Ga0163162_10126833
842 Ga0163162_10205282
843 Ga0163162_10822745
844 Ga0163162_10893931
845 Ga0157372_10258767
846 Ga0157372_10297153
847 Ga0157372_10515495
848 Ga0157375_10072994
849 Ga0157375_10126363
850 Ga0157375_10324228
851 Ga0163163_10202242
852 Ga0163163_10229598
853 Ga0163163_10428995
854 Ga0163163_10840053
855 Ga0163163_12596501
856 Ga0157380_10266891
857 Ga0157379_10016306
858 Ga0157379_11214016
859 Ga0163161_10025400
860 Ga0163161_10425344
861 Ga0163161_10473732
862 Ga0163161_10997841
863 Ga0213872_10102986
864 Ga0213874_10132935
865 Ga0207653_10002541
866 Ga0207680_10031608
867 Ga0207647_10145415
868 Ga0207645_10417234
869 Ga0207654_10428162
870 Ga0207707_10451114
871 Ga0207695_10061810
872 Ga0207695_10182630
873 Ga0207695_10403838
874 Ga0207671_10231775
875 Ga0207671_10824738
876 Ga0207693_10077348
877 Ga0207660_10005384
878 Ga0207660_10472934
879 Ga0207660_10689114
880 Ga0207662_10624943
881 Ga0207657_10187880
882 Ga0207657_10312121
883 Ga0207646_10229402
884 Ga0207646_10325578
885 Ga0207646_11102143
886 Ga0207681_10725594
887 Ga0207694_10001304
888 Ga0207694_10139461
889 Ga0207687_10093656
890 Ga0207664_10845821
891 Ga0207644_10962154
892 Ga0207690_10847107
893 Ga0207706_10110067
894 Ga0207706_10129735
895 Ga0207706_10340257
896 Ga0207686_10283761
897 Ga0207686_10552103
898 Ga0207709_10041366
899 Ga0207709_10102890
900 Ga0207709_10105095
901 Ga0207670_10071600
902 Ga0207670_10271815
903 Ga0207669_10254159
904 Ga0207704_10575280
905 Ga0207704_11259257
906 Ga0207691_10883181
907 Ga0207711_10219152
908 Ga0207711_10369988
909 Ga0207711_11151744
910 Ga0207689_10046017
911 Ga0207661_10096634
912 Ga0207667_10390040
913 Ga0207667_10553330
914 Ga0207651_11468162
915 Ga0207712_10024078
916 Ga0207712_10340422
917 Ga0207712_10489577
918 Ga0207712_10859900
919 Ga0207668_10003322
920 Ga0207668_10038442
921 Ga0207668_10399489
922 Ga0207640_10130889
923 Ga0207640_10995842
924 Ga0207658_10553779
925 Ga0207658_10653662
926 Ga0207658_10693462
927 Ga0207677_10313038
928 Ga0207703_10050402
929 Ga0207703_10201848
930 Ga0207703_10259977
931 Ga0207703_10962798
932 Ga0207703_11831716
933 Ga0207639_11218992
934 Ga0207678_10005726
935 Ga0207678_10142618
936 Ga0207678_10800125
937 Ga0207708_10000296
938 Ga0207708_10071218
939 Ga0207708_10553389
940 Ga0207708_10683620
941 Ga0207702_11591522
942 Ga0207641_10022099
943 Ga0207641_11271775
944 Ga0207648_10294933
945 Ga0207676_10067986
946 Ga0207676_10070220
947 Ga0207676_10556027
948 Ga0207676_10885382
949 Ga0207674_10004822
950 Ga0207674_10185022
951 Ga0207674_11431300
952 Ga0207675_100012855
953 Ga0207675_100043436
954 Ga0207675_100086733
955 Ga0207675_100302590
956 Ga0207675_100621088
957 Ga0207675_100741210
958 Ga0207683_10023066
959 Ga0268266_10003259
960 Ga0268266_10076843
961 Ga0268266_10106531
962 Ga0268265_10000508
963 Ga0268265_10232233
964 Ga0268265_10331466
965 Ga0268265_10432025
966 Ga0268264_10003796
967 Ga0268264_10036495
968 Ga0268264_10751625
969 Ga0268264_11073943
970 Ga0268264_11091014
971 Ga0265330_10380382
972 Ga0265325_10066791
973 Ga0265340_10383306
974 Ga0265331_10000129
975 Ga0265327_10000292
976 Ga0307513_10014267
977 Ga0307408_100048660
978 Ga0265313_10232980
979 Ga0316579_10058415
980 Ga0265314_10021087
981 Ga0316576_10139416
982 Ga0307405_10148725
983 Ga0307413_10238592
984 Ga0307410_11045101
985 Ga0307406_10527221
986 Ga0307412_11780681
987 Ga0316583_10015512
988 Ga0316580_10054191
989 Ga0373939_0274975
990 Ga0373945_0069025
991 Ga0373946_0077239
992 Ga0373961_0210164
993 Ga0373962_0097976
994 Ga0373931_0024643
995 Ga0373935_0089753
996 Ga0373927_0766353
997 Ga0316582_0706051
998 Ga0316584_0210669
999 Ga0395899_0019749
1000 Ga0436364_0530473
1001 Ga0436364_0747645
1002 Ga0436360_0247471
1003 Ga0436360_1199555
1004 Ga0436361_0045550
1005 Ga0436363_1456083
1006 Ga0439453_0024997
1007 Ga0451802_0507537
1008 Ga0451841_1012353
1009 Ga0439435_0002941
1010 Ga0439459_0233306
1011 Ga0466966_0024751
1012 Ga0466961_0375228
1013 Ga0466971_0047201
1014 Ga0466957_0701650
1015 Ga0466959_0204156
1016 Ga0451576_1161003
1017 Ga0451576_2343035
1018 Ga0466958_0152517
1019 Ga0495617_241172
1020 Ga0495603_0000627
1021 Ga0495629_0007106
1022 Ga0495641_0007313
1023 Ga0495580_0000299
1024 Ga0495639_0002035
1025 Ga0495584_0026383
1026 Ga0495584_0400180
1027 Ga0495585_0109548
1028 Ga0495594_0000131
1029 Ga0495607_0387675
1030 Ga0495608_0473015
1031 Ga0495616_0133079
1032 Ga0495616_0278684
1033 Ga0495637_0101299
1034 Ga0495665_0002454
1035 Ga0495587_0066743
1036 Ga0495609_0349414
1037 Ga0495622_0004321
1038 Ga0495656_0017177
1039 Ga0495668_0474763
1040 Ga0495634_0017557
1041 Ga0495625_0221462
1042 Ga0495661_0253567
1043 Ga0495588_0000613
1044 Ga0495658_0002461
1045 Ga0495669_0506806
1046 Ga0495624_0177926
1047 Ga0495670_0807314
1048 Ga0495581_0000843
1049 Ga0495581_0598538
1050 Ga0495672_0099357
1051 Ga0495675_0513036
1052 Ga0495677_0048043
1053 Ga0495684_0485136
1054 Ga0495602_0266929
1055 Ga0495614_0000595
1056 Ga0496100_0088386
1057 Ga0496100_0230180
1058 Ga0496101_0275972
1059 Ga0496101_1155395
1060 Ga0496101_1186577
1061 Ga0496102_0003290
1062 Ga0496102_0009775
1063 Ga0496102_0114053
1064 Ga0496102_0450756
1065 Ga0496103_0003743
1066 Ga0496103_0008489
1067 Ga0496104_0023377
1068 Ga0496104_0306877
1069 Ga0496104_0735116
1070 Ga0496104_0837724
1071 Ga0496105_0315015
1072 Ga0496105_0728021
1073 Ga0496106_0013938
1074 Ga0496106_0023578
1075 Ga0496106_0070147
1076 Ga0496106_0264884
1077 Ga0496107_0001227
1078 Ga0496107_0024412
1079 Ga0496107_0058795
1080 Ga0496108_0117227
1081 Ga0496108_0189284
1082 Ga0496108_1011418
1083 Ga0496109_0011144
1084 Ga0496109_0023962
1085 Ga0496109_0063870
1086 Ga0496110_0093793
1087 Ga0496110_0484000
1088 Ga0496111_0359525
1089 Ga0496112_0012419
1090 Ga0496112_0229806
1091 Ga0496112_0904927
1092 Ga0496112_1084745
1093 Ga0496112_1127120
1094 Ga0496113_0065408
1095 Ga0496113_0211701
1096 Ga0496114_0006475
1097 Ga0496115_0065176
1098 Ga0496121_0686703
1099 Ga0496126_0301478
1100 Ga0496126_1022797
1101 Ga0501031_0038071
1102 Ga0501031_0496849
1103 Ga0501031_0961442
1104 Ga0501032_0025300
1105 Ga0501032_0193534
1106 Ga0501032_0406552
1107 Ga0501033_0111113
1108 Ga0501033_0603605
1109 Ga0501033_0687574
1110 Ga0501034_0004261
1111 Ga0501034_0005961
1112 Ga0501034_0018906
1113 Ga0501034_0231328
1114 Ga0501036_0070372
1115 Ga0501036_0094129
1116 Ga0501036_0171298
1117 Ga0501036_0179190
1118 Ga0501036_0380133
1119 Ga0501037_0352891
1120 Ga0501037_0477216
1121 Ga0501037_0822883
1122 Ga0501038_0011728
1123 Ga0501038_0062640
1124 Ga0501038_0110360
1125 Ga0501038_0339780
1126 Ga0501038_0398767
1127 Ga0501039_0042416
1128 Ga0501039_0061840
1129 Ga0501039_0089351
1130 Ga0501039_0178067
1131 Ga0501039_0183921
1132 Ga0501039_0733426
1133 Ga0501039_1398429
1134 Ga0501040_0027155
1135 Ga0501040_0085580
1136 Ga0501040_0090293
1137 Ga0501040_0249267
1138 Ga0501040_0290747
1139 Ga0501040_0652483
1140 Ga0501041_0017902
1141 Ga0501041_0320879
1142 Ga0501042_0087966
1143 Ga0501042_0093570
1144 Ga0501042_0109144
1145 Ga0501043_0037738
1146 Ga0501043_0079525
1147 Ga0501043_0127109
1148 Ga0501043_0176369
1149 Ga0501043_0179370
1150 Ga0501043_0491061
1151 Ga0501046_0005370
1152 Ga0501046_0043143
1153 Ga0501046_0065978
1154 Ga0501046_0112238
1155 Ga0501046_0210691
1156 Ga0501046_0494448
1157 Ga0501047_0102782
1158 Ga0501047_0129543
1159 Ga0501047_0154272
1160 Ga0501047_0179097
1161 Ga0501047_0310190
1162 Ga0501047_0329015
1163 Ga0501047_0406822
1164 Ga0501048_0012118
1165 Ga0501048_0019338
1166 Ga0501048_0094546
1167 Ga0501048_0210649
1168 Ga0501048_0263931
1169 Ga0501048_0673930
1170 Ga0501048_0716363
1171 Ga0501067_0001416
1172 Ga0501067_0046177
1173 Ga0501068_0056384
1174 Ga0501068_0149739
1175 Ga0501069_0431211
1176 Ga0501070_0211820
1177 Ga0501071_0189680
1178 Ga0501071_0281108
1179 Ga0501071_0350578
1180 Ga0501071_0390866
1181 Ga0501071_0842714
1182 Ga0501072_0014249
1183 Ga0501072_0108051
1184 Ga0501072_0547296
1185 Ga0501072_0821301
1186 Ga0501072_1039086
1187 Ga0501072_1116412
1188 Ga0501073_0014072
1189 Ga0501073_0146493
1190 Ga0501073_0194547
1191 Ga0501073_0295487
1192 Ga0501073_0400517
1193 Ga0501073_0530605
1194 Ga0501074_0035756
1195 Ga0501074_0056825
1196 Ga0501074_0168670
1197 Ga0501074_0367731
1198 Ga0501074_0699541
1199 Ga0501075_0171395
1200 Ga0501075_0453870
1201 Ga0501075_0765425
1202 Ga0501075_1548174
1203 Ga0501076_0029662
1204 Ga0501076_0040748
1205 Ga0501076_0098084
1206 Ga0501076_0177808
1207 Ga0501076_0211185
1208 Ga0501076_0412659
1209 Ga0501076_0556244
1210 Ga0501076_1138538
1211 Ga0501076_1492929
1212 Ga0501077_0012381
1213 Ga0501077_0068503
1214 Ga0501077_0103895
1215 Ga0501077_0166759
1216 Ga0501077_0185905
1217 Ga0501077_0195592
1218 Ga0501077_0703827
1219 Ga0501079_0014826
1220 Ga0501079_0088493
1221 Ga0501079_0210132
1222 Ga0501079_0211701
1223 Ga0501079_0263041
1224 Ga0501080_0492198
1225 Ga0501080_0627889
1226 Ga0501080_0831263
1227 Ga0501080_1001771
1228 Ga0501080_1297626
1229 Ga0501081_0003077
1230 Ga0501081_0012801
1231 Ga0501081_0043930
1232 Ga0501081_0110113
1233 Ga0501081_0117405
1234 Ga0501081_1351364
1235 Ga0501083_0003409
1236 Ga0501083_0014402
1237 Ga0501083_0045435
1238 Ga0501083_0099967
1239 Ga0501083_0129767
1240 Ga0501083_0249577
1241 Ga0501083_0327259
1242 Ga0501083_0366336
1243 Ga0501280_003723
1244 Ga0501035_0034629
1245 Ga0501035_0094712
1246 Ga0501035_0211090
1247 Ga0501035_0328378
1248 Ga0501044_0028936
1249 Ga0501044_0056089
1250 Ga0501044_0212229
1251 Ga0501044_0289188
1252 Ga0501044_0335099
1253 Ga0501044_0444007
1254 Ga0501044_1044403
1255 Ga0501045_0022567
1256 Ga0501045_0049850
1257 Ga0501045_0168582
1258 Ga0501045_0545046
1259 nmdc:mga05p37_1445357_c1
1260 nmdc:mga05p37_354393_c1
1261 nmdc:mga05p37_562706_c1
1262 nmdc:mga0qj67_555104_c1
1263 nmdc:mga0qj67_8450_c1
1264 nmdc:mga06r32_1315_c1
1265 nmdc:mga06r32_404575_c1
1266 nmdc:mga08y16_114430_c1
1267 nmdc:mga08y16_328932_c1
1268 nmdc:mga0n895_348068_c1
1269 nmdc:mga0rr50_1141444_c1
1270 nmdc:mga0a205_489308_c1
1271 nmdc:mga0a205_75071_c1
1272 Ga0495612_0146744
1273 Ga0495612_0211089
1274 Ga0495655_0083809
1275 Ga0495619_0004904
1276 Ga0495619_0046494
1277 Ga0500583_0124548
1278 Ga0500651_0296726
1279 Ga0500566_0062953
1280 Ga0500641_0079550
1281 Ga0500554_081610
1282 Ga0500555_116509
1283 Ga0500556_0000903
1284 Ga0500562_019830
1285 Ga0500595_030648
1286 Ga0500642_0058722
1287 Ga0500573_0000050
1288 Ga0500588_0135843
1289 Ga0500616_0000139
1290 Ga0500616_0013071
1291 Ga0500627_0134264
1292 Ga0501084_0009497
1293 Ga0501084_0048742
1294 Ga0501084_0080943
1295 Ga0501084_0211690
1296 Ga0501084_0335243
1297 Ga0501084_0490384
1298 Ga0501084_1611793
1299 Ga0501082_0007775
1300 Ga0501082_0020366
1301 Ga0501082_0078325
1302 Ga0501082_0192855
1303 Ga0501082_0405337
1304 Ga0501082_0515768
1305 Ga0501082_0540745
1306 Ga0501082_0668604
1307 Ga0501082_1122709
1308 Ga0501082_1133969
1309 Ga0501082_1562402
1310 Ga0501082_1612446
1311 Ga0530510_0020365
1312 Ga0530510_0035380
1313 Ga0530510_0713812
1314 2511171774
1315 2585199256
1316 2585995045
1317 2585999589
1318 2587919690
1319 2616298206
1320 2643855923
1321 2644226376
1322 2644235864
1323 2792459614
1324 2819684196
1325 2842334773
1326 2843747269
1327 2849560808
1328 2849574326
1329 2851158048
1330 2883357569
1331 2884963926
1332 2898333438
1333 2919167311
1334 2919171497
1335 2978973744
1336 2984592015
1337 8005251382
1338 8018131281
1339 8054461845
1340 8054568500

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

4

121

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qmn-assembly1.cif.gz_B crystal structure of 4'-phosphopantetheinyl transferase acps from vibrio cholerae o1 biovar eltor 0.9391 1 128
5xuh-assembly1.cif.gz_C crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa 0.9265 1 128
2was-assembly2.cif.gz_E structure of the fungal type i fas ppt domain 0.921 4 128
5xu7-assembly1.cif.gz_C crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) 0.9209 1 128
3qmn-assembly1.cif.gz_B crystal structure of 4'-phosphopantetheinyl transferase acps from vibrio cholerae o1 biovar eltor 0.9178 1 128
ID Description Score Start End Superfamily
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9092 1 128 3.90.470.20
5xukA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8987 5 128 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8948 1 128 3.90.470.20
2wasC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8893 4 128 3.90.470.20
2wdyA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.886 2 127 3.90.470.20
ID Description Score Start End GO Terms
AF-A0A1E4ATP7-F1-model_v4 deleted 0.9981 1 115
AF-A0A397KZG9-F1-model_v4 deleted 0.9941 1 132
AF-A0A525KPW6-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9932 1 132 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A257J4Q7-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9929 1 132 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A7R7YEP3-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9926 1 133 GO:0000287
GO:0005737
GO:0006633
GO:0008897

Map