F474104

General Info

Members Datasets Scaffolds Average Seq Length
670 390 1340 324

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0091814|Ga0395901_0091814_1092_2183
Length 363
Sequence VLFFFAIARVPTTTSGQKIADYPRFLQRWMYMKFRKIGVLLGGLSSERDVSLRTGEAVLEALRARGHEAVPIYVDHDVDIALRQEQIDVAFIALHGRWGEDGCIQGLLELQGIPYTGSDVMSSALAMHKGKAKELFRLHNLPTPAYYTLAPEDCADLPGVHGDFGFPCVVKPIREGSSVGVTICHTLDDLGPAVERAFAFDDEVLVERFISGKEISVAVLGDRALGAVEIAPREGFYDYQNKYTRGATDYFVPPRLSPERYRGVLAQALRAHIALGCHGATRVDMMVSESGNEYILEVNTVPGLTPTSLLPKIADAAGISFGELCELMLAGASLSSRRGRGERRVVQRTFVGEDRREPAPPAH

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
202 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
210 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
224 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
227 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
228 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
229 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
230 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
257 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
268 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
269 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
270 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
271 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
272 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
273 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
274 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
275 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
276 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
277 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
278 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
304 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
305 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
306 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
307 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
308 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
309 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
310 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
311 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
312 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
313 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
314 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
315 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
316 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
317 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
318 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
319 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
320 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
321 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
322 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
323 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
324 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
325 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
326 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
327 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
328 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
329 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
330 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
331 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
332 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
337 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
338 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
339 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
340 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
341 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
342 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
343 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
344 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
345 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
346 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
347 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
352 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
359 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
360 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
361 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
362 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
363 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
364 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
365 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
366 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
367 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
368 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
369 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
370 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
371 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
372 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
373 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
374 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
375 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
376 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
377 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
378 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
379 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
380 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
381 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
382 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
383 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
384 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
385 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
386 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
387 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
388 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.88
Nodule 0
Rhizoplane 0.6
Rhizosphere 91.94
Stem 0
Stem Tuber 0
Unclassified 11.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0091814 3300038443 Bacteria 3178
2 MBSR1b_contig_13535307 2162886012 Unclassified 1268
3 JGI24746J21847_1003444 3300001977 Unclassified 2490
4 JGI24737J22298_10032482 3300001990 Unclassified 1625
5 JGI24743J22301_10000044 3300001991 Bacteria 11132
6 JGI24738J21930_10015755 3300002075 Unclassified 1603
7 JGI24035J26624_1001644 3300002126 Unclassified 2102
8 JGI24033J26618_1000066 3300002155 Bacteria 15346
9 rootH2_10011145 3300003320 Bacteria 22144
10 rootL2_10039822 3300003322 Bacteria 2025
11 rootL2_10074460 3300003322 Bacteria 2868
12 rootL2_10156277 3300003322 Bacteria 2243
13 rootL2_10186783 3300003322 Bacteria 5939
14 rootH1_10001752 3300003323 Bacteria 14969
15 Ga0055530_10014664 3300003791 Bacteria 2598
16 Ga0065707_10027286 3300005295 Bacteria 1901
17 Ga0065707_10099442 3300005295 Bacteria 3006
18 Ga0065707_10100377 3300005295 Unclassified 2933
19 Ga0070658_10032927 3300005327 Bacteria 4168
20 Ga0070676_10001419 3300005328 Bacteria 12100
21 Ga0070676_10064494 3300005328 Unclassified 2184
22 Ga0070690_100000348 3300005330 Bacteria 23853
23 Ga0070690_100015663 3300005330 Bacteria 4529
24 Ga0070690_100027931 3300005330 Bacteria 3492
25 Ga0070690_100030630 3300005330 Bacteria 3345
26 Ga0070670_100015844 3300005331 Bacteria 6469
27 Ga0070670_100206980 3300005331 Bacteria 1705
28 Ga0070677_10030097 3300005333 Bacteria 2064
29 Ga0068869_100086837 3300005334 Unclassified 2346
30 Ga0068869_100091429 3300005334 Bacteria 2289
31 Ga0070666_10012329 3300005335 Bacteria 5389
32 Ga0070680_100004415 3300005336 Bacteria 10586
33 Ga0070680_100031682 3300005336 Bacteria 4252
34 Ga0070680_100033394 3300005336 Bacteria 4147
35 Ga0070682_100016500 3300005337 Bacteria 4294
36 Ga0070682_100063363 3300005337 Bacteria 2344
37 Ga0070682_100082376 3300005337 Bacteria 2085
38 Ga0068868_100019130 3300005338 Bacteria 5129
39 Ga0068868_100038099 3300005338 Bacteria 3731
40 Ga0070660_100029788 3300005339 Bacteria 4092
41 Ga0070689_100000090 3300005340 Bacteria 52338
42 Ga0070689_100001519 3300005340 Bacteria 14805
43 Ga0070689_100004336 3300005340 Bacteria 9572
44 Ga0070689_100009358 3300005340 Bacteria 6943
45 Ga0070689_100129152 3300005340 Bacteria 2025
46 Ga0070687_100001354 3300005343 Bacteria 8602
47 Ga0070687_100023969 3300005343 Bacteria 2906
48 Ga0070687_100027515 3300005343 Bacteria 2748
49 Ga0070661_100000479 3300005344 Bacteria 30510
50 Ga0070661_100018849 3300005344 Bacteria 4912
51 Ga0070692_10054249 3300005345 Bacteria 2092
52 Ga0070668_100013058 3300005347 Bacteria 6187
53 Ga0070668_100071182 3300005347 Unclassified 2709
54 Ga0070668_100147751 3300005347 Bacteria 1898
55 Ga0070669_100007357 3300005353 Bacteria 7896
56 Ga0070669_100014808 3300005353 Bacteria 5553
57 Ga0070675_100013175 3300005354 Bacteria 6497
58 Ga0070675_100041338 3300005354 Bacteria 3766
59 Ga0070675_100157950 3300005354 Bacteria 1948
60 Ga0070671_100514142 3300005355 Bacteria 1031
61 Ga0070674_100000394 3300005356 Bacteria 21894
62 Ga0070673_100139017 3300005364 Unclassified 2047
63 Ga0070688_100000135 3300005365 Bacteria 39766
64 Ga0070688_100002702 3300005365 Bacteria 8996
65 Ga0070688_100045669 3300005365 Bacteria 2708
66 Ga0070688_100269889 3300005365 Bacteria 1218
67 Ga0070659_100000985 3300005366 Bacteria 20906
68 Ga0070659_100019927 3300005366 Bacteria 5091
69 Ga0070667_100056590 3300005367 Bacteria 3313
70 Ga0070710_10068984 3300005437 Bacteria 2033
71 Ga0070701_10045184 3300005438 Unclassified 2259
72 Ga0070701_10080414 3300005438 Bacteria 1763
73 Ga0070705_100006180 3300005440 Bacteria 5865
74 Ga0070705_100038236 3300005440 Bacteria 2713
75 Ga0070705_100060010 3300005440 Bacteria 2254
76 Ga0070700_100000257 3300005441 Bacteria 28570
77 Ga0070700_100173444 3300005441 Bacteria 1495
78 Ga0070694_100006125 3300005444 Bacteria 7296
79 Ga0070694_100012346 3300005444 Bacteria 5307
80 Ga0070694_100112811 3300005444 Bacteria 1939
81 Ga0070694_100171004 3300005444 Bacteria 1601
82 Ga0070708_100104158 3300005445 Bacteria 2602
83 Ga0070663_100247157 3300005455 Unclassified 1411
84 Ga0070678_100002606 3300005456 Bacteria 9915
85 Ga0070678_100151009 3300005456 Bacteria 1871
86 Ga0070662_100003227 3300005457 Bacteria 10137
87 Ga0070681_10001753 3300005458 Bacteria 19441
88 Ga0070681_10003614 3300005458 Bacteria 14505
89 Ga0070681_10049211 3300005458 Bacteria 4210
90 Ga0070681_10218431 3300005458 Bacteria 1822
91 Ga0070681_10253915 3300005458 Bacteria 1670
92 Ga0068867_100001546 3300005459 Bacteria 15988
93 Ga0068867_100002470 3300005459 Bacteria 13001
94 Ga0068867_100170770 3300005459 Bacteria 1722
95 Ga0070685_10000073 3300005466 Bacteria 59457
96 Ga0070685_10001193 3300005466 Bacteria 13886
97 Ga0070685_10075920 3300005466 Unclassified 2003
98 Ga0070706_100000878 3300005467 Bacteria 33009
99 Ga0070706_100002645 3300005467 Bacteria 17929
100 Ga0070706_100021603 3300005467 Bacteria 5926
101 Ga0070706_100031624 3300005467 Bacteria 4880
102 Ga0070707_100000018 3300005468 Bacteria 137542
103 Ga0070707_100024642 3300005468 Bacteria 5700
104 Ga0070707_100037631 3300005468 Bacteria 4618
105 Ga0070707_100162323 3300005468 Unclassified 2177
106 Ga0070707_100489467 3300005468 Unclassified 1191
107 Ga0070698_100000114 3300005471 Bacteria 68309
108 Ga0070698_100011560 3300005471 Bacteria 9365
109 Ga0070698_100082096 3300005471 Bacteria 3216
110 Ga0070698_100142901 3300005471 Bacteria 2344
111 Ga0070698_100164837 3300005471 Bacteria 2159
112 Ga0070698_100335125 3300005471 Bacteria 1444
113 Ga0070699_100005710 3300005518 Bacteria 10898
114 Ga0070699_100070201 3300005518 Bacteria 3045
115 Ga0070699_100082524 3300005518 Bacteria 2802
116 Ga0070679_100001459 3300005530 Bacteria 20941
117 Ga0070679_100047591 3300005530 Bacteria 4273
118 Ga0070684_100078633 3300005535 Bacteria 2914
119 Ga0070684_100503871 3300005535 Bacteria 1121
120 Ga0070697_100089572 3300005536 Bacteria 2542
121 Ga0070697_100090641 3300005536 Bacteria 2527
122 Ga0070672_100006069 3300005543 Bacteria 8075
123 Ga0070686_100000089 3300005544 Bacteria 64287
124 Ga0070686_100004655 3300005544 Bacteria 7568
125 Ga0070686_100010699 3300005544 Bacteria 5185
126 Ga0070695_100007325 3300005545 Bacteria 6540
127 Ga0070695_100015463 3300005545 Unclassified 4609
128 Ga0070695_100150832 3300005545 Bacteria 1622
129 Ga0070695_100248110 3300005545 Unclassified 1294
130 Ga0070696_100047305 3300005546 Bacteria 2985
131 Ga0070693_100041818 3300005547 Unclassified 2580
132 Ga0070665_100002307 3300005548 Bacteria 21174
133 Ga0070704_100027484 3300005549 Bacteria 3775
134 Ga0070704_100054340 3300005549 Unclassified 2834
135 Ga0070704_100070773 3300005549 Bacteria 2532
136 Ga0070704_100080429 3300005549 Bacteria 2397
137 Ga0068855_100174913 3300005563 Bacteria 2430
138 Ga0068855_100392142 3300005563 Bacteria 1523
139 Ga0070664_100006608 3300005564 Bacteria 9349
140 Ga0070664_100021093 3300005564 Bacteria 5367
141 Ga0068857_100059905 3300005577 Unclassified 3383
142 Ga0068856_100000537 3300005614 Bacteria 41817
143 Ga0068856_100058687 3300005614 Bacteria 3801
144 Ga0068856_100186254 3300005614 Bacteria 2090
145 Ga0068859_100002892 3300005617 Bacteria 17446
146 Ga0068859_100119805 3300005617 Bacteria 2698
147 Ga0068859_100400751 3300005617 Bacteria 1468
148 Ga0068864_100175150 3300005618 Bacteria 1958
149 Ga0068866_10054688 3300005718 Bacteria 2046
150 Ga0068861_100163883 3300005719 Bacteria 1836
151 Ga0068861_100218688 3300005719 Bacteria 1609
152 Ga0068861_100369053 3300005719 Bacteria 1264
153 Ga0068858_100135974 3300005842 Bacteria 2306
154 Ga0068860_100017638 3300005843 Bacteria 6955
155 Ga0068860_100245921 3300005843 Unclassified 1741
156 Ga0068862_100007910 3300005844 Bacteria 8794
157 Ga0068862_100021260 3300005844 Bacteria 5423
158 Ga0068862_100164946 3300005844 Bacteria 1980
159 Ga0068862_100347006 3300005844 Bacteria 1376
160 Ga0081455_10000594 3300005937 Bacteria 46883
161 Ga0070717_10024090 3300006028 Bacteria 4830
162 Ga0075432_10001979 3300006058 Bacteria 6811
163 Ga0070715_10035796 3300006163 Bacteria 2044
164 Ga0097621_100009427 3300006237 Bacteria 7083
165 Ga0097621_100037112 3300006237 Bacteria 3902
166 Ga0068871_100005816 3300006358 Bacteria 8666
167 Ga0068871_100110325 3300006358 Unclassified 2313
168 Ga0075428_100256170 3300006844 Bacteria 1885
169 Ga0075428_100295348 3300006844 Unclassified 1742
170 Ga0075430_100001325 3300006846 Bacteria 19981
171 Ga0075430_100001910 3300006846 Bacteria 17094
172 Ga0075431_100003065 3300006847 Bacteria 16180
173 Ga0075433_10002999 3300006852 Bacteria 12967
174 Ga0075433_10076304 3300006852 Bacteria 2951
175 Ga0075433_10111981 3300006852 Unclassified 2421
176 Ga0075433_10214902 3300006852 Bacteria 1709
177 Ga0075434_100050376 3300006871 Unclassified 4137
178 Ga0075434_100119547 3300006871 Bacteria 2649
179 Ga0075434_100141571 3300006871 Unclassified 2425
180 Ga0075434_100473178 3300006871 Bacteria 1274
181 Ga0075429_100001252 3300006880 Bacteria 20630
182 Ga0075429_100005851 3300006880 Bacteria 10609
183 Ga0075429_100082207 3300006880 Bacteria 2807
184 Ga0075429_100098362 3300006880 Unclassified 2553
185 Ga0075429_100144221 3300006880 Unclassified 2084
186 Ga0068865_100004478 3300006881 Bacteria 8429
187 Ga0068865_100010331 3300006881 Bacteria 5807
188 Ga0075436_100149379 3300006914 Bacteria 1644
189 Ga0097620_100002892 3300006931 Bacteria 17446
190 Ga0097620_100119801 3300006931 Bacteria 2698
191 Ga0097620_100400764 3300006931 Bacteria 1468
192 Ga0075435_100045650 3300007076 Bacteria 3513
193 Ga0075435_100097970 3300007076 Bacteria 2427
194 Ga0111539_10007846 3300009094 Bacteria 13632
195 Ga0111539_10012258 3300009094 Bacteria 10751
196 Ga0111539_10260481 3300009094 Bacteria 2019
197 Ga0111539_10497852 3300009094 Bacteria 1419
198 Ga0105245_10000099 3300009098 Bacteria 83865
199 Ga0105245_10029838 3300009098 Bacteria 4821
200 Ga0105245_10118545 3300009098 Unclassified 2470
201 Ga0105245_10252055 3300009098 Bacteria 1715
202 Ga0114129_10023328 3300009147 Bacteria 8777
203 Ga0114129_10067741 3300009147 Bacteria 4977
204 Ga0114129_10106309 3300009147 Bacteria 3877
205 Ga0114129_10126336 3300009147 Bacteria 3516
206 Ga0114129_10279486 3300009147 Bacteria 2231
207 Ga0105243_10004891 3300009148 Bacteria 10511
208 Ga0105241_10040792 3300009174 Bacteria 3505
209 Ga0105242_10013265 3300009176 Bacteria 6363
210 Ga0105242_10045229 3300009176 Bacteria 3567
211 Ga0105242_10087944 3300009176 Unclassified 2609
212 Ga0105248_10000908 3300009177 Bacteria 33049
213 Ga0105249_10007377 3300009553 Bacteria 9591
214 Ga0105249_10048253 3300009553 Bacteria 3882
215 Ga0105249_10148930 3300009553 Bacteria 2251
216 Ga0105239_10001416 3300010375 Bacteria 31991
217 Ga0105239_10005383 3300010375 Bacteria 15034
218 Ga0105239_10022606 3300010375 Bacteria 6933
219 Ga0105239_10231783 3300010375 Bacteria 2072
220 Ga0105246_10000200 3300011119 Bacteria 30052
221 Ga0105246_10110679 3300011119 Unclassified 2017
222 Ga0157369_10036432 3300013105 Bacteria 5389
223 Ga0157374_10011253 3300013296 Bacteria 7740
224 Ga0157374_10036693 3300013296 Bacteria 4492
225 Ga0157374_10128846 3300013296 Unclassified 2447
226 Ga0157374_10189801 3300013296 Bacteria 2010
227 Ga0157378_10000857 3300013297 Bacteria 28196
228 Ga0157378_10011945 3300013297 Bacteria 7603
229 Ga0157378_10013383 3300013297 Bacteria 7170
230 Ga0163162_10005848 3300013306 Bacteria 11898
231 Ga0163162_10192709 3300013306 Bacteria 2166
232 Ga0157375_10002941 3300013308 Bacteria 14773
233 Ga0157375_10103480 3300013308 Bacteria 2934
234 Ga0157375_10189802 3300013308 Bacteria 2209
235 Ga0163163_10199296 3300014325 Bacteria 2050
236 Ga0157380_10014684 3300014326 Bacteria 5735
237 Ga0157380_10240263 3300014326 Bacteria 1632
238 Ga0157377_10019343 3300014745 Bacteria 3557
239 Ga0157376_10003733 3300014969 Bacteria 10522
240 Ga0157376_10055439 3300014969 Bacteria 3307
241 Ga0157376_10192628 3300014969 Bacteria 1870
242 Ga0213876_10028194 3300021384 Bacteria 2959
243 Ga0209050_1000908 3300025298 Bacteria 39172
244 Ga0207697_10000198 3300025315 Bacteria 32108
245 Ga0207642_10037612 3300025899 Bacteria 2087
246 Ga0207688_10003742 3300025901 Bacteria 8302
247 Ga0207688_10004420 3300025901 Bacteria 7651
248 Ga0207699_10151304 3300025906 Bacteria 1536
249 Ga0207645_10000634 3300025907 Bacteria 29170
250 Ga0207645_10001133 3300025907 Bacteria 22060
251 Ga0207705_10110184 3300025909 Bacteria 2034
252 Ga0207684_10000198 3300025910 Bacteria 95038
253 Ga0207654_10034950 3300025911 Bacteria 2796
254 Ga0207707_10010179 3300025912 Bacteria 8161
255 Ga0207707_10269655 3300025912 Bacteria 1475
256 Ga0207660_10012261 3300025917 Bacteria 5603
257 Ga0207660_10014792 3300025917 Bacteria 5142
258 Ga0207660_10125724 3300025917 Bacteria 1947
259 Ga0207662_10007367 3300025918 Bacteria 5987
260 Ga0207662_10025917 3300025918 Bacteria 3379
261 Ga0207662_10280271 3300025918 Bacteria 1103
262 Ga0207657_10005985 3300025919 Bacteria 12658
263 Ga0207649_10000427 3300025920 Bacteria 30819
264 Ga0207649_10116466 3300025920 Unclassified 1794
265 Ga0207652_10017078 3300025921 Bacteria 5936
266 Ga0207652_10126027 3300025921 Bacteria 2281
267 Ga0207652_10219239 3300025921 Bacteria 1714
268 Ga0207646_10000072 3300025922 Bacteria 141756
269 Ga0207646_10043660 3300025922 Bacteria 4025
270 Ga0207681_10001480 3300025923 Bacteria 15139
271 Ga0207650_10118955 3300025925 Unclassified 2054
272 Ga0207650_10277150 3300025925 Bacteria 1365
273 Ga0207659_10027546 3300025926 Bacteria 3849
274 Ga0207659_10084688 3300025926 Unclassified 2353
275 Ga0207659_10168936 3300025926 Bacteria 1724
276 Ga0207687_10000774 3300025927 Bacteria 21584
277 Ga0207687_10136843 3300025927 Bacteria 1853
278 Ga0207690_10054181 3300025932 Bacteria 2695
279 Ga0207706_10000702 3300025933 Bacteria 35016
280 Ga0207706_10003909 3300025933 Bacteria 14140
281 Ga0207686_10005846 3300025934 Bacteria 6601
282 Ga0207670_10000032 3300025936 Bacteria 112426
283 Ga0207670_10000177 3300025936 Bacteria 42462
284 Ga0207670_10104866 3300025936 Bacteria 2026
285 Ga0207669_10035894 3300025937 Bacteria 2826
286 Ga0207669_10287622 3300025937 Bacteria 1243
287 Ga0207704_10011387 3300025938 Bacteria 4377
288 Ga0207704_10111776 3300025938 Bacteria 1848
289 Ga0207665_10060502 3300025939 Bacteria 2565
290 Ga0207665_10064074 3300025939 Bacteria 2497
291 Ga0207691_10000182 3300025940 Bacteria 59433
292 Ga0207711_10001788 3300025941 Bacteria 19690
293 Ga0207689_10072905 3300025942 Bacteria 2821
294 Ga0207689_10283640 3300025942 Bacteria 1371
295 Ga0207689_10325226 3300025942 Bacteria 1276
296 Ga0207661_10025410 3300025944 Bacteria 4502
297 Ga0207661_10032917 3300025944 Bacteria 4021
298 Ga0207679_10004180 3300025945 Bacteria 8971
299 Ga0207651_10116819 3300025960 Unclassified 2014
300 Ga0207651_10225689 3300025960 Bacteria 1517
301 Ga0207712_10052076 3300025961 Bacteria 2866
302 Ga0207712_10053359 3300025961 Bacteria 2835
303 Ga0207668_10006913 3300025972 Bacteria 6731
304 Ga0207668_10122064 3300025972 Unclassified 1974
305 Ga0207658_10008718 3300025986 Bacteria 6889
306 Ga0207703_10151607 3300026035 Unclassified 2022
307 Ga0207708_10000291 3300026075 Bacteria 39366
308 Ga0207708_10000413 3300026075 Bacteria 33516
309 Ga0207708_10151599 3300026075 Bacteria 1825
310 Ga0207702_10003806 3300026078 Bacteria 13620
311 Ga0207702_10150471 3300026078 Bacteria 2117
312 Ga0207702_10208654 3300026078 Bacteria 1815
313 Ga0207641_10127302 3300026088 Bacteria 2282
314 Ga0207648_10000101 3300026089 Bacteria 82654
315 Ga0207648_10085747 3300026089 Bacteria 2747
316 Ga0207676_10061252 3300026095 Bacteria 2979
317 Ga0207676_10340249 3300026095 Bacteria 1384
318 Ga0207674_10004318 3300026116 Bacteria 17135
319 Ga0207674_10313947 3300026116 Bacteria 1517
320 Ga0207675_100074130 3300026118 Bacteria 3185
321 Ga0207675_100134666 3300026118 Bacteria 2343
322 Ga0207675_100200856 3300026118 Bacteria 1915
323 Ga0207683_10000229 3300026121 Bacteria 49529
324 Ga0207683_10028708 3300026121 Bacteria 4812
325 Ga0209973_1000239 3300027252 Unclassified 3754
326 Ga0209969_1002389 3300027360 Bacteria 2596
327 Ga0209967_1000547 3300027364 Bacteria 4941
328 Ga0209981_1002105 3300027378 Unclassified 2535
329 Ga0209984_1000006 3300027424 Bacteria 23947
330 Ga0210000_1000032 3300027462 Bacteria 21476
331 Ga0209982_1000705 3300027552 Unclassified 4261
332 Ga0209970_1006254 3300027614 Bacteria 1950
333 Ga0209970_1007538 3300027614 Unclassified 1784
334 Ga0210002_1000061 3300027617 Bacteria 16870
335 Ga0209983_1000874 3300027665 Bacteria 6639
336 Ga0209971_1000642 3300027682 Bacteria 9100
337 Ga0209966_1000016 3300027695 Bacteria 73256
338 Ga0209998_10000021 3300027717 Bacteria 70520
339 Ga0209998_10019074 3300027717 Bacteria 1460
340 Ga0209974_10000003 3300027876 Bacteria 65938
341 Ga0209974_10000265 3300027876 Bacteria 16988
342 Ga0207428_10001120 3300027907 Bacteria 29155
343 Ga0207428_10006333 3300027907 Bacteria 10944
344 Ga0268266_10044738 3300028379 Bacteria 3785
345 Ga0268265_10013370 3300028380 Bacteria 5577
346 Ga0268265_10028020 3300028380 Bacteria 4029
347 Ga0268265_10311647 3300028380 Bacteria 1421
348 Ga0268264_10398558 3300028381 Bacteria 1322
349 Ga0265326_10005513 3300028558 Bacteria 3990
350 Ga0307517_10031500 3300028786 Bacteria 6169
351 Ga0307515_10015000 3300028794 Bacteria 14315
352 Ga0265338_10030516 3300028800 Bacteria 5309
353 Ga0265338_10087690 3300028800 Bacteria 2584
354 Ga0265338_10203924 3300028800 Bacteria 1489
355 Ga0265332_10020875 3300031238 Bacteria 2893
356 Ga0265320_10083479 3300031240 Bacteria 1489
357 Ga0265339_10020303 3300031249 Unclassified 3883
358 Ga0265316_10000230 3300031344 Bacteria 64801
359 Ga0265316_10001169 3300031344 Bacteria 28394
360 Ga0307513_10010635 3300031456 Bacteria 11512
361 Ga0307513_10186517 3300031456 Bacteria 1931
362 Ga0307509_10000007 3300031507 Bacteria 409278
363 Ga0307509_10010793 3300031507 Bacteria 11136
364 Ga0307509_10100579 3300031507 Bacteria 2929
365 Ga0307509_10128720 3300031507 Bacteria 2492
366 Ga0307509_10136421 3300031507 Bacteria 2398
367 Ga0307408_100038453 3300031548 Bacteria 3376
368 Ga0316579_10003565 3300031691 Bacteria 6099
369 Ga0265342_10000265 3300031712 Bacteria 58679
370 Ga0265342_10031378 3300031712 Bacteria 3285
371 Ga0316576_10000591 3300031727 Bacteria 17316
372 Ga0316576_10011115 3300031727 Bacteria 5881
373 Ga0307516_10013815 3300031730 Bacteria 8574
374 Ga0307516_10114082 3300031730 Bacteria 2499
375 Ga0307405_10010594 3300031731 Bacteria 4790
376 Ga0307413_10017077 3300031824 Bacteria 3771
377 Ga0307410_10050917 3300031852 Bacteria 2788
378 Ga0307406_10003927 3300031901 Bacteria 8080
379 Ga0307406_10052376 3300031901 Bacteria 2595
380 Ga0307407_10005289 3300031903 Bacteria 5582
381 Ga0307412_10000625 3300031911 Bacteria 20667
382 Ga0307409_100124325 3300031995 Bacteria 2191
383 Ga0307416_100294136 3300032002 Bacteria 1609
384 Ga0307414_10009229 3300032004 Bacteria 5654
385 Ga0307411_10008204 3300032005 Bacteria 5391
386 Ga0307415_100060451 3300032126 Unclassified 2618
387 Ga0307415_100115272 3300032126 Bacteria 2002
388 Ga0307415_100131256 3300032126 Bacteria 1897
389 Ga0373934_0000962 3300035086 Bacteria 10441
390 Ga0373934_0059328 3300035086 Unclassified 1523
391 Ga0373940_0035055 3300035088 Unclassified 1357
392 Ga0373949_0001386 3300035090 Bacteria 6967
393 Ga0373923_0020394 3300035111 Bacteria 2575
394 Ga0373936_0000035 3300035113 Bacteria 108166
395 Ga0373936_0085388 3300035113 Unclassified 1318
396 Ga0373941_0015901 3300035115 Bacteria 2037
397 Ga0373956_0059763 3300035119 Bacteria 1725
398 Ga0373957_0009657 3300035120 Bacteria 3162
399 Ga0373955_0008648 3300035172 Bacteria 4737
400 Ga0373961_0000020 3300035241 Bacteria 100658
401 Ga0316574_0072511 3300035398 Bacteria 2176
402 Ga0373924_0027753 3300035410 Bacteria 2252
403 Ga0373931_0040788 3300035691 Bacteria 2437
404 Ga0373935_0012043 3300035692 Bacteria 5199
405 Ga0373933_0004953 3300035724 Bacteria 7261
406 Ga0373933_0007058 3300035724 Bacteria 6121
407 Ga0373933_0069486 3300035724 Bacteria 2141
408 Ga0373947_0016709 3300035725 Bacteria 4216
409 Ga0373937_0031486 3300036401 Bacteria 4807
410 Ga0373937_0040042 3300036401 Bacteria 4271
411 Ga0373937_0079996 3300036401 Bacteria 3021
412 Ga0316582_0075916 3300036647 Bacteria 2184
413 Ga0316582_0218205 3300036647 Bacteria 1304
414 Ga0316584_0000325 3300036712 Bacteria 24471
415 Ga0316584_0091412 3300036712 Bacteria 2279
416 Ga0373925_0070936 3300037068 Bacteria 2634
417 Ga0373925_0154412 3300037068 Bacteria 1805
418 Ga0395899_0000015 3300037312 Bacteria 470061
419 Ga0395899_0004859 3300037312 Bacteria 10469
420 Ga0395900_0044586 3300037418 Bacteria 4568
421 Ga0395898_0000051 3300037466 Bacteria 281872
422 Ga0395898_0139593 3300037466 Bacteria 2320
423 Ga0316581_0073691 3300037588 Bacteria 1049
424 Ga0400483_005312 3300039062 Bacteria 2420
425 Ga0400483_224315 3300039062 Bacteria 8658
426 Ga0436365_0014080 3300039437 Bacteria 1413
427 Ga0439439_0015824 3300041406 Bacteria 1844
428 Ga0439461_0037611 3300041410 Bacteria 1034
429 Ga0439466_0017981 3300041411 Bacteria 2540
430 Ga0439450_042759 3300042008 Bacteria 1057
431 Ga0439452_004979 3300042010 Bacteria 4350
432 Ga0451577_0053435 3300042876 Bacteria 3606
433 Ga0451577_0180898 3300042876 Unclassified 1901
434 Ga0451577_0223564 3300042876 Bacteria 1702
435 Ga0451577_0521500 3300042876 Unclassified 1079
436 Ga0466965_0007338 3300044683 Bacteria 5056
437 Ga0453684_0331514 3300044712 Bacteria 1721
438 Ga0466971_0000025 3300044719 Bacteria 62833
439 Ga0451576_0001765 3300045051 Bacteria 35474
440 Ga0451576_0019910 3300045051 Bacteria 7315
441 Ga0451576_0093757 3300045051 Bacteria 3121
442 Ga0451576_0713558 3300045051 Bacteria 1053
443 Ga0466967_0220246 3300045976 Bacteria 1803
444 Ga0495592_0005931 3300046454 Bacteria 9069
445 Ga0495603_0079418 3300046455 Bacteria 1923
446 Ga0495629_0013291 3300046459 Bacteria 5941
447 Ga0495653_0062353 3300046463 Bacteria 2817
448 Ga0495580_0115243 3300046472 Bacteria 1867
449 Ga0495594_0002228 3300046499 Bacteria 10084
450 Ga0495594_0025000 3300046499 Bacteria 3209
451 Ga0495608_0012150 3300046511 Bacteria 5984
452 Ga0495628_0007531 3300046516 Bacteria 9414
453 Ga0495628_0216051 3300046516 Bacteria 1441
454 Ga0495630_0444302 3300046517 Bacteria 994
455 Ga0495632_0066854 3300046519 Bacteria 1734
456 Ga0495637_0036110 3300046520 Unclassified 2155
457 Ga0495652_0158488 3300046529 Bacteria 1760
458 Ga0495587_0006735 3300046536 Bacteria 7481
459 Ga0495587_0084415 3300046536 Unclassified 1839
460 Ga0495667_0014196 3300046559 Bacteria 5378
461 Ga0495635_0098788 3300046663 Bacteria 1995
462 Ga0495635_0152579 3300046663 Unclassified 1573
463 Ga0495659_0013982 3300046664 Unclassified 2620
464 Ga0495657_0016534 3300046675 Bacteria 5375
465 Ga0495657_0029598 3300046675 Bacteria 3839
466 Ga0495658_0105600 3300046683 Bacteria 1687
467 Ga0495670_0091914 3300046691 Bacteria 1554
468 Ga0495581_0062198 3300047315 Bacteria 2157
469 Ga0495604_0066471 3300047317 Bacteria 2742
470 Ga0495604_0138540 3300047317 Bacteria 1741
471 Ga0495676_0305523 3300047321 Unclassified 1072
472 Ga0495680_0233916 3300047322 Unclassified 1307
473 Ga0495675_0005566 3300047444 Bacteria 7686
474 Ga0495686_0025513 3300047472 Bacteria 3873
475 Ga0495602_0059350 3300048088 Bacteria 3340
476 Ga0496102_0527918 3300048905 Bacteria 1103
477 Ga0496108_0246796 3300048911 Bacteria 1553
478 Ga0496115_0018467 3300048918 Bacteria 5354
479 Ga0496115_0098672 3300048918 Bacteria 2393
480 Ga0496125_0001254 3300048928 Bacteria 37859
481 Ga0496125_0047635 3300048928 Bacteria 3581
482 Ga0501290_000039 3300049513 Bacteria 16974
483 Ga0501291_000019 3300049514 Bacteria 22541
484 Ga0501292_000403 3300049515 Bacteria 5740
485 Ga0501294_001525 3300049517 Unclassified 2317
486 Ga0501295_000011 3300049518 Bacteria 23617
487 Ga0501296_000029 3300049519 Bacteria 16252
488 Ga0501296_006766 3300049519 Unclassified 1306
489 Ga0501297_000006 3300049520 Bacteria 21954
490 Ga0501298_000012 3300049521 Bacteria 19378
491 Ga0501299_000715 3300049522 Bacteria 3988
492 Ga0501300_000483 3300049523 Bacteria 5989
493 Ga0501301_000228 3300049524 Bacteria 3249
494 Ga0501303_000138 3300049526 Bacteria 6311
495 Ga0501031_0002149 3300049568 Bacteria 12433
496 Ga0501031_0013859 3300049568 Bacteria 5253
497 Ga0501032_0000504 3300049569 Bacteria 31645
498 Ga0501033_0000003 3300049570 Bacteria 586973
499 Ga0501033_0000083 3300049570 Bacteria 89452
500 Ga0501036_0036576 3300049572 Bacteria 4155
501 Ga0501036_0053721 3300049572 Bacteria 3411
502 Ga0501036_0101804 3300049572 Bacteria 2430
503 Ga0501037_0000083 3300049573 Bacteria 86322
504 Ga0501037_0013052 3300049573 Bacteria 6125
505 Ga0501037_0042163 3300049573 Bacteria 3354
506 Ga0501037_0097604 3300049573 Unclassified 2123
507 Ga0501038_0000329 3300049574 Bacteria 40955
508 Ga0501038_0006687 3300049574 Bacteria 10655
509 Ga0501038_0022409 3300049574 Bacteria 5661
510 Ga0501038_0032868 3300049574 Bacteria 4572
511 Ga0501038_0039168 3300049574 Bacteria 4147
512 Ga0501038_0110342 3300049574 Bacteria 2279
513 Ga0501039_0002225 3300049575 Bacteria 14350
514 Ga0501039_0002998 3300049575 Bacteria 12619
515 Ga0501039_0013028 3300049575 Bacteria 6356
516 Ga0501039_0030652 3300049575 Bacteria 4148
517 Ga0501039_0431830 3300049575 Bacteria 1034
518 Ga0501039_0501618 3300049575 Bacteria 953
519 Ga0501040_0076133 3300049576 Unclassified 2320
520 Ga0501041_0003147 3300049577 Bacteria 9494
521 Ga0501041_0005224 3300049577 Bacteria 7582
522 Ga0501041_0073022 3300049577 Bacteria 2108
523 Ga0501042_0001893 3300049578 Bacteria 12585
524 Ga0501042_0055737 3300049578 Bacteria 2821
525 Ga0501043_0002418 3300049579 Bacteria 15801
526 Ga0501043_0017594 3300049579 Bacteria 5604
527 Ga0501043_0073429 3300049579 Bacteria 2687
528 Ga0501046_0007844 3300049580 Bacteria 9366
529 Ga0501046_0014946 3300049580 Bacteria 6531
530 Ga0501047_0002692 3300049581 Bacteria 16920
531 Ga0501047_0095852 3300049581 Bacteria 2845
532 Ga0501047_0143491 3300049581 Bacteria 2265
533 Ga0501048_0002213 3300049582 Bacteria 14809
534 Ga0501067_0026740 3300049583 Bacteria 3195
535 Ga0501067_0065861 3300049583 Bacteria 2006
536 Ga0501068_0087011 3300049584 Bacteria 1924
537 Ga0501069_0018643 3300049585 Bacteria 3747
538 Ga0501070_0005200 3300049586 Bacteria 11088
539 Ga0501070_0023242 3300049586 Bacteria 5193
540 Ga0501070_0041974 3300049586 Bacteria 3809
541 Ga0501070_0078064 3300049586 Bacteria 2740
542 Ga0501070_0122961 3300049586 Bacteria 2145
543 Ga0501070_0139358 3300049586 Bacteria 2003
544 Ga0501071_0004046 3300049587 Bacteria 9263
545 Ga0501071_0165052 3300049587 Bacteria 1657
546 Ga0501073_0038848 3300049589 Bacteria 3375
547 Ga0501073_0108362 3300049589 Bacteria 1928
548 Ga0501074_0155538 3300049590 Bacteria 1633
549 Ga0501075_0017241 3300049591 Bacteria 5215
550 Ga0501076_0147192 3300049592 Unclassified 1915
551 Ga0501076_0163347 3300049592 Bacteria 1815
552 Ga0501077_0079742 3300049593 Unclassified 2074
553 Ga0501198_002606 3300049649 Bacteria 2435
554 Ga0501199_000121 3300049650 Bacteria 5901
555 Ga0501207_000226 3300049654 Bacteria 5715
556 Ga0501208_000359 3300049655 Bacteria 3486
557 Ga0501209_069411 3300049656 Bacteria 1000
558 Ga0501216_000387 3300049660 Bacteria 5121
559 Ga0501217_001318 3300049661 Bacteria 4614
560 Ga0501227_004929 3300049665 Unclassified 2863
561 Ga0501228_000244 3300049666 Bacteria 3261
562 Ga0501230_007885 3300049667 Bacteria 1593
563 Ga0501233_000301 3300049668 Bacteria 7611
564 Ga0501235_000299 3300049669 Bacteria 9332
565 Ga0501236_002905 3300049670 Unclassified 1985
566 Ga0501243_000533 3300049675 Bacteria 5076
567 Ga0501246_000183 3300049676 Bacteria 4029
568 Ga0501248_001084 3300049678 Unclassified 1660
569 Ga0501249_000187 3300049679 Bacteria 18921
570 Ga0501251_000388 3300049681 Bacteria 3906
571 Ga0501252_001159 3300049682 Bacteria 2353
572 Ga0501256_000097 3300049685 Bacteria 4481
573 Ga0501257_014580 3300049686 Unclassified 1811
574 Ga0501259_004175 3300049688 Unclassified 2296
575 Ga0501260_000130 3300049689 Bacteria 5424
576 Ga0501261_000368 3300049690 Bacteria 6040
577 Ga0501219_000921 3300049703 Bacteria 3582
578 Ga0501221_000411 3300049704 Bacteria 6609
579 Ga0501225_0001272 3300049705 Bacteria 7818
580 Ga0501229_000409 3300049706 Bacteria 4819
581 Ga0501234_000067 3300049707 Bacteria 12699
582 Ga0501245_007222 3300049708 Unclassified 1568
583 Ga0501079_0021590 3300049741 Bacteria 4925
584 Ga0501079_0070270 3300049741 Bacteria 2703
585 Ga0501080_0168503 3300049742 Bacteria 2021
586 Ga0501083_0060881 3300049744 Unclassified 2522
587 Ga0501232_000390 3300049757 Bacteria 2866
588 Ga0501264_000556 3300049761 Bacteria 5422
589 Ga0501265_002952 3300049762 Bacteria 1933
590 Ga0501266_000463 3300049763 Bacteria 5357
591 Ga0501269_010427 3300049766 Bacteria 1131
592 Ga0501270_001992 3300049767 Unclassified 2040
593 Ga0501272_000065 3300049769 Bacteria 7699
594 Ga0501273_000307 3300049770 Bacteria 3803
595 Ga0501275_004489 3300049772 Bacteria 1311
596 Ga0501279_000197 3300049775 Bacteria 8384
597 Ga0501281_00384 3300049777 Bacteria 4429
598 Ga0501283_000015 3300049779 Bacteria 21880
599 Ga0501035_0000001 3300049822 Bacteria 1037138
600 Ga0501035_0002674 3300049822 Bacteria 17341
601 Ga0501035_0004915 3300049822 Bacteria 12681
602 Ga0501035_0119329 3300049822 Bacteria 2307
603 Ga0501035_0321354 3300049822 Bacteria 1300
604 Ga0501044_0000159 3300049823 Bacteria 83639
605 Ga0501044_0030731 3300049823 Bacteria 5658
606 Ga0501044_0256973 3300049823 Unclassified 1686
607 Ga0501045_0099600 3300049824 Bacteria 2151
608 Ga0501045_0180862 3300049824 Bacteria 1571
609 Ga0501212_007373 3300049851 Unclassified 1506
610 Ga0501226_004624 3300049853 Bacteria 1589
611 nmdc:mga05p37_533777_c1 3300050507 Bacteria 1339
612 nmdc:mga05p37_7050_c3 3300050507 Bacteria 7677
613 nmdc:mga05p37_85784_c1 3300050507 Bacteria 3880
614 nmdc:mga09592_126987_c1 3300050508 Unclassified 2193
615 nmdc:mga09592_56990_c1 3300050508 Bacteria 3302
616 nmdc:mga09592_628_c1 3300050508 Bacteria 26997
617 nmdc:mga09592_88265_c1 3300050508 Unclassified 2648
618 nmdc:mga0qj67_7424_c1 3300050509 Bacteria 8104
619 nmdc:mga0qj67_8914_c1 3300050509 Bacteria 7443
620 nmdc:mga06r32_20429_c1 3300050510 Bacteria 6099
621 nmdc:mga08y16_130851_c1 3300050511 Bacteria 2609
622 nmdc:mga08y16_19593_c1 3300050511 Bacteria 7133
623 nmdc:mga08y16_40174_c1 3300050511 Unclassified 4905
624 nmdc:mga08y16_579738_c1 3300050511 Bacteria 1133
625 nmdc:mga0n895_183973_c1 3300050512 Bacteria 2121
626 nmdc:mga0n895_25119_c1 3300050512 Bacteria 5626
627 nmdc:mga0n895_446378_c1 3300050512 Bacteria 1306
628 nmdc:mga0n895_45444_c1 3300050512 Bacteria 4286
629 nmdc:mga0rr50_9841_c1 3300050513 Bacteria 6039
630 nmdc:mga08x19_148882_c1 3300050514 Unclassified 1584
631 nmdc:mga0a205_33356_c1 3300050515 Bacteria 4937
632 nmdc:mga0a205_379728_c1 3300050515 Bacteria 1278
633 nmdc:mga0a205_5607_c1 3300050515 Bacteria 11307
634 Ga0495601_0029104 3300053077 Bacteria 3424
635 Ga0495601_0059194 3300053077 Bacteria 2429
636 Ga0500635_0016485 3300053080 Bacteria 2199
637 Ga0495595_0002156 3300053084 Bacteria 7647
638 Ga0495619_0070253 3300053085 Bacteria 2341
639 Ga0500578_0051718 3300053086 Bacteria 2632
640 Ga0500646_0005402 3300053090 Bacteria 3234
641 Ga0500583_0007096 3300053092 Bacteria 3913
642 Ga0500566_0035668 3300053094 Bacteria 2889
643 Ga0500566_0101427 3300053094 Bacteria 1577
644 Ga0500640_006413 3300053095 Bacteria 4489
645 Ga0500554_001427 3300053102 Bacteria 4621
646 Ga0500556_0003471 3300053104 Bacteria 4631
647 Ga0500572_003251 3300053111 Bacteria 3744
648 Ga0500595_000080 3300053119 Bacteria 67711
649 Ga0500607_150014 3300053121 Bacteria 1082
650 Ga0500608_000243 3300053122 Bacteria 21503
651 Ga0500614_000998 3300053123 Bacteria 7023
652 Ga0500614_010113 3300053123 Bacteria 2021
653 Ga0500559_0042880 3300053136 Bacteria 1975
654 Ga0500568_0020885 3300053139 Bacteria 2826
655 Ga0500603_010891 3300053150 Bacteria 2060
656 Ga0500619_037329 3300053154 Bacteria 1517
657 Ga0500638_049814 3300053162 Bacteria 2026
658 Ga0500639_017834 3300053163 Bacteria 3746
659 Ga0500636_0084495 3300053177 Bacteria 1825
660 Ga0500636_0175579 3300053177 Bacteria 1155
661 Ga0500645_007906 3300053730 Bacteria 3670
662 Ga0501084_0317574 3300054114 Bacteria 1316
663 Ga0590075_032038 3300059424 Unclassified 1333
664 Ga0590077_009132 3300059426 Unclassified 2031
665 Ga0590077_012961 3300059426 Bacteria 1731
666 Ga0501082_0019412 3300060353 Bacteria 5859
667 Ga0501082_0168841 3300060353 Bacteria 1902
668 Ga0501082_0395773 3300060353 Bacteria 1205
669 Ga0501082_0534850 3300060353 Unclassified 1025
670 2687237057 2684623219 Bacteria 8442773
671 Ga0395901_0091814
672 MBSR1b_contig_13535307
673 JGI24746J21847_1003444
674 JGI24737J22298_10032482
675 JGI24743J22301_10000044
676 JGI24738J21930_10015755
677 JGI24035J26624_1001644
678 JGI24033J26618_1000066
679 rootH2_10011145
680 rootL2_10039822
681 rootL2_10074460
682 rootL2_10156277
683 rootL2_10186783
684 rootH1_10001752
685 Ga0055530_10014664
686 Ga0065707_10027286
687 Ga0065707_10099442
688 Ga0065707_10100377
689 Ga0070658_10032927
690 Ga0070676_10001419
691 Ga0070676_10064494
692 Ga0070690_100000348
693 Ga0070690_100015663
694 Ga0070690_100027931
695 Ga0070690_100030630
696 Ga0070670_100015844
697 Ga0070670_100206980
698 Ga0070677_10030097
699 Ga0068869_100086837
700 Ga0068869_100091429
701 Ga0070666_10012329
702 Ga0070680_100004415
703 Ga0070680_100031682
704 Ga0070680_100033394
705 Ga0070682_100016500
706 Ga0070682_100063363
707 Ga0070682_100082376
708 Ga0068868_100019130
709 Ga0068868_100038099
710 Ga0070660_100029788
711 Ga0070689_100000090
712 Ga0070689_100001519
713 Ga0070689_100004336
714 Ga0070689_100009358
715 Ga0070689_100129152
716 Ga0070687_100001354
717 Ga0070687_100023969
718 Ga0070687_100027515
719 Ga0070661_100000479
720 Ga0070661_100018849
721 Ga0070692_10054249
722 Ga0070668_100013058
723 Ga0070668_100071182
724 Ga0070668_100147751
725 Ga0070669_100007357
726 Ga0070669_100014808
727 Ga0070675_100013175
728 Ga0070675_100041338
729 Ga0070675_100157950
730 Ga0070671_100514142
731 Ga0070674_100000394
732 Ga0070673_100139017
733 Ga0070688_100000135
734 Ga0070688_100002702
735 Ga0070688_100045669
736 Ga0070688_100269889
737 Ga0070659_100000985
738 Ga0070659_100019927
739 Ga0070667_100056590
740 Ga0070710_10068984
741 Ga0070701_10045184
742 Ga0070701_10080414
743 Ga0070705_100006180
744 Ga0070705_100038236
745 Ga0070705_100060010
746 Ga0070700_100000257
747 Ga0070700_100173444
748 Ga0070694_100006125
749 Ga0070694_100012346
750 Ga0070694_100112811
751 Ga0070694_100171004
752 Ga0070708_100104158
753 Ga0070663_100247157
754 Ga0070678_100002606
755 Ga0070678_100151009
756 Ga0070662_100003227
757 Ga0070681_10001753
758 Ga0070681_10003614
759 Ga0070681_10049211
760 Ga0070681_10218431
761 Ga0070681_10253915
762 Ga0068867_100001546
763 Ga0068867_100002470
764 Ga0068867_100170770
765 Ga0070685_10000073
766 Ga0070685_10001193
767 Ga0070685_10075920
768 Ga0070706_100000878
769 Ga0070706_100002645
770 Ga0070706_100021603
771 Ga0070706_100031624
772 Ga0070707_100000018
773 Ga0070707_100024642
774 Ga0070707_100037631
775 Ga0070707_100162323
776 Ga0070707_100489467
777 Ga0070698_100000114
778 Ga0070698_100011560
779 Ga0070698_100082096
780 Ga0070698_100142901
781 Ga0070698_100164837
782 Ga0070698_100335125
783 Ga0070699_100005710
784 Ga0070699_100070201
785 Ga0070699_100082524
786 Ga0070679_100001459
787 Ga0070679_100047591
788 Ga0070684_100078633
789 Ga0070684_100503871
790 Ga0070697_100089572
791 Ga0070697_100090641
792 Ga0070672_100006069
793 Ga0070686_100000089
794 Ga0070686_100004655
795 Ga0070686_100010699
796 Ga0070695_100007325
797 Ga0070695_100015463
798 Ga0070695_100150832
799 Ga0070695_100248110
800 Ga0070696_100047305
801 Ga0070693_100041818
802 Ga0070665_100002307
803 Ga0070704_100027484
804 Ga0070704_100054340
805 Ga0070704_100070773
806 Ga0070704_100080429
807 Ga0068855_100174913
808 Ga0068855_100392142
809 Ga0070664_100006608
810 Ga0070664_100021093
811 Ga0068857_100059905
812 Ga0068856_100000537
813 Ga0068856_100058687
814 Ga0068856_100186254
815 Ga0068859_100002892
816 Ga0068859_100119805
817 Ga0068859_100400751
818 Ga0068864_100175150
819 Ga0068866_10054688
820 Ga0068861_100163883
821 Ga0068861_100218688
822 Ga0068861_100369053
823 Ga0068858_100135974
824 Ga0068860_100017638
825 Ga0068860_100245921
826 Ga0068862_100007910
827 Ga0068862_100021260
828 Ga0068862_100164946
829 Ga0068862_100347006
830 Ga0081455_10000594
831 Ga0070717_10024090
832 Ga0075432_10001979
833 Ga0070715_10035796
834 Ga0097621_100009427
835 Ga0097621_100037112
836 Ga0068871_100005816
837 Ga0068871_100110325
838 Ga0075428_100256170
839 Ga0075428_100295348
840 Ga0075430_100001325
841 Ga0075430_100001910
842 Ga0075431_100003065
843 Ga0075433_10002999
844 Ga0075433_10076304
845 Ga0075433_10111981
846 Ga0075433_10214902
847 Ga0075434_100050376
848 Ga0075434_100119547
849 Ga0075434_100141571
850 Ga0075434_100473178
851 Ga0075429_100001252
852 Ga0075429_100005851
853 Ga0075429_100082207
854 Ga0075429_100098362
855 Ga0075429_100144221
856 Ga0068865_100004478
857 Ga0068865_100010331
858 Ga0075436_100149379
859 Ga0097620_100002892
860 Ga0097620_100119801
861 Ga0097620_100400764
862 Ga0075435_100045650
863 Ga0075435_100097970
864 Ga0111539_10007846
865 Ga0111539_10012258
866 Ga0111539_10260481
867 Ga0111539_10497852
868 Ga0105245_10000099
869 Ga0105245_10029838
870 Ga0105245_10118545
871 Ga0105245_10252055
872 Ga0114129_10023328
873 Ga0114129_10067741
874 Ga0114129_10106309
875 Ga0114129_10126336
876 Ga0114129_10279486
877 Ga0105243_10004891
878 Ga0105241_10040792
879 Ga0105242_10013265
880 Ga0105242_10045229
881 Ga0105242_10087944
882 Ga0105248_10000908
883 Ga0105249_10007377
884 Ga0105249_10048253
885 Ga0105249_10148930
886 Ga0105239_10001416
887 Ga0105239_10005383
888 Ga0105239_10022606
889 Ga0105239_10231783
890 Ga0105246_10000200
891 Ga0105246_10110679
892 Ga0157369_10036432
893 Ga0157374_10011253
894 Ga0157374_10036693
895 Ga0157374_10128846
896 Ga0157374_10189801
897 Ga0157378_10000857
898 Ga0157378_10011945
899 Ga0157378_10013383
900 Ga0163162_10005848
901 Ga0163162_10192709
902 Ga0157375_10002941
903 Ga0157375_10103480
904 Ga0157375_10189802
905 Ga0163163_10199296
906 Ga0157380_10014684
907 Ga0157380_10240263
908 Ga0157377_10019343
909 Ga0157376_10003733
910 Ga0157376_10055439
911 Ga0157376_10192628
912 Ga0213876_10028194
913 Ga0209050_1000908
914 Ga0207697_10000198
915 Ga0207642_10037612
916 Ga0207688_10003742
917 Ga0207688_10004420
918 Ga0207699_10151304
919 Ga0207645_10000634
920 Ga0207645_10001133
921 Ga0207705_10110184
922 Ga0207684_10000198
923 Ga0207654_10034950
924 Ga0207707_10010179
925 Ga0207707_10269655
926 Ga0207660_10012261
927 Ga0207660_10014792
928 Ga0207660_10125724
929 Ga0207662_10007367
930 Ga0207662_10025917
931 Ga0207662_10280271
932 Ga0207657_10005985
933 Ga0207649_10000427
934 Ga0207649_10116466
935 Ga0207652_10017078
936 Ga0207652_10126027
937 Ga0207652_10219239
938 Ga0207646_10000072
939 Ga0207646_10043660
940 Ga0207681_10001480
941 Ga0207650_10118955
942 Ga0207650_10277150
943 Ga0207659_10027546
944 Ga0207659_10084688
945 Ga0207659_10168936
946 Ga0207687_10000774
947 Ga0207687_10136843
948 Ga0207690_10054181
949 Ga0207706_10000702
950 Ga0207706_10003909
951 Ga0207686_10005846
952 Ga0207670_10000032
953 Ga0207670_10000177
954 Ga0207670_10104866
955 Ga0207669_10035894
956 Ga0207669_10287622
957 Ga0207704_10011387
958 Ga0207704_10111776
959 Ga0207665_10060502
960 Ga0207665_10064074
961 Ga0207691_10000182
962 Ga0207711_10001788
963 Ga0207689_10072905
964 Ga0207689_10283640
965 Ga0207689_10325226
966 Ga0207661_10025410
967 Ga0207661_10032917
968 Ga0207679_10004180
969 Ga0207651_10116819
970 Ga0207651_10225689
971 Ga0207712_10052076
972 Ga0207712_10053359
973 Ga0207668_10006913
974 Ga0207668_10122064
975 Ga0207658_10008718
976 Ga0207703_10151607
977 Ga0207708_10000291
978 Ga0207708_10000413
979 Ga0207708_10151599
980 Ga0207702_10003806
981 Ga0207702_10150471
982 Ga0207702_10208654
983 Ga0207641_10127302
984 Ga0207648_10000101
985 Ga0207648_10085747
986 Ga0207676_10061252
987 Ga0207676_10340249
988 Ga0207674_10004318
989 Ga0207674_10313947
990 Ga0207675_100074130
991 Ga0207675_100134666
992 Ga0207675_100200856
993 Ga0207683_10000229
994 Ga0207683_10028708
995 Ga0209973_1000239
996 Ga0209969_1002389
997 Ga0209967_1000547
998 Ga0209981_1002105
999 Ga0209984_1000006
1000 Ga0210000_1000032
1001 Ga0209982_1000705
1002 Ga0209970_1006254
1003 Ga0209970_1007538
1004 Ga0210002_1000061
1005 Ga0209983_1000874
1006 Ga0209971_1000642
1007 Ga0209966_1000016
1008 Ga0209998_10000021
1009 Ga0209998_10019074
1010 Ga0209974_10000003
1011 Ga0209974_10000265
1012 Ga0207428_10001120
1013 Ga0207428_10006333
1014 Ga0268266_10044738
1015 Ga0268265_10013370
1016 Ga0268265_10028020
1017 Ga0268265_10311647
1018 Ga0268264_10398558
1019 Ga0265326_10005513
1020 Ga0307517_10031500
1021 Ga0307515_10015000
1022 Ga0265338_10030516
1023 Ga0265338_10087690
1024 Ga0265338_10203924
1025 Ga0265332_10020875
1026 Ga0265320_10083479
1027 Ga0265339_10020303
1028 Ga0265316_10000230
1029 Ga0265316_10001169
1030 Ga0307513_10010635
1031 Ga0307513_10186517
1032 Ga0307509_10000007
1033 Ga0307509_10010793
1034 Ga0307509_10100579
1035 Ga0307509_10128720
1036 Ga0307509_10136421
1037 Ga0307408_100038453
1038 Ga0316579_10003565
1039 Ga0265342_10000265
1040 Ga0265342_10031378
1041 Ga0316576_10000591
1042 Ga0316576_10011115
1043 Ga0307516_10013815
1044 Ga0307516_10114082
1045 Ga0307405_10010594
1046 Ga0307413_10017077
1047 Ga0307410_10050917
1048 Ga0307406_10003927
1049 Ga0307406_10052376
1050 Ga0307407_10005289
1051 Ga0307412_10000625
1052 Ga0307409_100124325
1053 Ga0307416_100294136
1054 Ga0307414_10009229
1055 Ga0307411_10008204
1056 Ga0307415_100060451
1057 Ga0307415_100115272
1058 Ga0307415_100131256
1059 Ga0373934_0000962
1060 Ga0373934_0059328
1061 Ga0373940_0035055
1062 Ga0373949_0001386
1063 Ga0373923_0020394
1064 Ga0373936_0000035
1065 Ga0373936_0085388
1066 Ga0373941_0015901
1067 Ga0373956_0059763
1068 Ga0373957_0009657
1069 Ga0373955_0008648
1070 Ga0373961_0000020
1071 Ga0316574_0072511
1072 Ga0373924_0027753
1073 Ga0373931_0040788
1074 Ga0373935_0012043
1075 Ga0373933_0004953
1076 Ga0373933_0007058
1077 Ga0373933_0069486
1078 Ga0373947_0016709
1079 Ga0373937_0031486
1080 Ga0373937_0040042
1081 Ga0373937_0079996
1082 Ga0316582_0075916
1083 Ga0316582_0218205
1084 Ga0316584_0000325
1085 Ga0316584_0091412
1086 Ga0373925_0070936
1087 Ga0373925_0154412
1088 Ga0395899_0000015
1089 Ga0395899_0004859
1090 Ga0395900_0044586
1091 Ga0395898_0000051
1092 Ga0395898_0139593
1093 Ga0316581_0073691
1094 Ga0400483_005312
1095 Ga0400483_224315
1096 Ga0436365_0014080
1097 Ga0439439_0015824
1098 Ga0439461_0037611
1099 Ga0439466_0017981
1100 Ga0439450_042759
1101 Ga0439452_004979
1102 Ga0451577_0053435
1103 Ga0451577_0180898
1104 Ga0451577_0223564
1105 Ga0451577_0521500
1106 Ga0466965_0007338
1107 Ga0453684_0331514
1108 Ga0466971_0000025
1109 Ga0451576_0001765
1110 Ga0451576_0019910
1111 Ga0451576_0093757
1112 Ga0451576_0713558
1113 Ga0466967_0220246
1114 Ga0495592_0005931
1115 Ga0495603_0079418
1116 Ga0495629_0013291
1117 Ga0495653_0062353
1118 Ga0495580_0115243
1119 Ga0495594_0002228
1120 Ga0495594_0025000
1121 Ga0495608_0012150
1122 Ga0495628_0007531
1123 Ga0495628_0216051
1124 Ga0495630_0444302
1125 Ga0495632_0066854
1126 Ga0495637_0036110
1127 Ga0495652_0158488
1128 Ga0495587_0006735
1129 Ga0495587_0084415
1130 Ga0495667_0014196
1131 Ga0495635_0098788
1132 Ga0495635_0152579
1133 Ga0495659_0013982
1134 Ga0495657_0016534
1135 Ga0495657_0029598
1136 Ga0495658_0105600
1137 Ga0495670_0091914
1138 Ga0495581_0062198
1139 Ga0495604_0066471
1140 Ga0495604_0138540
1141 Ga0495676_0305523
1142 Ga0495680_0233916
1143 Ga0495675_0005566
1144 Ga0495686_0025513
1145 Ga0495602_0059350
1146 Ga0496102_0527918
1147 Ga0496108_0246796
1148 Ga0496115_0018467
1149 Ga0496115_0098672
1150 Ga0496125_0001254
1151 Ga0496125_0047635
1152 Ga0501290_000039
1153 Ga0501291_000019
1154 Ga0501292_000403
1155 Ga0501294_001525
1156 Ga0501295_000011
1157 Ga0501296_000029
1158 Ga0501296_006766
1159 Ga0501297_000006
1160 Ga0501298_000012
1161 Ga0501299_000715
1162 Ga0501300_000483
1163 Ga0501301_000228
1164 Ga0501303_000138
1165 Ga0501031_0002149
1166 Ga0501031_0013859
1167 Ga0501032_0000504
1168 Ga0501033_0000003
1169 Ga0501033_0000083
1170 Ga0501036_0036576
1171 Ga0501036_0053721
1172 Ga0501036_0101804
1173 Ga0501037_0000083
1174 Ga0501037_0013052
1175 Ga0501037_0042163
1176 Ga0501037_0097604
1177 Ga0501038_0000329
1178 Ga0501038_0006687
1179 Ga0501038_0022409
1180 Ga0501038_0032868
1181 Ga0501038_0039168
1182 Ga0501038_0110342
1183 Ga0501039_0002225
1184 Ga0501039_0002998
1185 Ga0501039_0013028
1186 Ga0501039_0030652
1187 Ga0501039_0431830
1188 Ga0501039_0501618
1189 Ga0501040_0076133
1190 Ga0501041_0003147
1191 Ga0501041_0005224
1192 Ga0501041_0073022
1193 Ga0501042_0001893
1194 Ga0501042_0055737
1195 Ga0501043_0002418
1196 Ga0501043_0017594
1197 Ga0501043_0073429
1198 Ga0501046_0007844
1199 Ga0501046_0014946
1200 Ga0501047_0002692
1201 Ga0501047_0095852
1202 Ga0501047_0143491
1203 Ga0501048_0002213
1204 Ga0501067_0026740
1205 Ga0501067_0065861
1206 Ga0501068_0087011
1207 Ga0501069_0018643
1208 Ga0501070_0005200
1209 Ga0501070_0023242
1210 Ga0501070_0041974
1211 Ga0501070_0078064
1212 Ga0501070_0122961
1213 Ga0501070_0139358
1214 Ga0501071_0004046
1215 Ga0501071_0165052
1216 Ga0501073_0038848
1217 Ga0501073_0108362
1218 Ga0501074_0155538
1219 Ga0501075_0017241
1220 Ga0501076_0147192
1221 Ga0501076_0163347
1222 Ga0501077_0079742
1223 Ga0501198_002606
1224 Ga0501199_000121
1225 Ga0501207_000226
1226 Ga0501208_000359
1227 Ga0501209_069411
1228 Ga0501216_000387
1229 Ga0501217_001318
1230 Ga0501227_004929
1231 Ga0501228_000244
1232 Ga0501230_007885
1233 Ga0501233_000301
1234 Ga0501235_000299
1235 Ga0501236_002905
1236 Ga0501243_000533
1237 Ga0501246_000183
1238 Ga0501248_001084
1239 Ga0501249_000187
1240 Ga0501251_000388
1241 Ga0501252_001159
1242 Ga0501256_000097
1243 Ga0501257_014580
1244 Ga0501259_004175
1245 Ga0501260_000130
1246 Ga0501261_000368
1247 Ga0501219_000921
1248 Ga0501221_000411
1249 Ga0501225_0001272
1250 Ga0501229_000409
1251 Ga0501234_000067
1252 Ga0501245_007222
1253 Ga0501079_0021590
1254 Ga0501079_0070270
1255 Ga0501080_0168503
1256 Ga0501083_0060881
1257 Ga0501232_000390
1258 Ga0501264_000556
1259 Ga0501265_002952
1260 Ga0501266_000463
1261 Ga0501269_010427
1262 Ga0501270_001992
1263 Ga0501272_000065
1264 Ga0501273_000307
1265 Ga0501275_004489
1266 Ga0501279_000197
1267 Ga0501281_00384
1268 Ga0501283_000015
1269 Ga0501035_0000001
1270 Ga0501035_0002674
1271 Ga0501035_0004915
1272 Ga0501035_0119329
1273 Ga0501035_0321354
1274 Ga0501044_0000159
1275 Ga0501044_0030731
1276 Ga0501044_0256973
1277 Ga0501045_0099600
1278 Ga0501045_0180862
1279 Ga0501212_007373
1280 Ga0501226_004624
1281 nmdc:mga05p37_533777_c1
1282 nmdc:mga05p37_7050_c3
1283 nmdc:mga05p37_85784_c1
1284 nmdc:mga09592_126987_c1
1285 nmdc:mga09592_56990_c1
1286 nmdc:mga09592_628_c1
1287 nmdc:mga09592_88265_c1
1288 nmdc:mga0qj67_7424_c1
1289 nmdc:mga0qj67_8914_c1
1290 nmdc:mga06r32_20429_c1
1291 nmdc:mga08y16_130851_c1
1292 nmdc:mga08y16_19593_c1
1293 nmdc:mga08y16_40174_c1
1294 nmdc:mga08y16_579738_c1
1295 nmdc:mga0n895_183973_c1
1296 nmdc:mga0n895_25119_c1
1297 nmdc:mga0n895_446378_c1
1298 nmdc:mga0n895_45444_c1
1299 nmdc:mga0rr50_9841_c1
1300 nmdc:mga08x19_148882_c1
1301 nmdc:mga0a205_33356_c1
1302 nmdc:mga0a205_379728_c1
1303 nmdc:mga0a205_5607_c1
1304 Ga0495601_0029104
1305 Ga0495601_0059194
1306 Ga0500635_0016485
1307 Ga0495595_0002156
1308 Ga0495619_0070253
1309 Ga0500578_0051718
1310 Ga0500646_0005402
1311 Ga0500583_0007096
1312 Ga0500566_0035668
1313 Ga0500566_0101427
1314 Ga0500640_006413
1315 Ga0500554_001427
1316 Ga0500556_0003471
1317 Ga0500572_003251
1318 Ga0500595_000080
1319 Ga0500607_150014
1320 Ga0500608_000243
1321 Ga0500614_000998
1322 Ga0500614_010113
1323 Ga0500559_0042880
1324 Ga0500568_0020885
1325 Ga0500603_010891
1326 Ga0500619_037329
1327 Ga0500638_049814
1328 Ga0500639_017834
1329 Ga0500636_0084495
1330 Ga0500636_0175579
1331 Ga0500645_007906
1332 Ga0501084_0317574
1333 Ga0590075_032038
1334 Ga0590077_009132
1335 Ga0590077_012961
1336 Ga0501082_0019412
1337 Ga0501082_0168841
1338 Ga0501082_0395773
1339 Ga0501082_0534850
1340 2687237057

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

135

330

0.96

PF01820

Dala_Dala_lig_N

D-ala D-ala ligase N-terminus

78

118

0.95

PF01820

Dala_Dala_lig_N

D-ala D-ala ligase N-terminus

36

86

0.91

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

128

302

0.85

PF13535

ATP-grasp_4

ATP-grasp domain

164

305

0.8

PF08443

RimK

RimK-like ATP-grasp domain

126

319

0.76

PF02655

ATP-grasp_3

ATP-grasp domain

126

303

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nri-assembly2.cif.gz_B crystal structure of burkholderia pseudomallei d-alanine-d-alanine ligase in complex with amp and d-ala-d-ala 0.9165 12 306
1iow-assembly1.cif.gz_A complex of y216f d-ala:d-ala ligase with adp and a phosphoryl phosphinate 0.9157 9 305
4c5b-assembly1.cif.gz_A the x-ray crystal structure of d-alanyl-d-alanine ligase in complex with atp and d-ala-d-ala 0.9149 9 305
8evx-assembly1.cif.gz_B ddla from pseudomonas aeruginosa pao1 in complex with adp and phosphorylated d-cycloserine 0.903 12 309
7u9k-assembly1.cif.gz_B staphylococcus aureus d-alanine-d-alanine ligase in complex with atp, d-ala-d-ala, mg2+ and k+ 0.9003 13 312
ID Description Score Start End Superfamily
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9487 91 305 3.30.470.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9294 91 305 3.30.470.20
3q1kB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9071 176 312 3.30.470.20
2i8cA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.905 91 312 3.30.470.20
2yzgC02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9027 92 307 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A352XNI3-F1-model_v4 D-alanine--D-alanine ligase 0.9972 11 87 GO:0016874
AF-A0A059X3G1-F1-model_v4 D-ala D-ala ligase N-terminus 0.9902 9 127 GO:0008716
AF-A0A7W0YC08-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) 0.9876 11 273 GO:0005524
GO:0008716
GO:0046872
GO:0071555
AF-A0A2V6JM71-F1-model_v4 D-alanine--D-alanine ligase 0.9757 8 174 GO:0005524
GO:0008716
GO:0046872
GO:0071555
AF-A0A7U6DW68-F1-model_v4 deleted 0.9693 61 311

Map