F474133

General Info

Members Datasets Scaffolds Average Seq Length
671 321 1342 173

Family's Representative Sequence

Representative Sequence 3300004800|Ga0058861_12003411|Ga0058861_120034113
Length 213
Sequence MVVGADLRVGPGIHMRTRERIDASQLDIKDNVVSINRVTKVVKGGKNLSFSALVVVGDGHGVVGFGVGKAKEVPSAIKKGIEAAKKNLIRVPLAGNTIPHRIVGVFGAGSVLLKPAPDGTGIIARRGARGDHEHPHQVARIGQPAQRRACDDHRARLAEGSRDDRAAARQRAERRHVRHGLTRPTNEQRGSVRFGRTREIWLIRERIRRAPAR

Samples

Sample ID Description Type Environment
1 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
178 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
179 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
182 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
183 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
202 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
203 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
213 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
216 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
276 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
311 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
314 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
315 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
316 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
319 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
320 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0
Rhizoplane 5.96
Rhizosphere 91.51
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058861_12003411 3300004800 Bacteria 1805
2 Ga0065712_10033738 3300005290 Bacteria 1066
3 Ga0065715_10238277 3300005293 Bacteria 1206
4 Ga0065707_10089023 3300005295 Bacteria 4482
5 Ga0065707_10519979 3300005295 Bacteria 743
6 Ga0070658_10302065 3300005327 Bacteria 1365
7 Ga0070676_10007044 3300005328 Bacteria 6019
8 Ga0070676_10100742 3300005328 Bacteria 1784
9 Ga0070676_10285363 3300005328 Bacteria 1114
10 Ga0070683_100763243 3300005329 Bacteria 926
11 Ga0070670_100050949 3300005331 Bacteria 3557
12 Ga0070670_100280626 3300005331 Bacteria 1454
13 Ga0070670_100362036 3300005331 Bacteria 1275
14 Ga0070670_100596116 3300005331 Bacteria 988
15 Ga0070677_10104469 3300005333 Bacteria 1255
16 Ga0070666_10051882 3300005335 Bacteria 2763
17 Ga0070666_10123865 3300005335 Bacteria 1793
18 Ga0070666_10212816 3300005335 Bacteria 1362
19 Ga0070666_10310169 3300005335 Bacteria 1124
20 Ga0070682_100444190 3300005337 Bacteria 992
21 Ga0068868_100055137 3300005338 Bacteria 3135
22 Ga0068868_100553795 3300005338 Bacteria 1014
23 Ga0068868_100887592 3300005338 Bacteria 809
24 Ga0070660_100520246 3300005339 Bacteria 991
25 Ga0070689_100460205 3300005340 Unclassified 1084
26 Ga0070691_10004188 3300005341 Bacteria 6554
27 Ga0070687_100080522 3300005343 Bacteria 1776
28 Ga0070668_100489968 3300005347 Bacteria 1062
29 Ga0070669_100110504 3300005353 Bacteria 2085
30 Ga0070675_100000056 3300005354 Bacteria 66985
31 Ga0070675_100029203 3300005354 Bacteria 4445
32 Ga0070675_100546245 3300005354 Bacteria 1047
33 Ga0070675_100735796 3300005354 Bacteria 899
34 Ga0070674_100007417 3300005356 Bacteria 6470
35 Ga0070674_100046049 3300005356 Bacteria 2982
36 Ga0070674_100078891 3300005356 Bacteria 2347
37 Ga0070674_100192253 3300005356 Bacteria 1571
38 Ga0070674_100202289 3300005356 Bacteria 1534
39 Ga0070674_100278160 3300005356 Bacteria 1325
40 Ga0070674_100554456 3300005356 Bacteria 965
41 Ga0070673_100003427 3300005364 Bacteria 9877
42 Ga0070673_100043981 3300005364 Bacteria 3455
43 Ga0070673_100460085 3300005364 Bacteria 1145
44 Ga0070667_100165408 3300005367 Bacteria 1951
45 Ga0070667_100168474 3300005367 Bacteria 1932
46 Ga0070667_100643276 3300005367 Bacteria 979
47 Ga0070667_101228191 3300005367 Bacteria 702
48 Ga0070714_100050502 3300005435 Bacteria 3543
49 Ga0070701_10010126 3300005438 Bacteria 4157
50 Ga0070701_10205854 3300005438 Bacteria 1166
51 Ga0070711_100592938 3300005439 Bacteria 924
52 Ga0070705_100044955 3300005440 Bacteria 2538
53 Ga0070705_100573723 3300005440 Bacteria 869
54 Ga0070705_100971410 3300005440 Bacteria 688
55 Ga0070700_100432017 3300005441 Bacteria 997
56 Ga0070694_100016422 3300005444 Bacteria 4660
57 Ga0070708_100055234 3300005445 Bacteria 3531
58 Ga0070663_100654247 3300005455 Bacteria 889
59 Ga0070678_100092251 3300005456 Bacteria 2326
60 Ga0070662_100496398 3300005457 Bacteria 1018
61 Ga0070681_10042357 3300005458 Bacteria 4563
62 Ga0070681_10348644 3300005458 Bacteria 1391
63 Ga0068867_100035655 3300005459 Bacteria 3609
64 Ga0068867_100041777 3300005459 Bacteria 3351
65 Ga0068867_100073877 3300005459 Bacteria 2554
66 Ga0068867_100513996 3300005459 Bacteria 1031
67 Ga0068867_100588601 3300005459 Bacteria 969
68 Ga0068867_100816926 3300005459 Bacteria 833
69 Ga0070706_100556565 3300005467 Bacteria 1067
70 Ga0070707_100125461 3300005468 Bacteria 2494
71 Ga0070707_100175008 3300005468 Bacteria 2092
72 Ga0070698_100034124 3300005471 Bacteria 5270
73 Ga0070698_100183947 3300005471 Bacteria 2028
74 Ga0070698_100367829 3300005471 Bacteria 1370
75 Ga0070698_100995188 3300005471 Bacteria 786
76 Ga0070699_100119032 3300005518 Bacteria 2322
77 Ga0070699_100741988 3300005518 Bacteria 898
78 Ga0070679_100044653 3300005530 Bacteria 4415
79 Ga0070684_100744697 3300005535 Bacteria 915
80 Ga0070697_100193729 3300005536 Bacteria 1726
81 Ga0070672_100417490 3300005543 Bacteria 1152
82 Ga0070672_100454407 3300005543 Bacteria 1104
83 Ga0070686_100002243 3300005544 Bacteria 10661
84 Ga0070686_100024325 3300005544 Bacteria 3629
85 Ga0070695_100063603 3300005545 Bacteria 2398
86 Ga0070695_100169060 3300005545 Bacteria 1541
87 Ga0070696_100012605 3300005546 Bacteria 5675
88 Ga0070696_100133503 3300005546 Bacteria 1809
89 Ga0070696_100145121 3300005546 Bacteria 1738
90 Ga0070696_100184966 3300005546 Bacteria 1547
91 Ga0070696_100694764 3300005546 Bacteria 829
92 Ga0070693_100512486 3300005547 Bacteria 853
93 Ga0070665_100004733 3300005548 Bacteria 14164
94 Ga0070665_100005447 3300005548 Bacteria 13122
95 Ga0070665_100010437 3300005548 Bacteria 9398
96 Ga0070704_100096664 3300005549 Bacteria 2215
97 Ga0070704_100355660 3300005549 Bacteria 1238
98 Ga0070704_100462367 3300005549 Bacteria 1095
99 Ga0068855_100286434 3300005563 Bacteria 1827
100 Ga0070664_100563231 3300005564 Bacteria 1054
101 Ga0068857_101000445 3300005577 Bacteria 805
102 Ga0068854_100177554 3300005578 Bacteria 1661
103 Ga0068854_100637221 3300005578 Bacteria 914
104 Ga0068856_100018557 3300005614 Bacteria 6740
105 Ga0070702_100002883 3300005615 Bacteria 7557
106 Ga0070702_100036054 3300005615 Bacteria 2737
107 Ga0070702_100096432 3300005615 Bacteria 1805
108 Ga0068859_100020008 3300005617 Bacteria 6721
109 Ga0068859_100168307 3300005617 Bacteria 2272
110 Ga0068859_100700495 3300005617 Bacteria 1103
111 Ga0068864_100075695 3300005618 Bacteria 2940
112 Ga0068866_10332190 3300005718 Bacteria 960
113 Ga0068861_100024888 3300005719 Bacteria 4334
114 Ga0068861_100463764 3300005719 Bacteria 1138
115 Ga0068861_101645756 3300005719 Bacteria 633
116 Ga0068870_10321948 3300005840 Bacteria 983
117 Ga0068863_100116322 3300005841 Bacteria 2548
118 Ga0068863_100116801 3300005841 Bacteria 2542
119 Ga0068858_100001254 3300005842 Bacteria 26256
120 Ga0068858_100008638 3300005842 Bacteria 9781
121 Ga0068858_100189424 3300005842 Bacteria 1944
122 Ga0068858_100524546 3300005842 Bacteria 1146
123 Ga0068858_100793695 3300005842 Bacteria 924
124 Ga0068858_101016433 3300005842 Bacteria 813
125 Ga0068858_101641368 3300005842 Bacteria 635
126 Ga0068860_100123715 3300005843 Bacteria 2479
127 Ga0068860_100129065 3300005843 Bacteria 2424
128 Ga0068860_100304196 3300005843 Bacteria 1563
129 Ga0068860_100304719 3300005843 Bacteria 1561
130 Ga0068860_100328276 3300005843 Bacteria 1502
131 Ga0068860_100344425 3300005843 Bacteria 1466
132 Ga0068860_100534033 3300005843 Bacteria 1174
133 Ga0068862_100109135 3300005844 Bacteria 2427
134 Ga0068862_100110658 3300005844 Bacteria 2410
135 Ga0068862_100157630 3300005844 Bacteria 2025
136 Ga0081455_10174261 3300005937 Bacteria 1635
137 Ga0081455_10345681 3300005937 Bacteria 1051
138 Ga0081540_1096511 3300005983 Bacteria 1286
139 Ga0081539_10100098 3300005985 Bacteria 1479
140 Ga0081539_10197007 3300005985 Bacteria 933
141 Ga0075368_10004958 3300006042 Bacteria 4544
142 Ga0075432_10185114 3300006058 Bacteria 817
143 Ga0070716_100341366 3300006173 Bacteria 1057
144 Ga0075367_10010203 3300006178 Bacteria 4925
145 Ga0075367_10028961 3300006178 Bacteria 3163
146 Ga0075367_10258480 3300006178 Bacteria 1093
147 Ga0097621_100006061 3300006237 Bacteria 8549
148 Ga0097621_100118810 3300006237 Bacteria 2241
149 Ga0097621_100228720 3300006237 Bacteria 1623
150 Ga0097621_100238936 3300006237 Bacteria 1588
151 Ga0068871_100006055 3300006358 Bacteria 8509
152 Ga0068871_100075510 3300006358 Bacteria 2782
153 Ga0075428_100000009 3300006844 Bacteria 266370
154 Ga0075428_100312003 3300006844 Bacteria 1690
155 Ga0075428_100319068 3300006844 Bacteria 1670
156 Ga0075428_100348183 3300006844 Bacteria 1590
157 Ga0075430_100105326 3300006846 Bacteria 2354
158 Ga0075431_100261523 3300006847 Bacteria 1756
159 Ga0075431_100598368 3300006847 Bacteria 1087
160 Ga0075433_10100150 3300006852 Bacteria 2565
161 Ga0075433_10128181 3300006852 Bacteria 2254
162 Ga0075433_10422349 3300006852 Bacteria 1176
163 Ga0075433_10530184 3300006852 Bacteria 1036
164 Ga0075433_10616820 3300006852 Bacteria 952
165 Ga0075433_11134277 3300006852 Bacteria 679
166 Ga0075434_100069571 3300006871 Bacteria 3509
167 Ga0075434_100109389 3300006871 Bacteria 2774
168 Ga0075434_100110530 3300006871 Bacteria 2759
169 Ga0075434_100135753 3300006871 Bacteria 2479
170 Ga0075434_100385465 3300006871 Bacteria 1422
171 Ga0075434_101223515 3300006871 Bacteria 763
172 Ga0075429_100522210 3300006880 Bacteria 1040
173 Ga0068865_100006729 3300006881 Bacteria 7032
174 Ga0068865_100055357 3300006881 Bacteria 2759
175 Ga0075436_100018272 3300006914 Bacteria 4802
176 Ga0075436_100038116 3300006914 Bacteria 3318
177 Ga0075436_100110506 3300006914 Bacteria 1918
178 Ga0097620_100020008 3300006931 Bacteria 6721
179 Ga0097620_100168317 3300006931 Bacteria 2272
180 Ga0097620_100700471 3300006931 Bacteria 1103
181 Ga0075435_100001542 3300007076 Bacteria 14846
182 Ga0075435_100001694 3300007076 Bacteria 14328
183 Ga0075435_100028991 3300007076 Bacteria 4343
184 Ga0075435_100038141 3300007076 Bacteria 3830
185 Ga0105240_10045226 3300009093 Bacteria 5587
186 Ga0105240_10177867 3300009093 Bacteria 2514
187 Ga0105240_11200222 3300009093 Bacteria 803
188 Ga0111539_10000010 3300009094 Bacteria 366246
189 Ga0111539_10000566 3300009094 Bacteria 47366
190 Ga0111539_10293747 3300009094 Bacteria 1891
191 Ga0111539_11332686 3300009094 Bacteria 833
192 Ga0105245_10035527 3300009098 Bacteria 4423
193 Ga0105245_10062980 3300009098 Bacteria 3348
194 Ga0105245_10473430 3300009098 Bacteria 1265
195 Ga0105247_10004209 3300009101 Bacteria 9230
196 Ga0105247_10511839 3300009101 Bacteria 876
197 Ga0114129_10017270 3300009147 Bacteria 10276
198 Ga0114129_10117140 3300009147 Bacteria 3671
199 Ga0114129_10118442 3300009147 Bacteria 3648
200 Ga0114129_10148538 3300009147 Bacteria 3209
201 Ga0114129_10216991 3300009147 Bacteria 2583
202 Ga0114129_11634253 3300009147 Bacteria 788
203 Ga0105243_10054004 3300009148 Bacteria 3188
204 Ga0105243_10105863 3300009148 Bacteria 2343
205 Ga0105243_11686437 3300009148 Bacteria 662
206 Ga0105241_10100846 3300009174 Bacteria 2295
207 Ga0105242_10013585 3300009176 Bacteria 6299
208 Ga0105242_10035616 3300009176 Bacteria 3991
209 Ga0105242_10125367 3300009176 Bacteria 2210
210 Ga0105242_10177665 3300009176 Bacteria 1876
211 Ga0105248_10026461 3300009177 Bacteria 6454
212 Ga0105248_10261960 3300009177 Bacteria 1946
213 Ga0105248_10387276 3300009177 Bacteria 1574
214 Ga0105248_10404784 3300009177 Bacteria 1536
215 Ga0105248_10452960 3300009177 Bacteria 1446
216 Ga0105248_10819264 3300009177 Bacteria 1051
217 Ga0105238_10125557 3300009551 Bacteria 2545
218 Ga0105238_11387555 3300009551 Bacteria 730
219 Ga0105249_10455911 3300009553 Bacteria 1318
220 Ga0099796_10030103 3300010159 Bacteria 1758
221 Ga0105239_11680584 3300010375 Bacteria 735
222 Ga0157313_1011512 3300012503 Bacteria 770
223 Ga0157374_10119547 3300013296 Bacteria 2541
224 Ga0157374_10311603 3300013296 Bacteria 1558
225 Ga0157374_10433731 3300013296 Bacteria 1314
226 Ga0157374_10899348 3300013296 Bacteria 903
227 Ga0157374_11120636 3300013296 Bacteria 808
228 Ga0157378_10067386 3300013297 Bacteria 3207
229 Ga0163162_10364795 3300013306 Bacteria 1577
230 Ga0163162_10519827 3300013306 Bacteria 1320
231 Ga0157375_10053326 3300013308 Bacteria 3978
232 Ga0157375_10277484 3300013308 Bacteria 1839
233 Ga0163163_10087285 3300014325 Bacteria 3130
234 Ga0163163_10125545 3300014325 Bacteria 2604
235 Ga0163163_10548400 3300014325 Bacteria 1219
236 Ga0163163_10641362 3300014325 Bacteria 1126
237 Ga0157380_10007827 3300014326 Bacteria 7605
238 Ga0157380_10190699 3300014326 Bacteria 1809
239 Ga0157380_10194070 3300014326 Bacteria 1795
240 Ga0157380_10489694 3300014326 Bacteria 1191
241 Ga0157380_10547053 3300014326 Bacteria 1135
242 Ga0157377_10019122 3300014745 Bacteria 3575
243 Ga0157379_10018550 3300014968 Bacteria 6136
244 Ga0157379_10063370 3300014968 Bacteria 3306
245 Ga0157379_10138355 3300014968 Bacteria 2195
246 Ga0157379_10146389 3300014968 Bacteria 2130
247 Ga0157379_10802200 3300014968 Bacteria 889
248 Ga0157379_11038565 3300014968 Bacteria 783
249 Ga0157376_10057273 3300014969 Bacteria 3259
250 Ga0157376_10145796 3300014969 Bacteria 2129
251 Ga0157376_11266519 3300014969 Bacteria 767
252 Ga0213873_10124294 3300021358 Bacteria 760
253 Ga0207697_10089053 3300025315 Bacteria 1307
254 Ga0207697_10157139 3300025315 Bacteria 991
255 Ga0207682_10094553 3300025893 Bacteria 1300
256 Ga0207682_10146518 3300025893 Bacteria 1062
257 Ga0207682_10342783 3300025893 Bacteria 703
258 Ga0207642_10054168 3300025899 Bacteria 1828
259 Ga0207642_10258962 3300025899 Bacteria 991
260 Ga0207642_10948925 3300025899 Bacteria 552
261 Ga0207688_10190402 3300025901 Bacteria 1227
262 Ga0207688_10337075 3300025901 Bacteria 927
263 Ga0207680_10142428 3300025903 Bacteria 1590
264 Ga0207680_10349441 3300025903 Bacteria 1038
265 Ga0207680_10364852 3300025903 Bacteria 1016
266 Ga0207647_10156595 3300025904 Bacteria 1330
267 Ga0207645_10096400 3300025907 Bacteria 1905
268 Ga0207645_10155591 3300025907 Bacteria 1493
269 Ga0207645_10307973 3300025907 Bacteria 1055
270 Ga0207643_10090349 3300025908 Bacteria 1785
271 Ga0207705_10423658 3300025909 Bacteria 1031
272 Ga0207705_10546213 3300025909 Bacteria 901
273 Ga0207654_10223831 3300025911 Bacteria 1249
274 Ga0207707_10312425 3300025912 Bacteria 1358
275 Ga0207695_10084625 3300025913 Bacteria 3202
276 Ga0207695_10131709 3300025913 Bacteria 2458
277 Ga0207695_10642497 3300025913 Bacteria 942
278 Ga0207693_10257754 3300025915 Bacteria 1368
279 Ga0207663_10236530 3300025916 Bacteria 1337
280 Ga0207660_10323655 3300025917 Bacteria 1232
281 Ga0207662_10178874 3300025918 Bacteria 1364
282 Ga0207657_10013143 3300025919 Bacteria 8130
283 Ga0207649_10659408 3300025920 Bacteria 809
284 Ga0207649_10693416 3300025920 Bacteria 789
285 Ga0207646_10097073 3300025922 Bacteria 2640
286 Ga0207646_10731602 3300025922 Bacteria 884
287 Ga0207694_10261502 3300025924 Bacteria 1418
288 Ga0207694_10758091 3300025924 Bacteria 819
289 Ga0207694_10758852 3300025924 Bacteria 819
290 Ga0207650_10877977 3300025925 Bacteria 761
291 Ga0207659_10126623 3300025926 Bacteria 1965
292 Ga0207687_10015584 3300025927 Bacteria 4986
293 Ga0207687_10063053 3300025927 Bacteria 2623
294 Ga0207687_10098805 3300025927 Bacteria 2143
295 Ga0207664_10050545 3300025929 Bacteria 3278
296 Ga0207644_10120436 3300025931 Bacteria 1997
297 Ga0207644_11023801 3300025931 Bacteria 693
298 Ga0207690_10232957 3300025932 Bacteria 1415
299 Ga0207706_10450722 3300025933 Bacteria 1113
300 Ga0207686_10013361 3300025934 Bacteria 4541
301 Ga0207686_10016494 3300025934 Bacteria 4146
302 Ga0207686_10147455 3300025934 Bacteria 1634
303 Ga0207686_10160445 3300025934 Bacteria 1575
304 Ga0207709_10007222 3300025935 Bacteria 6197
305 Ga0207669_10039737 3300025937 Bacteria 2722
306 Ga0207669_10127353 3300025937 Bacteria 1742
307 Ga0207669_10297868 3300025937 Bacteria 1224
308 Ga0207669_10337513 3300025937 Bacteria 1159
309 Ga0207669_10392616 3300025937 Bacteria 1084
310 Ga0207669_10553177 3300025937 Bacteria 929
311 Ga0207669_11301839 3300025937 Bacteria 617
312 Ga0207704_10005828 3300025938 Bacteria 5701
313 Ga0207704_10169986 3300025938 Bacteria 1562
314 Ga0207704_10211258 3300025938 Bacteria 1428
315 Ga0207704_10464569 3300025938 Bacteria 1013
316 Ga0207704_10707716 3300025938 Unclassified 834
317 Ga0207665_10048683 3300025939 Bacteria 2846
318 Ga0207665_10565550 3300025939 Bacteria 885
319 Ga0207665_10847167 3300025939 Bacteria 724
320 Ga0207691_10339779 3300025940 Bacteria 1285
321 Ga0207691_10419050 3300025940 Bacteria 1141
322 Ga0207691_10555542 3300025940 Bacteria 973
323 Ga0207711_10026433 3300025941 Bacteria 4870
324 Ga0207711_10058386 3300025941 Bacteria 3320
325 Ga0207711_10137892 3300025941 Bacteria 2192
326 Ga0207711_10169022 3300025941 Bacteria 1983
327 Ga0207711_10212107 3300025941 Bacteria 1769
328 Ga0207711_10393563 3300025941 Bacteria 1287
329 Ga0207689_10034411 3300025942 Bacteria 4209
330 Ga0207661_10337766 3300025944 Bacteria 1357
331 Ga0207667_10168529 3300025949 Bacteria 2251
332 Ga0207651_10041000 3300025960 Bacteria 3069
333 Ga0207651_10110459 3300025960 Bacteria 2062
334 Ga0207651_10149189 3300025960 Bacteria 1818
335 Ga0207651_10156204 3300025960 Bacteria 1782
336 Ga0207712_10726235 3300025961 Bacteria 869
337 Ga0207712_11612361 3300025961 Bacteria 582
338 Ga0207668_10076681 3300025972 Bacteria 2408
339 Ga0207668_10092168 3300025972 Bacteria 2229
340 Ga0207668_10098613 3300025972 Bacteria 2165
341 Ga0207640_10114374 3300025981 Bacteria 1920
342 Ga0207658_10276346 3300025986 Bacteria 1438
343 Ga0207658_11054258 3300025986 Bacteria 742
344 Ga0207677_10497170 3300026023 Bacteria 1054
345 Ga0207677_11060195 3300026023 Bacteria 737
346 Ga0207703_10215416 3300026035 Bacteria 1714
347 Ga0207703_10280457 3300026035 Bacteria 1513
348 Ga0207703_10361518 3300026035 Bacteria 1339
349 Ga0207703_11452727 3300026035 Bacteria 660
350 Ga0207639_10543413 3300026041 Bacteria 1066
351 Ga0207708_10105615 3300026075 Bacteria 2183
352 Ga0207708_10328664 3300026075 Bacteria 1249
353 Ga0207702_10262266 3300026078 Bacteria 1627
354 Ga0207641_10752171 3300026088 Bacteria 962
355 Ga0207648_10016724 3300026089 Bacteria 6693
356 Ga0207648_10037722 3300026089 Bacteria 4256
357 Ga0207648_10082760 3300026089 Bacteria 2799
358 Ga0207648_10319166 3300026089 Bacteria 1396
359 Ga0207676_10028142 3300026095 Bacteria 4195
360 Ga0207676_10069079 3300026095 Bacteria 2828
361 Ga0207676_10164224 3300026095 Bacteria 1927
362 Ga0207676_10416489 3300026095 Bacteria 1259
363 Ga0207676_10694427 3300026095 Bacteria 985
364 Ga0207674_10203527 3300026116 Bacteria 1929
365 Ga0207675_100014045 3300026118 Bacteria 7468
366 Ga0207675_100038967 3300026118 Bacteria 4435
367 Ga0207675_100412832 3300026118 Bacteria 1332
368 Ga0207675_100818367 3300026118 Bacteria 945
369 Ga0207683_11447570 3300026121 Bacteria 635
370 Ga0207698_11764993 3300026142 Bacteria 634
371 Ga0209967_1039820 3300027364 Bacteria 713
372 Ga0209970_1014250 3300027614 Bacteria 1320
373 Ga0209813_10100043 3300027866 Bacteria 985
374 Ga0207428_10000034 3300027907 Bacteria 231306
375 Ga0207428_10072788 3300027907 Bacteria 2697
376 Ga0207428_10073024 3300027907 Bacteria 2692
377 Ga0207428_10107542 3300027907 Bacteria 2149
378 Ga0207428_10120374 3300027907 Bacteria 2013
379 Ga0268266_10005896 3300028379 Bacteria 11335
380 Ga0268266_10029767 3300028379 Bacteria 4639
381 Ga0268266_10219488 3300028379 Bacteria 1747
382 Ga0268265_10005520 3300028380 Bacteria 8630
383 Ga0268265_10025303 3300028380 Bacteria 4210
384 Ga0268265_10113738 3300028380 Bacteria 2215
385 Ga0268265_10733702 3300028380 Bacteria 957
386 Ga0268264_10042810 3300028381 Bacteria 3749
387 Ga0268264_10050141 3300028381 Bacteria 3475
388 Ga0268264_10317611 3300028381 Bacteria 1472
389 Ga0268264_11287382 3300028381 Bacteria 741
390 Ga0265338_10656703 3300028800 Bacteria 726
391 Ga0265332_10048353 3300031238 Bacteria 1830
392 Ga0265316_10261546 3300031344 Bacteria 1269
393 Ga0265314_10007579 3300031711 Bacteria 9400
394 Ga0265314_10013729 3300031711 Bacteria 6530
395 Ga0265342_10192479 3300031712 Bacteria 1112
396 Ga0307413_10091526 3300031824 Bacteria 1982
397 Ga0307413_10220584 3300031824 Bacteria 1385
398 Ga0307413_10391449 3300031824 Bacteria 1086
399 Ga0307412_10843067 3300031911 Bacteria 799
400 Ga0307416_100160347 3300032002 Bacteria 2078
401 Ga0307416_100512333 3300032002 Bacteria 1266
402 Ga0307416_100922927 3300032002 Bacteria 974
403 Ga0307411_10170887 3300032005 Bacteria 1639
404 Ga0307411_10594306 3300032005 Bacteria 951
405 Ga0373930_0002995 3300034816 Bacteria 2656
406 Ga0373948_0001483 3300034817 Bacteria 3266
407 Ga0373958_0000045 3300034819 Bacteria 12165
408 Ga0373959_0001151 3300034820 Bacteria 4278
409 Ga0373938_0000418 3300034957 Bacteria 6847
410 Ga0373928_0001212 3300035084 Bacteria 5090
411 Ga0373929_0000116 3300035085 Bacteria 13311
412 Ga0373940_0000084 3300035088 Bacteria 11367
413 Ga0373944_0043759 3300035089 Bacteria 1392
414 Ga0373944_0073733 3300035089 Bacteria 1116
415 Ga0373944_0224850 3300035089 Bacteria 686
416 Ga0373949_0000597 3300035090 Bacteria 11806
417 Ga0373949_0033224 3300035090 Bacteria 1239
418 Ga0373951_0001673 3300035091 Bacteria 5805
419 Ga0373952_0001387 3300035092 Bacteria 4428
420 Ga0373932_0006095 3300035112 Bacteria 2845
421 Ga0373936_0092396 3300035113 Bacteria 1270
422 Ga0373936_0346338 3300035113 Bacteria 676
423 Ga0373939_0001888 3300035114 Bacteria 5012
424 Ga0373939_0031755 3300035114 Bacteria 1529
425 Ga0373939_0107081 3300035114 Bacteria 968
426 Ga0373941_0000161 3300035115 Bacteria 12224
427 Ga0373945_0056786 3300035116 Bacteria 1453
428 Ga0373953_0044678 3300035117 Bacteria 1772
429 Ga0373953_0132653 3300035117 Bacteria 1063
430 Ga0373956_0208787 3300035119 Bacteria 926
431 Ga0373957_0061355 3300035120 Bacteria 1457
432 Ga0373960_0001448 3300035121 Bacteria 5252
433 Ga0373943_0571512 3300035170 Bacteria 664
434 Ga0373946_0369495 3300035171 Bacteria 720
435 Ga0373955_0047351 3300035172 Bacteria 2328
436 Ga0373955_0059904 3300035172 Bacteria 2098
437 Ga0373955_0171915 3300035172 Bacteria 1283
438 Ga0373955_0273145 3300035172 Bacteria 1016
439 Ga0373942_0001757 3300035207 Bacteria 5486
440 Ga0373961_0001591 3300035241 Bacteria 6457
441 Ga0373961_0111475 3300035241 Bacteria 897
442 Ga0373962_0000245 3300035242 Bacteria 11519
443 Ga0373924_0173653 3300035410 Bacteria 947
444 Ga0373931_0009494 3300035691 Bacteria 4653
445 Ga0373931_0169020 3300035691 Bacteria 1287
446 Ga0373935_0087624 3300035692 Bacteria 2033
447 Ga0373935_1067504 3300035692 Bacteria 601
448 Ga0373927_0199653 3300035695 Bacteria 1313
449 Ga0373947_0085310 3300035725 Bacteria 1961
450 Ga0373937_0055553 3300036401 Bacteria 3635
451 Ga0373937_0139222 3300036401 Bacteria 2270
452 Ga0373937_0170677 3300036401 Bacteria 2041
453 Ga0373937_0356987 3300036401 Bacteria 1385
454 Ga0373925_0160073 3300037068 Bacteria 1773
455 Ga0373925_0251097 3300037068 Bacteria 1419
456 Ga0373925_0281546 3300037068 Bacteria 1339
457 Ga0373925_0545741 3300037068 Bacteria 953
458 Ga0436362_0941488 3300039453 Bacteria 849
459 Ga0451839_1310317 3300041496 Bacteria 642
460 Ga0450920_048426 3300042122 Bacteria 851
461 Ga0450920_056922 3300042122 Bacteria 788
462 Ga0439446_0031821 3300042156 Bacteria 1528
463 Ga0439446_0172916 3300042156 Bacteria 719
464 Ga0439460_0019860 3300042461 Bacteria 1823
465 Ga0450916_000502 3300042530 Bacteria 3425
466 Ga0466963_0109939 3300044694 Bacteria 1891
467 Ga0453684_0121001 3300044712 Bacteria 3161
468 Ga0451576_0071334 3300045051 Bacteria 3615
469 Ga0451576_0277902 3300045051 Bacteria 1751
470 Ga0451576_1037898 3300045051 Bacteria 859
471 Ga0451576_1823096 3300045051 Bacteria 629
472 Ga0495592_0087298 3300046454 Bacteria 2244
473 Ga0495603_0056649 3300046455 Bacteria 2320
474 Ga0495603_0297709 3300046455 Bacteria 926
475 Ga0495603_0566865 3300046455 Bacteria 650
476 Ga0495629_0108936 3300046459 Bacteria 1932
477 Ga0495641_0068787 3300046461 Bacteria 1592
478 Ga0495651_0599107 3300046462 Bacteria 695
479 Ga0495653_0159656 3300046463 Bacteria 1566
480 Ga0495653_0252550 3300046463 Bacteria 1170
481 Ga0495582_0041828 3300046473 Bacteria 2525
482 Ga0495582_0422807 3300046473 Bacteria 769
483 Ga0495582_0606613 3300046473 Bacteria 633
484 Ga0495639_0206318 3300046475 Bacteria 963
485 Ga0495639_0395149 3300046475 Bacteria 698
486 Ga0495607_0238917 3300046501 Bacteria 880
487 Ga0495608_0039741 3300046511 Bacteria 3152
488 Ga0495608_0213098 3300046511 Bacteria 1214
489 Ga0495610_0116527 3300046512 Bacteria 1177
490 Ga0495628_0154047 3300046516 Bacteria 1749
491 Ga0495628_0162934 3300046516 Bacteria 1694
492 Ga0495628_0203404 3300046516 Bacteria 1491
493 Ga0495630_0010900 3300046517 Bacteria 6565
494 Ga0495630_0318966 3300046517 Bacteria 1188
495 Ga0495630_0406660 3300046517 Bacteria 1043
496 Ga0495666_0192761 3300046526 Bacteria 939
497 Ga0495652_0401588 3300046529 Bacteria 970
498 Ga0495640_0332366 3300046533 Bacteria 940
499 Ga0495640_0593247 3300046533 Bacteria 669
500 Ga0495587_0053831 3300046536 Bacteria 2372
501 Ga0495587_0368436 3300046536 Bacteria 800
502 Ga0495598_0209738 3300046537 Bacteria 707
503 Ga0495645_0004427 3300046543 Bacteria 9593
504 Ga0495656_0119836 3300046615 Bacteria 1241
505 Ga0495656_0287918 3300046615 Bacteria 839
506 Ga0495634_0280130 3300046642 Bacteria 1013
507 Ga0495611_0179280 3300046648 Bacteria 990
508 Ga0495635_0471561 3300046663 Bacteria 828
509 Ga0495657_0047275 3300046675 Bacteria 2910
510 Ga0495599_0110128 3300046678 Bacteria 1716
511 Ga0495599_0240460 3300046678 Bacteria 1104
512 Ga0495647_0024667 3300046681 Bacteria 2191
513 Ga0495647_0029173 3300046681 Bacteria 2039
514 Ga0495647_0031489 3300046681 Bacteria 1973
515 Ga0495647_0187512 3300046681 Bacteria 902
516 Ga0495658_0046802 3300046683 Bacteria 2433
517 Ga0495658_0063955 3300046683 Bacteria 2118
518 Ga0495669_0134426 3300046684 Bacteria 1165
519 Ga0495613_0013985 3300046689 Bacteria 5957
520 Ga0495613_0199781 3300046689 Bacteria 1410
521 Ga0495613_0202812 3300046689 Bacteria 1398
522 Ga0495624_0143899 3300046690 Bacteria 1460
523 Ga0495670_0317137 3300046691 Bacteria 837
524 Ga0495670_0481795 3300046691 Bacteria 673
525 Ga0495600_0293614 3300046809 Bacteria 1027
526 Ga0495600_0488459 3300046809 Bacteria 758
527 Ga0495600_0494407 3300046809 Bacteria 752
528 Ga0495581_0450625 3300047315 Bacteria 749
529 Ga0495604_0039449 3300047317 Bacteria 3711
530 Ga0495604_0115887 3300047317 Bacteria 1946
531 Ga0495674_0044746 3300047319 Bacteria 3934
532 Ga0495674_0130151 3300047319 Bacteria 2120
533 Ga0495680_0155995 3300047322 Bacteria 1660
534 Ga0495680_0180664 3300047322 Bacteria 1523
535 Ga0495680_0290614 3300047322 Bacteria 1150
536 Ga0495675_0369920 3300047444 Bacteria 840
537 Ga0495684_0001687 3300047471 Bacteria 17745
538 Ga0495684_0073724 3300047471 Bacteria 2593
539 Ga0495602_0306123 3300048088 Bacteria 1161
540 Ga0496100_0004796 3300048903 Bacteria 7222
541 Ga0496100_0149902 3300048903 Bacteria 1662
542 Ga0496101_0000396 3300048904 Bacteria 28444
543 Ga0496102_0213093 3300048905 Bacteria 1821
544 Ga0496102_0267652 3300048905 Bacteria 1611
545 Ga0496102_0404817 3300048905 Bacteria 1283
546 Ga0496102_0457266 3300048905 Bacteria 1197
547 Ga0496103_0584234 3300048906 Bacteria 712
548 Ga0496104_0017385 3300048907 Bacteria 6549
549 Ga0496104_0021813 3300048907 Bacteria 5883
550 Ga0496104_0083357 3300048907 Bacteria 3049
551 Ga0496104_0354243 3300048907 Bacteria 1380
552 Ga0496104_0368628 3300048907 Bacteria 1349
553 Ga0496105_0090691 3300048908 Bacteria 2524
554 Ga0496105_0124564 3300048908 Bacteria 2124
555 Ga0496106_0311109 3300048909 Bacteria 1264
556 Ga0496107_0031098 3300048910 Bacteria 3807
557 Ga0496107_0104604 3300048910 Bacteria 2078
558 Ga0496108_0011060 3300048911 Bacteria 7328
559 Ga0496108_0310386 3300048911 Bacteria 1374
560 Ga0496109_0151382 3300048912 Bacteria 2172
561 Ga0496109_0191312 3300048912 Bacteria 1923
562 Ga0496110_0157481 3300048913 Bacteria 2058
563 Ga0496110_0399484 3300048913 Bacteria 1253
564 Ga0496110_1004039 3300048913 Bacteria 742
565 Ga0496111_0549294 3300048914 Bacteria 848
566 Ga0496112_0016237 3300048915 Bacteria 6967
567 Ga0496112_0055326 3300048915 Bacteria 3901
568 Ga0496112_0199485 3300048915 Bacteria 1961
569 Ga0496112_0394138 3300048915 Bacteria 1325
570 Ga0496112_0745016 3300048915 Bacteria 906
571 Ga0496113_0032056 3300048916 Bacteria 3817
572 Ga0496114_0000246 3300048917 Bacteria 39480
573 Ga0496114_0013645 3300048917 Bacteria 6514
574 Ga0496114_0172098 3300048917 Bacteria 1888
575 Ga0496114_0259315 3300048917 Bacteria 1530
576 Ga0496114_0333337 3300048917 Bacteria 1341
577 Ga0496114_0489114 3300048917 Bacteria 1088
578 Ga0496115_0383448 3300048918 Bacteria 1143
579 Ga0496115_0513647 3300048918 Bacteria 961
580 Ga0495682_0101315 3300049460 Bacteria 1033
581 Ga0501318_058812 3300049534 Bacteria 586
582 Ga0501034_0077055 3300049571 Bacteria 3340
583 Ga0501034_0108508 3300049571 Bacteria 2767
584 Ga0501036_0997737 3300049572 Bacteria 685
585 Ga0501038_0525123 3300049574 Bacteria 903
586 Ga0501039_0924243 3300049575 Bacteria 679
587 Ga0501041_0273442 3300049577 Bacteria 1063
588 Ga0501042_1188518 3300049578 Bacteria 556
589 Ga0501043_0067123 3300049579 Bacteria 2817
590 Ga0501047_0015370 3300049581 Bacteria 7290
591 Ga0501047_0399559 3300049581 Bacteria 1207
592 Ga0501048_0193859 3300049582 Bacteria 1440
593 Ga0501068_0172060 3300049584 Bacteria 1367
594 Ga0501070_0443810 3300049586 Bacteria 1047
595 Ga0501072_0531812 3300049588 Bacteria 929
596 Ga0501073_0177565 3300049589 Bacteria 1474
597 Ga0501076_0161703 3300049592 Bacteria 1824
598 Ga0501080_0958755 3300049742 Bacteria 743
599 Ga0501081_0126226 3300049743 Bacteria 1825
600 Ga0501083_0137210 3300049744 Bacteria 1602
601 Ga0501044_0003452 3300049823 Bacteria 17800
602 Ga0501045_0482481 3300049824 Bacteria 921
603 nmdc:mga00v17_169418_c1 3300050491 Bacteria 1408
604 nmdc:mga0k408_227432_c1 3300050493 Bacteria 1114
605 nmdc:mga06z11_310287_c1 3300050494 Bacteria 939
606 nmdc:mga06z11_54011_c1 3300050494 Bacteria 2069
607 nmdc:mga04h51_118064_c1 3300050495 Bacteria 985
608 nmdc:mga05p37_119480_c1 3300050507 Bacteria 3238
609 nmdc:mga05p37_260703_c1 3300050507 Bacteria 2075
610 nmdc:mga05p37_361676_c1 3300050507 Bacteria 1706
611 nmdc:mga05p37_403716_c1 3300050507 Bacteria 1595
612 nmdc:mga05p37_411029_c1 3300050507 Bacteria 1577
613 nmdc:mga05p37_416605_c1 3300050507 Bacteria 1564
614 nmdc:mga05p37_6561_c1 3300050507 Bacteria 13712
615 nmdc:mga09592_112102_c1 3300050508 Bacteria 2340
616 nmdc:mga0qj67_297758_c1 3300050509 Bacteria 1307
617 nmdc:mga0qj67_786687_c1 3300050509 Bacteria 754
618 nmdc:mga06r32_45742_c1 3300050510 Bacteria 4173
619 nmdc:mga06r32_490383_c1 3300050510 Bacteria 1206
620 nmdc:mga08y16_1091636_c1 3300050511 Bacteria 773
621 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
622 nmdc:mga08y16_1463818_c1 3300050511 Bacteria 644
623 nmdc:mga08y16_16207_c1 3300050511 Bacteria 7835
624 nmdc:mga08y16_20665_c1 3300050511 Bacteria 6949
625 nmdc:mga08y16_95418_c1 3300050511 Bacteria 3098
626 nmdc:mga0n895_12982_c1 3300050512 Bacteria 4790
627 nmdc:mga0n895_17757_c1 3300050512 Bacteria 6566
628 nmdc:mga0n895_24421_c1 3300050512 Bacteria 5697
629 nmdc:mga0n895_27160_c1 3300050512 Bacteria 5435
630 nmdc:mga0n895_449050_c1 3300050512 Bacteria 1302
631 nmdc:mga0n895_490768_c1 3300050512 Bacteria 1238
632 nmdc:mga0n895_7101_c1 3300050512 Bacteria 9574
633 nmdc:mga0n895_957514_c1 3300050512 Bacteria 839
634 nmdc:mga0rr50_140171_c1 3300050513 Bacteria 1945
635 nmdc:mga0rr50_1773_c1 3300050513 Bacteria 11923
636 nmdc:mga0rr50_2205_c1 3300050513 Bacteria 10927
637 nmdc:mga0rr50_373_c1 3300050513 Bacteria 24506
638 nmdc:mga0rr50_40661_c1 3300050513 Bacteria 3382
639 nmdc:mga0rr50_435801_c1 3300050513 Bacteria 1110
640 nmdc:mga08x19_10007_c1 3300050514 Bacteria 5684
641 nmdc:mga08x19_189510_c1 3300050514 Bacteria 1407
642 nmdc:mga08x19_441276_c1 3300050514 Bacteria 916
643 nmdc:mga08x19_79203_c1 3300050514 Bacteria 2155
644 nmdc:mga0a205_10346_c1 3300050515 Bacteria 8575
645 nmdc:mga0a205_14317_c1 3300050515 Bacteria 7396
646 nmdc:mga0a205_162299_c1 3300050515 Bacteria 2131
647 nmdc:mga0a205_193005_c1 3300050515 Bacteria 1928
648 nmdc:mga0a205_255698_c1 3300050515 Bacteria 1630
649 nmdc:mga0a205_616154_c1 3300050515 Bacteria 938
650 nmdc:mga0a205_6655_c1 3300050515 Bacteria 10458
651 Ga0495601_0040645 3300053077 Bacteria 2913
652 Ga0495601_0073947 3300053077 Bacteria 2180
653 Ga0495601_0179517 3300053077 Bacteria 1384
654 Ga0495612_0184035 3300053078 Bacteria 918
655 Ga0495612_0206914 3300053078 Bacteria 867
656 Ga0495595_0015689 3300053084 Bacteria 3233
657 Ga0495595_0015791 3300053084 Bacteria 3224
658 Ga0495595_0099791 3300053084 Bacteria 1400
659 Ga0495595_0246585 3300053084 Bacteria 894
660 Ga0495595_0247835 3300053084 Bacteria 892
661 Ga0495619_0076292 3300053085 Bacteria 2250
662 Ga0495619_0163154 3300053085 Bacteria 1539
663 Ga0500555_000474 3300053103 Bacteria 16656
664 Ga0500556_0001889 3300053104 Bacteria 7496
665 Ga0500658_0026256 3300053134 Bacteria 2243
666 Ga0500568_0002524 3300053139 Bacteria 10698
667 Ga0500616_0000173 3300053153 Bacteria 107646
668 Ga0500627_0271257 3300053158 Bacteria 747
669 Ga0590071_010704 3300059421 Bacteria 2145
670 Ga0590075_059940 3300059424 Bacteria 980
671 Ga0501082_0139167 3300060353 Bacteria 2107
672 Ga0058861_12003411
673 Ga0065712_10033738
674 Ga0065715_10238277
675 Ga0065707_10089023
676 Ga0065707_10519979
677 Ga0070658_10302065
678 Ga0070676_10007044
679 Ga0070676_10100742
680 Ga0070676_10285363
681 Ga0070683_100763243
682 Ga0070670_100050949
683 Ga0070670_100280626
684 Ga0070670_100362036
685 Ga0070670_100596116
686 Ga0070677_10104469
687 Ga0070666_10051882
688 Ga0070666_10123865
689 Ga0070666_10212816
690 Ga0070666_10310169
691 Ga0070682_100444190
692 Ga0068868_100055137
693 Ga0068868_100553795
694 Ga0068868_100887592
695 Ga0070660_100520246
696 Ga0070689_100460205
697 Ga0070691_10004188
698 Ga0070687_100080522
699 Ga0070668_100489968
700 Ga0070669_100110504
701 Ga0070675_100000056
702 Ga0070675_100029203
703 Ga0070675_100546245
704 Ga0070675_100735796
705 Ga0070674_100007417
706 Ga0070674_100046049
707 Ga0070674_100078891
708 Ga0070674_100192253
709 Ga0070674_100202289
710 Ga0070674_100278160
711 Ga0070674_100554456
712 Ga0070673_100003427
713 Ga0070673_100043981
714 Ga0070673_100460085
715 Ga0070667_100165408
716 Ga0070667_100168474
717 Ga0070667_100643276
718 Ga0070667_101228191
719 Ga0070714_100050502
720 Ga0070701_10010126
721 Ga0070701_10205854
722 Ga0070711_100592938
723 Ga0070705_100044955
724 Ga0070705_100573723
725 Ga0070705_100971410
726 Ga0070700_100432017
727 Ga0070694_100016422
728 Ga0070708_100055234
729 Ga0070663_100654247
730 Ga0070678_100092251
731 Ga0070662_100496398
732 Ga0070681_10042357
733 Ga0070681_10348644
734 Ga0068867_100035655
735 Ga0068867_100041777
736 Ga0068867_100073877
737 Ga0068867_100513996
738 Ga0068867_100588601
739 Ga0068867_100816926
740 Ga0070706_100556565
741 Ga0070707_100125461
742 Ga0070707_100175008
743 Ga0070698_100034124
744 Ga0070698_100183947
745 Ga0070698_100367829
746 Ga0070698_100995188
747 Ga0070699_100119032
748 Ga0070699_100741988
749 Ga0070679_100044653
750 Ga0070684_100744697
751 Ga0070697_100193729
752 Ga0070672_100417490
753 Ga0070672_100454407
754 Ga0070686_100002243
755 Ga0070686_100024325
756 Ga0070695_100063603
757 Ga0070695_100169060
758 Ga0070696_100012605
759 Ga0070696_100133503
760 Ga0070696_100145121
761 Ga0070696_100184966
762 Ga0070696_100694764
763 Ga0070693_100512486
764 Ga0070665_100004733
765 Ga0070665_100005447
766 Ga0070665_100010437
767 Ga0070704_100096664
768 Ga0070704_100355660
769 Ga0070704_100462367
770 Ga0068855_100286434
771 Ga0070664_100563231
772 Ga0068857_101000445
773 Ga0068854_100177554
774 Ga0068854_100637221
775 Ga0068856_100018557
776 Ga0070702_100002883
777 Ga0070702_100036054
778 Ga0070702_100096432
779 Ga0068859_100020008
780 Ga0068859_100168307
781 Ga0068859_100700495
782 Ga0068864_100075695
783 Ga0068866_10332190
784 Ga0068861_100024888
785 Ga0068861_100463764
786 Ga0068861_101645756
787 Ga0068870_10321948
788 Ga0068863_100116322
789 Ga0068863_100116801
790 Ga0068858_100001254
791 Ga0068858_100008638
792 Ga0068858_100189424
793 Ga0068858_100524546
794 Ga0068858_100793695
795 Ga0068858_101016433
796 Ga0068858_101641368
797 Ga0068860_100123715
798 Ga0068860_100129065
799 Ga0068860_100304196
800 Ga0068860_100304719
801 Ga0068860_100328276
802 Ga0068860_100344425
803 Ga0068860_100534033
804 Ga0068862_100109135
805 Ga0068862_100110658
806 Ga0068862_100157630
807 Ga0081455_10174261
808 Ga0081455_10345681
809 Ga0081540_1096511
810 Ga0081539_10100098
811 Ga0081539_10197007
812 Ga0075368_10004958
813 Ga0075432_10185114
814 Ga0070716_100341366
815 Ga0075367_10010203
816 Ga0075367_10028961
817 Ga0075367_10258480
818 Ga0097621_100006061
819 Ga0097621_100118810
820 Ga0097621_100228720
821 Ga0097621_100238936
822 Ga0068871_100006055
823 Ga0068871_100075510
824 Ga0075428_100000009
825 Ga0075428_100312003
826 Ga0075428_100319068
827 Ga0075428_100348183
828 Ga0075430_100105326
829 Ga0075431_100261523
830 Ga0075431_100598368
831 Ga0075433_10100150
832 Ga0075433_10128181
833 Ga0075433_10422349
834 Ga0075433_10530184
835 Ga0075433_10616820
836 Ga0075433_11134277
837 Ga0075434_100069571
838 Ga0075434_100109389
839 Ga0075434_100110530
840 Ga0075434_100135753
841 Ga0075434_100385465
842 Ga0075434_101223515
843 Ga0075429_100522210
844 Ga0068865_100006729
845 Ga0068865_100055357
846 Ga0075436_100018272
847 Ga0075436_100038116
848 Ga0075436_100110506
849 Ga0097620_100020008
850 Ga0097620_100168317
851 Ga0097620_100700471
852 Ga0075435_100001542
853 Ga0075435_100001694
854 Ga0075435_100028991
855 Ga0075435_100038141
856 Ga0105240_10045226
857 Ga0105240_10177867
858 Ga0105240_11200222
859 Ga0111539_10000010
860 Ga0111539_10000566
861 Ga0111539_10293747
862 Ga0111539_11332686
863 Ga0105245_10035527
864 Ga0105245_10062980
865 Ga0105245_10473430
866 Ga0105247_10004209
867 Ga0105247_10511839
868 Ga0114129_10017270
869 Ga0114129_10117140
870 Ga0114129_10118442
871 Ga0114129_10148538
872 Ga0114129_10216991
873 Ga0114129_11634253
874 Ga0105243_10054004
875 Ga0105243_10105863
876 Ga0105243_11686437
877 Ga0105241_10100846
878 Ga0105242_10013585
879 Ga0105242_10035616
880 Ga0105242_10125367
881 Ga0105242_10177665
882 Ga0105248_10026461
883 Ga0105248_10261960
884 Ga0105248_10387276
885 Ga0105248_10404784
886 Ga0105248_10452960
887 Ga0105248_10819264
888 Ga0105238_10125557
889 Ga0105238_11387555
890 Ga0105249_10455911
891 Ga0099796_10030103
892 Ga0105239_11680584
893 Ga0157313_1011512
894 Ga0157374_10119547
895 Ga0157374_10311603
896 Ga0157374_10433731
897 Ga0157374_10899348
898 Ga0157374_11120636
899 Ga0157378_10067386
900 Ga0163162_10364795
901 Ga0163162_10519827
902 Ga0157375_10053326
903 Ga0157375_10277484
904 Ga0163163_10087285
905 Ga0163163_10125545
906 Ga0163163_10548400
907 Ga0163163_10641362
908 Ga0157380_10007827
909 Ga0157380_10190699
910 Ga0157380_10194070
911 Ga0157380_10489694
912 Ga0157380_10547053
913 Ga0157377_10019122
914 Ga0157379_10018550
915 Ga0157379_10063370
916 Ga0157379_10138355
917 Ga0157379_10146389
918 Ga0157379_10802200
919 Ga0157379_11038565
920 Ga0157376_10057273
921 Ga0157376_10145796
922 Ga0157376_11266519
923 Ga0213873_10124294
924 Ga0207697_10089053
925 Ga0207697_10157139
926 Ga0207682_10094553
927 Ga0207682_10146518
928 Ga0207682_10342783
929 Ga0207642_10054168
930 Ga0207642_10258962
931 Ga0207642_10948925
932 Ga0207688_10190402
933 Ga0207688_10337075
934 Ga0207680_10142428
935 Ga0207680_10349441
936 Ga0207680_10364852
937 Ga0207647_10156595
938 Ga0207645_10096400
939 Ga0207645_10155591
940 Ga0207645_10307973
941 Ga0207643_10090349
942 Ga0207705_10423658
943 Ga0207705_10546213
944 Ga0207654_10223831
945 Ga0207707_10312425
946 Ga0207695_10084625
947 Ga0207695_10131709
948 Ga0207695_10642497
949 Ga0207693_10257754
950 Ga0207663_10236530
951 Ga0207660_10323655
952 Ga0207662_10178874
953 Ga0207657_10013143
954 Ga0207649_10659408
955 Ga0207649_10693416
956 Ga0207646_10097073
957 Ga0207646_10731602
958 Ga0207694_10261502
959 Ga0207694_10758091
960 Ga0207694_10758852
961 Ga0207650_10877977
962 Ga0207659_10126623
963 Ga0207687_10015584
964 Ga0207687_10063053
965 Ga0207687_10098805
966 Ga0207664_10050545
967 Ga0207644_10120436
968 Ga0207644_11023801
969 Ga0207690_10232957
970 Ga0207706_10450722
971 Ga0207686_10013361
972 Ga0207686_10016494
973 Ga0207686_10147455
974 Ga0207686_10160445
975 Ga0207709_10007222
976 Ga0207669_10039737
977 Ga0207669_10127353
978 Ga0207669_10297868
979 Ga0207669_10337513
980 Ga0207669_10392616
981 Ga0207669_10553177
982 Ga0207669_11301839
983 Ga0207704_10005828
984 Ga0207704_10169986
985 Ga0207704_10211258
986 Ga0207704_10464569
987 Ga0207704_10707716
988 Ga0207665_10048683
989 Ga0207665_10565550
990 Ga0207665_10847167
991 Ga0207691_10339779
992 Ga0207691_10419050
993 Ga0207691_10555542
994 Ga0207711_10026433
995 Ga0207711_10058386
996 Ga0207711_10137892
997 Ga0207711_10169022
998 Ga0207711_10212107
999 Ga0207711_10393563
1000 Ga0207689_10034411
1001 Ga0207661_10337766
1002 Ga0207667_10168529
1003 Ga0207651_10041000
1004 Ga0207651_10110459
1005 Ga0207651_10149189
1006 Ga0207651_10156204
1007 Ga0207712_10726235
1008 Ga0207712_11612361
1009 Ga0207668_10076681
1010 Ga0207668_10092168
1011 Ga0207668_10098613
1012 Ga0207640_10114374
1013 Ga0207658_10276346
1014 Ga0207658_11054258
1015 Ga0207677_10497170
1016 Ga0207677_11060195
1017 Ga0207703_10215416
1018 Ga0207703_10280457
1019 Ga0207703_10361518
1020 Ga0207703_11452727
1021 Ga0207639_10543413
1022 Ga0207708_10105615
1023 Ga0207708_10328664
1024 Ga0207702_10262266
1025 Ga0207641_10752171
1026 Ga0207648_10016724
1027 Ga0207648_10037722
1028 Ga0207648_10082760
1029 Ga0207648_10319166
1030 Ga0207676_10028142
1031 Ga0207676_10069079
1032 Ga0207676_10164224
1033 Ga0207676_10416489
1034 Ga0207676_10694427
1035 Ga0207674_10203527
1036 Ga0207675_100014045
1037 Ga0207675_100038967
1038 Ga0207675_100412832
1039 Ga0207675_100818367
1040 Ga0207683_11447570
1041 Ga0207698_11764993
1042 Ga0209967_1039820
1043 Ga0209970_1014250
1044 Ga0209813_10100043
1045 Ga0207428_10000034
1046 Ga0207428_10072788
1047 Ga0207428_10073024
1048 Ga0207428_10107542
1049 Ga0207428_10120374
1050 Ga0268266_10005896
1051 Ga0268266_10029767
1052 Ga0268266_10219488
1053 Ga0268265_10005520
1054 Ga0268265_10025303
1055 Ga0268265_10113738
1056 Ga0268265_10733702
1057 Ga0268264_10042810
1058 Ga0268264_10050141
1059 Ga0268264_10317611
1060 Ga0268264_11287382
1061 Ga0265338_10656703
1062 Ga0265332_10048353
1063 Ga0265316_10261546
1064 Ga0265314_10007579
1065 Ga0265314_10013729
1066 Ga0265342_10192479
1067 Ga0307413_10091526
1068 Ga0307413_10220584
1069 Ga0307413_10391449
1070 Ga0307412_10843067
1071 Ga0307416_100160347
1072 Ga0307416_100512333
1073 Ga0307416_100922927
1074 Ga0307411_10170887
1075 Ga0307411_10594306
1076 Ga0373930_0002995
1077 Ga0373948_0001483
1078 Ga0373958_0000045
1079 Ga0373959_0001151
1080 Ga0373938_0000418
1081 Ga0373928_0001212
1082 Ga0373929_0000116
1083 Ga0373940_0000084
1084 Ga0373944_0043759
1085 Ga0373944_0073733
1086 Ga0373944_0224850
1087 Ga0373949_0000597
1088 Ga0373949_0033224
1089 Ga0373951_0001673
1090 Ga0373952_0001387
1091 Ga0373932_0006095
1092 Ga0373936_0092396
1093 Ga0373936_0346338
1094 Ga0373939_0001888
1095 Ga0373939_0031755
1096 Ga0373939_0107081
1097 Ga0373941_0000161
1098 Ga0373945_0056786
1099 Ga0373953_0044678
1100 Ga0373953_0132653
1101 Ga0373956_0208787
1102 Ga0373957_0061355
1103 Ga0373960_0001448
1104 Ga0373943_0571512
1105 Ga0373946_0369495
1106 Ga0373955_0047351
1107 Ga0373955_0059904
1108 Ga0373955_0171915
1109 Ga0373955_0273145
1110 Ga0373942_0001757
1111 Ga0373961_0001591
1112 Ga0373961_0111475
1113 Ga0373962_0000245
1114 Ga0373924_0173653
1115 Ga0373931_0009494
1116 Ga0373931_0169020
1117 Ga0373935_0087624
1118 Ga0373935_1067504
1119 Ga0373927_0199653
1120 Ga0373947_0085310
1121 Ga0373937_0055553
1122 Ga0373937_0139222
1123 Ga0373937_0170677
1124 Ga0373937_0356987
1125 Ga0373925_0160073
1126 Ga0373925_0251097
1127 Ga0373925_0281546
1128 Ga0373925_0545741
1129 Ga0436362_0941488
1130 Ga0451839_1310317
1131 Ga0450920_048426
1132 Ga0450920_056922
1133 Ga0439446_0031821
1134 Ga0439446_0172916
1135 Ga0439460_0019860
1136 Ga0450916_000502
1137 Ga0466963_0109939
1138 Ga0453684_0121001
1139 Ga0451576_0071334
1140 Ga0451576_0277902
1141 Ga0451576_1037898
1142 Ga0451576_1823096
1143 Ga0495592_0087298
1144 Ga0495603_0056649
1145 Ga0495603_0297709
1146 Ga0495603_0566865
1147 Ga0495629_0108936
1148 Ga0495641_0068787
1149 Ga0495651_0599107
1150 Ga0495653_0159656
1151 Ga0495653_0252550
1152 Ga0495582_0041828
1153 Ga0495582_0422807
1154 Ga0495582_0606613
1155 Ga0495639_0206318
1156 Ga0495639_0395149
1157 Ga0495607_0238917
1158 Ga0495608_0039741
1159 Ga0495608_0213098
1160 Ga0495610_0116527
1161 Ga0495628_0154047
1162 Ga0495628_0162934
1163 Ga0495628_0203404
1164 Ga0495630_0010900
1165 Ga0495630_0318966
1166 Ga0495630_0406660
1167 Ga0495666_0192761
1168 Ga0495652_0401588
1169 Ga0495640_0332366
1170 Ga0495640_0593247
1171 Ga0495587_0053831
1172 Ga0495587_0368436
1173 Ga0495598_0209738
1174 Ga0495645_0004427
1175 Ga0495656_0119836
1176 Ga0495656_0287918
1177 Ga0495634_0280130
1178 Ga0495611_0179280
1179 Ga0495635_0471561
1180 Ga0495657_0047275
1181 Ga0495599_0110128
1182 Ga0495599_0240460
1183 Ga0495647_0024667
1184 Ga0495647_0029173
1185 Ga0495647_0031489
1186 Ga0495647_0187512
1187 Ga0495658_0046802
1188 Ga0495658_0063955
1189 Ga0495669_0134426
1190 Ga0495613_0013985
1191 Ga0495613_0199781
1192 Ga0495613_0202812
1193 Ga0495624_0143899
1194 Ga0495670_0317137
1195 Ga0495670_0481795
1196 Ga0495600_0293614
1197 Ga0495600_0488459
1198 Ga0495600_0494407
1199 Ga0495581_0450625
1200 Ga0495604_0039449
1201 Ga0495604_0115887
1202 Ga0495674_0044746
1203 Ga0495674_0130151
1204 Ga0495680_0155995
1205 Ga0495680_0180664
1206 Ga0495680_0290614
1207 Ga0495675_0369920
1208 Ga0495684_0001687
1209 Ga0495684_0073724
1210 Ga0495602_0306123
1211 Ga0496100_0004796
1212 Ga0496100_0149902
1213 Ga0496101_0000396
1214 Ga0496102_0213093
1215 Ga0496102_0267652
1216 Ga0496102_0404817
1217 Ga0496102_0457266
1218 Ga0496103_0584234
1219 Ga0496104_0017385
1220 Ga0496104_0021813
1221 Ga0496104_0083357
1222 Ga0496104_0354243
1223 Ga0496104_0368628
1224 Ga0496105_0090691
1225 Ga0496105_0124564
1226 Ga0496106_0311109
1227 Ga0496107_0031098
1228 Ga0496107_0104604
1229 Ga0496108_0011060
1230 Ga0496108_0310386
1231 Ga0496109_0151382
1232 Ga0496109_0191312
1233 Ga0496110_0157481
1234 Ga0496110_0399484
1235 Ga0496110_1004039
1236 Ga0496111_0549294
1237 Ga0496112_0016237
1238 Ga0496112_0055326
1239 Ga0496112_0199485
1240 Ga0496112_0394138
1241 Ga0496112_0745016
1242 Ga0496113_0032056
1243 Ga0496114_0000246
1244 Ga0496114_0013645
1245 Ga0496114_0172098
1246 Ga0496114_0259315
1247 Ga0496114_0333337
1248 Ga0496114_0489114
1249 Ga0496115_0383448
1250 Ga0496115_0513647
1251 Ga0495682_0101315
1252 Ga0501318_058812
1253 Ga0501034_0077055
1254 Ga0501034_0108508
1255 Ga0501036_0997737
1256 Ga0501038_0525123
1257 Ga0501039_0924243
1258 Ga0501041_0273442
1259 Ga0501042_1188518
1260 Ga0501043_0067123
1261 Ga0501047_0015370
1262 Ga0501047_0399559
1263 Ga0501048_0193859
1264 Ga0501068_0172060
1265 Ga0501070_0443810
1266 Ga0501072_0531812
1267 Ga0501073_0177565
1268 Ga0501076_0161703
1269 Ga0501080_0958755
1270 Ga0501081_0126226
1271 Ga0501083_0137210
1272 Ga0501044_0003452
1273 Ga0501045_0482481
1274 nmdc:mga00v17_169418_c1
1275 nmdc:mga0k408_227432_c1
1276 nmdc:mga06z11_310287_c1
1277 nmdc:mga06z11_54011_c1
1278 nmdc:mga04h51_118064_c1
1279 nmdc:mga05p37_119480_c1
1280 nmdc:mga05p37_260703_c1
1281 nmdc:mga05p37_361676_c1
1282 nmdc:mga05p37_403716_c1
1283 nmdc:mga05p37_411029_c1
1284 nmdc:mga05p37_416605_c1
1285 nmdc:mga05p37_6561_c1
1286 nmdc:mga09592_112102_c1
1287 nmdc:mga0qj67_297758_c1
1288 nmdc:mga0qj67_786687_c1
1289 nmdc:mga06r32_45742_c1
1290 nmdc:mga06r32_490383_c1
1291 nmdc:mga08y16_1091636_c1
1292 nmdc:mga08y16_10_c1
1293 nmdc:mga08y16_1463818_c1
1294 nmdc:mga08y16_16207_c1
1295 nmdc:mga08y16_20665_c1
1296 nmdc:mga08y16_95418_c1
1297 nmdc:mga0n895_12982_c1
1298 nmdc:mga0n895_17757_c1
1299 nmdc:mga0n895_24421_c1
1300 nmdc:mga0n895_27160_c1
1301 nmdc:mga0n895_449050_c1
1302 nmdc:mga0n895_490768_c1
1303 nmdc:mga0n895_7101_c1
1304 nmdc:mga0n895_957514_c1
1305 nmdc:mga0rr50_140171_c1
1306 nmdc:mga0rr50_1773_c1
1307 nmdc:mga0rr50_2205_c1
1308 nmdc:mga0rr50_373_c1
1309 nmdc:mga0rr50_40661_c1
1310 nmdc:mga0rr50_435801_c1
1311 nmdc:mga08x19_10007_c1
1312 nmdc:mga08x19_189510_c1
1313 nmdc:mga08x19_441276_c1
1314 nmdc:mga08x19_79203_c1
1315 nmdc:mga0a205_10346_c1
1316 nmdc:mga0a205_14317_c1
1317 nmdc:mga0a205_162299_c1
1318 nmdc:mga0a205_193005_c1
1319 nmdc:mga0a205_255698_c1
1320 nmdc:mga0a205_616154_c1
1321 nmdc:mga0a205_6655_c1
1322 Ga0495601_0040645
1323 Ga0495601_0073947
1324 Ga0495601_0179517
1325 Ga0495612_0184035
1326 Ga0495612_0206914
1327 Ga0495595_0015689
1328 Ga0495595_0015791
1329 Ga0495595_0099791
1330 Ga0495595_0246585
1331 Ga0495595_0247835
1332 Ga0495619_0076292
1333 Ga0495619_0163154
1334 Ga0500555_000474
1335 Ga0500556_0001889
1336 Ga0500658_0026256
1337 Ga0500568_0002524
1338 Ga0500616_0000173
1339 Ga0500627_0271257
1340 Ga0590071_010704
1341 Ga0590075_059940
1342 Ga0501082_0139167

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00333

Ribosomal_S5

Ribosomal protein S5, N-terminal domain

28

92

0.98

PF03719

Ribosomal_S5_C

Ribosomal protein S5, C-terminal domain

104

130

0.89

Map