F474141
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 671 | 362 | 671 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10375177|Ga0070681_103751772 |
| Length | 108 |
| Sequence | MVITIFRSRLRPENQEQYSQWAQQMHDLAVKMPGFISIKTFNAEDGERVSIVEFESEEAVRHWREQAEHRQAQELGRKLFYSEYRIQVCQPIRDYSFPKKTGAPATSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 113 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 114 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 115 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 116 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 117 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 118 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 119 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 120 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 121 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 200 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 212 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 213 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 214 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 223 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 233 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 249 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 250 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 251 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 252 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 253 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 254 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 255 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 256 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 257 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 258 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 259 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 260 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 261 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 262 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 263 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 312 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 313 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 314 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 340 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 341 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 356 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 357 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 358 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 360 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.68 |
| Nodule | 0 |
| Rhizoplane | 3.58 |
| Rhizosphere | 93.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3134885 | 2162886007 | Bacteria | 1096 |
| 2 | ARcpr5oldR_c000007 | 3300000041 | Bacteria | 41749 |
| 3 | ARSoilYngRDRAFT_c00111 | 3300000042 | Bacteria | 13938 |
| 4 | ARcpr5yngRDRAFT_c000090 | 3300000043 | Bacteria | 14724 |
| 5 | ARSoilOldRDRAFT_c000004 | 3300000044 | Bacteria | 62556 |
| 6 | ARCol0oldRDRAFT_c00252 | 3300000045 | Bacteria | 5061 |
| 7 | ARCol0yngRDRAFT_1000074 | 3300000652 | Bacteria | 18636 |
| 8 | JGI24739J22299_10120407 | 3300001989 | Bacteria | 784 |
| 9 | JGI24737J22298_10040242 | 3300001990 | Bacteria | 1435 |
| 10 | JGI24751J29686_10035409 | 3300002459 | Bacteria | 1035 |
| 11 | JGI25405J52794_10019710 | 3300003911 | Bacteria | 1354 |
| 12 | Ga0065704_10140814 | 3300005289 | Bacteria | 1518 |
| 13 | Ga0065712_10074224 | 3300005290 | Bacteria | 4151 |
| 14 | Ga0065715_10001507 | 3300005293 | Bacteria | 6080 |
| 15 | Ga0070676_10178581 | 3300005328 | Bacteria | 1378 |
| 16 | Ga0070676_10723112 | 3300005328 | Bacteria | 729 |
| 17 | Ga0070683_101225567 | 3300005329 | Unclassified | 721 |
| 18 | Ga0070690_100016276 | 3300005330 | Bacteria | 4450 |
| 19 | Ga0070690_100266051 | 3300005330 | Bacteria | 1218 |
| 20 | Ga0068869_100481001 | 3300005334 | Bacteria | 1034 |
| 21 | Ga0070680_100363287 | 3300005336 | Unclassified | 1231 |
| 22 | Ga0070680_100498496 | 3300005336 | Bacteria | 1042 |
| 23 | Ga0070680_101489396 | 3300005336 | Unclassified | 586 |
| 24 | Ga0070682_100062566 | 3300005337 | Bacteria | 2358 |
| 25 | Ga0070682_100378969 | 3300005337 | Bacteria | 1063 |
| 26 | Ga0070682_101036272 | 3300005337 | Bacteria | 683 |
| 27 | Ga0068868_100131943 | 3300005338 | Bacteria | 2045 |
| 28 | Ga0070660_100023926 | 3300005339 | Bacteria | 4530 |
| 29 | Ga0070660_100130906 | 3300005339 | Bacteria | 2008 |
| 30 | Ga0070660_100212826 | 3300005339 | Bacteria | 1570 |
| 31 | Ga0070660_100240451 | 3300005339 | Bacteria | 1475 |
| 32 | Ga0070660_100544293 | 3300005339 | Bacteria | 968 |
| 33 | Ga0070660_100612262 | 3300005339 | Bacteria | 911 |
| 34 | Ga0070689_100132230 | 3300005340 | Bacteria | 2001 |
| 35 | Ga0070691_10015669 | 3300005341 | Bacteria | 3482 |
| 36 | Ga0070687_100058634 | 3300005343 | Bacteria | 2023 |
| 37 | Ga0070661_100228093 | 3300005344 | Bacteria | 1431 |
| 38 | Ga0070661_100859956 | 3300005344 | Bacteria | 747 |
| 39 | Ga0070668_100063032 | 3300005347 | Bacteria | 2873 |
| 40 | Ga0070671_100061508 | 3300005355 | Bacteria | 3127 |
| 41 | Ga0070674_100243238 | 3300005356 | Bacteria | 1410 |
| 42 | Ga0070688_100007418 | 3300005365 | Bacteria | 5911 |
| 43 | Ga0070659_100033098 | 3300005366 | Bacteria | 4013 |
| 44 | Ga0070709_10855111 | 3300005434 | Bacteria | 717 |
| 45 | Ga0070714_100202442 | 3300005435 | Bacteria | 1817 |
| 46 | Ga0070714_101009288 | 3300005435 | Bacteria | 810 |
| 47 | Ga0070710_10292538 | 3300005437 | Bacteria | 1060 |
| 48 | Ga0070701_10086165 | 3300005438 | Bacteria | 1711 |
| 49 | Ga0070701_10194971 | 3300005438 | Bacteria | 1194 |
| 50 | Ga0070701_10376353 | 3300005438 | Bacteria | 894 |
| 51 | Ga0070711_100015569 | 3300005439 | Bacteria | 4814 |
| 52 | Ga0070711_100210514 | 3300005439 | Bacteria | 1505 |
| 53 | Ga0070711_100249465 | 3300005439 | Bacteria | 1391 |
| 54 | Ga0070705_100024922 | 3300005440 | Bacteria | 3236 |
| 55 | Ga0070705_100245552 | 3300005440 | Bacteria | 1253 |
| 56 | Ga0070700_100006176 | 3300005441 | Bacteria | 6383 |
| 57 | Ga0070694_100022606 | 3300005444 | Bacteria | 4031 |
| 58 | Ga0070694_100255402 | 3300005444 | Bacteria | 1328 |
| 59 | Ga0070708_100010550 | 3300005445 | Bacteria | 7492 |
| 60 | Ga0070663_100060440 | 3300005455 | Bacteria | 2726 |
| 61 | Ga0070663_100397782 | 3300005455 | Bacteria | 1125 |
| 62 | Ga0070663_100527909 | 3300005455 | Bacteria | 984 |
| 63 | Ga0070678_100061654 | 3300005456 | Bacteria | 2765 |
| 64 | Ga0070678_100161142 | 3300005456 | Bacteria | 1817 |
| 65 | Ga0070662_100020477 | 3300005457 | Bacteria | 4504 |
| 66 | Ga0070662_100060479 | 3300005457 | Bacteria | 2762 |
| 67 | Ga0070662_100467770 | 3300005457 | Bacteria | 1048 |
| 68 | Ga0070662_100520410 | 3300005457 | Bacteria | 994 |
| 69 | Ga0070681_10012985 | 3300005458 | Bacteria | 8271 |
| 70 | Ga0070681_10035954 | 3300005458 | Bacteria | 4975 |
| 71 | Ga0070681_10206806 | 3300005458 | Bacteria | 1880 |
| 72 | Ga0070681_10224839 | 3300005458 | Bacteria | 1792 |
| 73 | Ga0070681_10375177 | 3300005458 | Bacteria | 1333 |
| 74 | Ga0068867_100037428 | 3300005459 | Bacteria | 3526 |
| 75 | Ga0068867_101011014 | 3300005459 | Bacteria | 754 |
| 76 | Ga0070706_100475797 | 3300005467 | Bacteria | 1162 |
| 77 | Ga0070706_100867938 | 3300005467 | Bacteria | 834 |
| 78 | Ga0070707_100410356 | 3300005468 | Bacteria | 1315 |
| 79 | Ga0070698_100194771 | 3300005471 | Bacteria | 1964 |
| 80 | Ga0074259_10551873 | 3300005507 | Unclassified | 555 |
| 81 | Ga0070699_100276198 | 3300005518 | Bacteria | 1504 |
| 82 | Ga0070679_100174499 | 3300005530 | Bacteria | 2122 |
| 83 | Ga0070679_100178466 | 3300005530 | Bacteria | 2096 |
| 84 | Ga0070679_100376970 | 3300005530 | Bacteria | 1365 |
| 85 | Ga0070679_100414523 | 3300005530 | Bacteria | 1292 |
| 86 | Ga0070679_100720363 | 3300005530 | Unclassified | 940 |
| 87 | Ga0070679_100961102 | 3300005530 | Bacteria | 798 |
| 88 | Ga0070679_101788471 | 3300005530 | Unclassified | 563 |
| 89 | Ga0070684_100013001 | 3300005535 | Bacteria | 6697 |
| 90 | Ga0070684_100446112 | 3300005535 | Bacteria | 1196 |
| 91 | Ga0068853_100265245 | 3300005539 | Bacteria | 1580 |
| 92 | Ga0070672_100520224 | 3300005543 | Bacteria | 1031 |
| 93 | Ga0070686_100375741 | 3300005544 | Bacteria | 1074 |
| 94 | Ga0070695_100487841 | 3300005545 | Bacteria | 951 |
| 95 | Ga0070695_101137079 | 3300005545 | Bacteria | 640 |
| 96 | Ga0070693_100185933 | 3300005547 | Bacteria | 1341 |
| 97 | Ga0070665_101152896 | 3300005548 | Bacteria | 786 |
| 98 | Ga0070704_101243516 | 3300005549 | Bacteria | 680 |
| 99 | Ga0068855_100047838 | 3300005563 | Bacteria | 5051 |
| 100 | Ga0068855_100613714 | 3300005563 | Bacteria | 1172 |
| 101 | Ga0070664_100235074 | 3300005564 | Bacteria | 1644 |
| 102 | Ga0070664_101240334 | 3300005564 | Bacteria | 704 |
| 103 | Ga0068854_100412823 | 3300005578 | Bacteria | 1120 |
| 104 | Ga0068854_100684475 | 3300005578 | Bacteria | 884 |
| 105 | Ga0068856_101156346 | 3300005614 | Bacteria | 791 |
| 106 | Ga0068856_101446061 | 3300005614 | Bacteria | 702 |
| 107 | Ga0068856_102137680 | 3300005614 | Unclassified | 569 |
| 108 | Ga0068852_100189709 | 3300005616 | Bacteria | 1938 |
| 109 | Ga0068852_100494026 | 3300005616 | Bacteria | 1218 |
| 110 | Ga0068852_100498989 | 3300005616 | Bacteria | 1212 |
| 111 | Ga0068859_100029252 | 3300005617 | Bacteria | 5528 |
| 112 | Ga0068859_101302103 | 3300005617 | Bacteria | 801 |
| 113 | Ga0068864_102373942 | 3300005618 | Unclassified | 537 |
| 114 | Ga0068866_10274370 | 3300005718 | Bacteria | 1042 |
| 115 | Ga0068861_100348775 | 3300005719 | Bacteria | 1298 |
| 116 | Ga0068870_10519446 | 3300005840 | Bacteria | 797 |
| 117 | Ga0068858_100057288 | 3300005842 | Bacteria | 3601 |
| 118 | Ga0068858_101163939 | 3300005842 | Bacteria | 758 |
| 119 | Ga0068860_100020537 | 3300005843 | Bacteria | 6397 |
| 120 | Ga0068862_100070792 | 3300005844 | Bacteria | 3011 |
| 121 | Ga0068862_100581494 | 3300005844 | Unclassified | 1073 |
| 122 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 123 | Ga0081455_10027656 | 3300005937 | Bacteria | 5196 |
| 124 | Ga0081455_10050997 | 3300005937 | Bacteria | 3552 |
| 125 | Ga0081540_1026148 | 3300005983 | Bacteria | 3339 |
| 126 | Ga0070717_10517872 | 3300006028 | Bacteria | 1079 |
| 127 | Ga0075368_10019706 | 3300006042 | Bacteria | 2548 |
| 128 | Ga0075363_100047592 | 3300006048 | Bacteria | 2278 |
| 129 | Ga0075364_10037083 | 3300006051 | Bacteria | 3154 |
| 130 | Ga0075432_10006215 | 3300006058 | Bacteria | 4061 |
| 131 | Ga0075432_10132621 | 3300006058 | Bacteria | 945 |
| 132 | Ga0070715_10957021 | 3300006163 | Bacteria | 531 |
| 133 | Ga0070716_101388129 | 3300006173 | Unclassified | 571 |
| 134 | Ga0070712_100222014 | 3300006175 | Bacteria | 1496 |
| 135 | Ga0075362_10032958 | 3300006177 | Bacteria | 2251 |
| 136 | Ga0075367_10053650 | 3300006178 | Bacteria | 2389 |
| 137 | Ga0075369_10027920 | 3300006186 | Bacteria | 2362 |
| 138 | Ga0075366_10678908 | 3300006195 | Bacteria | 639 |
| 139 | Ga0075370_10081079 | 3300006353 | Bacteria | 1865 |
| 140 | Ga0075428_100002408 | 3300006844 | Bacteria | 20309 |
| 141 | Ga0075430_100000032 | 3300006846 | Bacteria | 72679 |
| 142 | Ga0075431_100009024 | 3300006847 | Bacteria | 9998 |
| 143 | Ga0075431_102131501 | 3300006847 | Unclassified | 515 |
| 144 | Ga0075433_10000976 | 3300006852 | Bacteria | 20309 |
| 145 | Ga0075433_10044742 | 3300006852 | Bacteria | 3847 |
| 146 | Ga0075433_10086034 | 3300006852 | Bacteria | 2776 |
| 147 | Ga0075433_10319165 | 3300006852 | Bacteria | 1374 |
| 148 | Ga0075433_11051906 | 3300006852 | Bacteria | 708 |
| 149 | Ga0075433_11727494 | 3300006852 | Unclassified | 539 |
| 150 | Ga0075434_100000341 | 3300006871 | Bacteria | 33666 |
| 151 | Ga0075434_100027835 | 3300006871 | Bacteria | 5550 |
| 152 | Ga0075434_100059042 | 3300006871 | Bacteria | 3813 |
| 153 | Ga0075434_100072274 | 3300006871 | Bacteria | 3442 |
| 154 | Ga0075434_100431350 | 3300006871 | Bacteria | 1339 |
| 155 | Ga0075429_100000631 | 3300006880 | Bacteria | 27160 |
| 156 | Ga0075429_101042700 | 3300006880 | Bacteria | 715 |
| 157 | Ga0068865_100938981 | 3300006881 | Bacteria | 754 |
| 158 | Ga0075436_100116041 | 3300006914 | Bacteria | 1871 |
| 159 | Ga0075436_100756477 | 3300006914 | Bacteria | 722 |
| 160 | Ga0097620_100029251 | 3300006931 | Bacteria | 5528 |
| 161 | Ga0097620_101302282 | 3300006931 | Bacteria | 801 |
| 162 | Ga0075435_100022993 | 3300007076 | Bacteria | 4814 |
| 163 | Ga0075435_100049803 | 3300007076 | Bacteria | 3370 |
| 164 | Ga0075435_100060236 | 3300007076 | Bacteria | 3078 |
| 165 | Ga0075435_100863239 | 3300007076 | Bacteria | 789 |
| 166 | Ga0075435_101072839 | 3300007076 | Unclassified | 704 |
| 167 | Ga0105240_10028987 | 3300009093 | Bacteria | 7220 |
| 168 | Ga0105240_10055992 | 3300009093 | Unclassified | 4936 |
| 169 | Ga0105240_10111765 | 3300009093 | Bacteria | 3304 |
| 170 | Ga0111539_10000915 | 3300009094 | Bacteria | 38573 |
| 171 | Ga0111539_10001270 | 3300009094 | Bacteria | 33682 |
| 172 | Ga0111539_10077351 | 3300009094 | Bacteria | 3916 |
| 173 | Ga0111539_10197339 | 3300009094 | Bacteria | 2347 |
| 174 | Ga0111539_12459714 | 3300009094 | Bacteria | 604 |
| 175 | Ga0105245_10039789 | 3300009098 | Bacteria | 4185 |
| 176 | Ga0105247_10158180 | 3300009101 | Bacteria | 1498 |
| 177 | Ga0114129_10001035 | 3300009147 | Bacteria | 36374 |
| 178 | Ga0114129_10001551 | 3300009147 | Bacteria | 31169 |
| 179 | Ga0114129_10654038 | 3300009147 | Bacteria | 1356 |
| 180 | Ga0114129_11110381 | 3300009147 | Bacteria | 989 |
| 181 | Ga0105243_10106669 | 3300009148 | Bacteria | 2336 |
| 182 | Ga0105243_10110965 | 3300009148 | Bacteria | 2295 |
| 183 | Ga0105241_10096790 | 3300009174 | Bacteria | 2339 |
| 184 | Ga0105241_10385179 | 3300009174 | Bacteria | 1226 |
| 185 | Ga0105242_10066315 | 3300009176 | Bacteria | 2980 |
| 186 | Ga0105242_10106058 | 3300009176 | Bacteria | 2387 |
| 187 | Ga0105242_10301072 | 3300009176 | Bacteria | 1464 |
| 188 | Ga0105248_10332388 | 3300009177 | Bacteria | 1711 |
| 189 | Ga0105237_10084828 | 3300009545 | Bacteria | 3157 |
| 190 | Ga0105237_10160503 | 3300009545 | Bacteria | 2246 |
| 191 | Ga0105237_10683485 | 3300009545 | Bacteria | 1033 |
| 192 | Ga0105238_11459457 | 3300009551 | Bacteria | 712 |
| 193 | Ga0105238_11771762 | 3300009551 | Unclassified | 649 |
| 194 | Ga0105249_10061774 | 3300009553 | Bacteria | 3438 |
| 195 | Ga0105239_11050476 | 3300010375 | Bacteria | 937 |
| 196 | Ga0105239_12670758 | 3300010375 | Bacteria | 583 |
| 197 | Ga0105239_12826958 | 3300010375 | Bacteria | 566 |
| 198 | Ga0105239_13359783 | 3300010375 | Bacteria | 521 |
| 199 | Ga0105246_10141649 | 3300011119 | Bacteria | 1809 |
| 200 | Ga0105246_10172008 | 3300011119 | Bacteria | 1660 |
| 201 | Ga0157346_1005788 | 3300012480 | Bacteria | 776 |
| 202 | Ga0157323_1002789 | 3300012495 | Bacteria | 1002 |
| 203 | Ga0157319_1043390 | 3300012497 | Unclassified | 534 |
| 204 | Ga0157345_1002502 | 3300012498 | Bacteria | 1300 |
| 205 | Ga0157347_1006398 | 3300012502 | Bacteria | 1151 |
| 206 | Ga0157339_1006073 | 3300012505 | Bacteria | 974 |
| 207 | Ga0157342_1047034 | 3300012507 | Bacteria | 596 |
| 208 | Ga0157315_1022617 | 3300012508 | Bacteria | 678 |
| 209 | Ga0157327_1006620 | 3300012512 | Bacteria | 981 |
| 210 | Ga0157326_1002939 | 3300012513 | Bacteria | 1800 |
| 211 | Ga0157373_10032188 | 3300013100 | Bacteria | 3775 |
| 212 | Ga0157373_10088443 | 3300013100 | Bacteria | 2182 |
| 213 | Ga0157373_10776649 | 3300013100 | Bacteria | 705 |
| 214 | Ga0157373_11303407 | 3300013100 | Unclassified | 550 |
| 215 | Ga0157371_10124619 | 3300013102 | Bacteria | 1832 |
| 216 | Ga0157371_10288824 | 3300013102 | Bacteria | 1186 |
| 217 | Ga0157371_10500097 | 3300013102 | Bacteria | 898 |
| 218 | Ga0157370_10151577 | 3300013104 | Bacteria | 2157 |
| 219 | Ga0157369_10355943 | 3300013105 | Bacteria | 1520 |
| 220 | Ga0157369_10421221 | 3300013105 | Bacteria | 1384 |
| 221 | Ga0157369_10575740 | 3300013105 | Bacteria | 1163 |
| 222 | Ga0157369_11240425 | 3300013105 | Bacteria | 760 |
| 223 | Ga0157374_10045943 | 3300013296 | Bacteria | 4042 |
| 224 | Ga0157378_10049474 | 3300013297 | Bacteria | 3740 |
| 225 | Ga0163162_10030120 | 3300013306 | Bacteria | 5376 |
| 226 | Ga0163162_10047201 | 3300013306 | Bacteria | 4316 |
| 227 | Ga0163162_10955272 | 3300013306 | Bacteria | 968 |
| 228 | Ga0157372_10099175 | 3300013307 | Bacteria | 3323 |
| 229 | Ga0157372_10182904 | 3300013307 | Bacteria | 2427 |
| 230 | Ga0157375_10434633 | 3300013308 | Bacteria | 1478 |
| 231 | Ga0157375_12628648 | 3300013308 | Unclassified | 602 |
| 232 | Ga0163163_12102474 | 3300014325 | Bacteria | 624 |
| 233 | Ga0157380_10032786 | 3300014326 | Bacteria | 3997 |
| 234 | Ga0157380_10151915 | 3300014326 | Unclassified | 2003 |
| 235 | Ga0157380_11007189 | 3300014326 | Bacteria | 867 |
| 236 | Ga0157379_10952289 | 3300014968 | Bacteria | 816 |
| 237 | Ga0157376_10454158 | 3300014969 | Bacteria | 1250 |
| 238 | Ga0157376_11425947 | 3300014969 | Bacteria | 724 |
| 239 | Ga0163161_10220614 | 3300017792 | Bacteria | 1468 |
| 240 | Ga0206354_10070906 | 3300020081 | Unclassified | 573 |
| 241 | Ga0207653_10052169 | 3300025885 | Bacteria | 1363 |
| 242 | Ga0207688_10059983 | 3300025901 | Bacteria | 2142 |
| 243 | Ga0207680_10105667 | 3300025903 | Bacteria | 1817 |
| 244 | Ga0207647_10059863 | 3300025904 | Bacteria | 2329 |
| 245 | Ga0207685_10664139 | 3300025905 | Bacteria | 565 |
| 246 | Ga0207645_10293008 | 3300025907 | Bacteria | 1082 |
| 247 | Ga0207705_10204831 | 3300025909 | Bacteria | 1495 |
| 248 | Ga0207684_10497909 | 3300025910 | Bacteria | 1045 |
| 249 | Ga0207654_10081144 | 3300025911 | Bacteria | 1952 |
| 250 | Ga0207707_10026505 | 3300025912 | Bacteria | 5066 |
| 251 | Ga0207707_10167329 | 3300025912 | Bacteria | 1921 |
| 252 | Ga0207707_10257706 | 3300025912 | Bacteria | 1514 |
| 253 | Ga0207707_10297165 | 3300025912 | Bacteria | 1397 |
| 254 | Ga0207707_10312794 | 3300025912 | Bacteria | 1357 |
| 255 | Ga0207707_10318361 | 3300025912 | Bacteria | 1343 |
| 256 | Ga0207695_10167542 | 3300025913 | Unclassified | 2124 |
| 257 | Ga0207695_10526180 | 3300025913 | Bacteria | 1064 |
| 258 | Ga0207695_10848468 | 3300025913 | Bacteria | 793 |
| 259 | Ga0207671_10496670 | 3300025914 | Bacteria | 973 |
| 260 | Ga0207693_10016657 | 3300025915 | Bacteria | 5872 |
| 261 | Ga0207663_10064670 | 3300025916 | Bacteria | 2335 |
| 262 | Ga0207660_10063690 | 3300025917 | Bacteria | 2659 |
| 263 | Ga0207660_10150073 | 3300025917 | Bacteria | 1790 |
| 264 | Ga0207660_10199241 | 3300025917 | Bacteria | 1563 |
| 265 | Ga0207660_10385177 | 3300025917 | Bacteria | 1127 |
| 266 | Ga0207660_10621581 | 3300025917 | Bacteria | 880 |
| 267 | Ga0207660_11383092 | 3300025917 | Bacteria | 570 |
| 268 | Ga0207662_10277031 | 3300025918 | Bacteria | 1109 |
| 269 | Ga0207657_10019263 | 3300025919 | Bacteria | 6485 |
| 270 | Ga0207657_10070172 | 3300025919 | Bacteria | 2970 |
| 271 | Ga0207657_10192513 | 3300025919 | Bacteria | 1644 |
| 272 | Ga0207649_10939050 | 3300025920 | Bacteria | 679 |
| 273 | Ga0207652_10181847 | 3300025921 | Bacteria | 1890 |
| 274 | Ga0207652_10206046 | 3300025921 | Bacteria | 1770 |
| 275 | Ga0207652_10214732 | 3300025921 | Bacteria | 1733 |
| 276 | Ga0207652_10376959 | 3300025921 | Bacteria | 1280 |
| 277 | Ga0207652_10666498 | 3300025921 | Bacteria | 930 |
| 278 | Ga0207652_11568289 | 3300025921 | Unclassified | 563 |
| 279 | Ga0207646_11054632 | 3300025922 | Bacteria | 717 |
| 280 | Ga0207681_10032490 | 3300025923 | Bacteria | 3417 |
| 281 | Ga0207694_11737218 | 3300025924 | Bacteria | 525 |
| 282 | Ga0207659_10380189 | 3300025926 | Unclassified | 1177 |
| 283 | Ga0207659_10691460 | 3300025926 | Bacteria | 873 |
| 284 | Ga0207687_10122144 | 3300025927 | Bacteria | 1949 |
| 285 | Ga0207687_10581368 | 3300025927 | Bacteria | 942 |
| 286 | Ga0207700_10046780 | 3300025928 | Bacteria | 3202 |
| 287 | Ga0207664_10266135 | 3300025929 | Bacteria | 1500 |
| 288 | Ga0207664_11292732 | 3300025929 | Bacteria | 649 |
| 289 | Ga0207690_10105670 | 3300025932 | Bacteria | 2019 |
| 290 | Ga0207690_10330310 | 3300025932 | Unclassified | 1201 |
| 291 | Ga0207706_10034222 | 3300025933 | Bacteria | 4520 |
| 292 | Ga0207706_10079135 | 3300025933 | Bacteria | 2891 |
| 293 | Ga0207706_10128113 | 3300025933 | Bacteria | 2232 |
| 294 | Ga0207706_10545189 | 3300025933 | Bacteria | 999 |
| 295 | Ga0207709_10063259 | 3300025935 | Bacteria | 2319 |
| 296 | Ga0207709_10692588 | 3300025935 | Bacteria | 815 |
| 297 | Ga0207670_10015675 | 3300025936 | Bacteria | 4534 |
| 298 | Ga0207669_10797829 | 3300025937 | Bacteria | 783 |
| 299 | Ga0207669_11734897 | 3300025937 | Unclassified | 533 |
| 300 | Ga0207665_10388782 | 3300025939 | Bacteria | 1060 |
| 301 | Ga0207711_10179951 | 3300025941 | Bacteria | 1922 |
| 302 | Ga0207711_10298219 | 3300025941 | Bacteria | 1486 |
| 303 | Ga0207689_10817001 | 3300025942 | Unclassified | 787 |
| 304 | Ga0207679_10098964 | 3300025945 | Bacteria | 2276 |
| 305 | Ga0207667_10154285 | 3300025949 | Bacteria | 2363 |
| 306 | Ga0207667_10395726 | 3300025949 | Bacteria | 1407 |
| 307 | Ga0207667_11613522 | 3300025949 | Unclassified | 617 |
| 308 | Ga0207640_10889405 | 3300025981 | Unclassified | 777 |
| 309 | Ga0207640_11652805 | 3300025981 | Bacteria | 578 |
| 310 | Ga0207658_10216638 | 3300025986 | Bacteria | 1608 |
| 311 | Ga0207677_10831027 | 3300026023 | Bacteria | 829 |
| 312 | Ga0207639_10163344 | 3300026041 | Bacteria | 1879 |
| 313 | Ga0207678_10132449 | 3300026067 | Bacteria | 2127 |
| 314 | Ga0207708_10640002 | 3300026075 | Bacteria | 904 |
| 315 | Ga0207702_12183638 | 3300026078 | Unclassified | 542 |
| 316 | Ga0207648_10058329 | 3300026089 | Bacteria | 3367 |
| 317 | Ga0207648_10191923 | 3300026089 | Bacteria | 1810 |
| 318 | Ga0207648_10917847 | 3300026089 | Bacteria | 818 |
| 319 | Ga0207676_11414042 | 3300026095 | Bacteria | 692 |
| 320 | Ga0207674_10392848 | 3300026116 | Bacteria | 1341 |
| 321 | Ga0207683_10029889 | 3300026121 | Bacteria | 4718 |
| 322 | Ga0207683_10211280 | 3300026121 | Bacteria | 1766 |
| 323 | Ga0207698_10509200 | 3300026142 | Bacteria | 1173 |
| 324 | Ga0207698_11007605 | 3300026142 | Bacteria | 844 |
| 325 | Ga0207698_11565583 | 3300026142 | Unclassified | 674 |
| 326 | Ga0209969_1008696 | 3300027360 | Bacteria | 1443 |
| 327 | Ga0210000_1005697 | 3300027462 | Bacteria | 1810 |
| 328 | Ga0209995_1040909 | 3300027471 | Bacteria | 782 |
| 329 | Ga0209968_1021237 | 3300027526 | Bacteria | 1053 |
| 330 | Ga0209982_1004183 | 3300027552 | Bacteria | 2064 |
| 331 | Ga0210002_1029513 | 3300027617 | Bacteria | 908 |
| 332 | Ga0209966_1001176 | 3300027695 | Bacteria | 4673 |
| 333 | Ga0209998_10009463 | 3300027717 | Bacteria | 2022 |
| 334 | Ga0209813_10001100 | 3300027866 | Bacteria | 6040 |
| 335 | Ga0207428_10000082 | 3300027907 | Bacteria | 133684 |
| 336 | Ga0207428_10001078 | 3300027907 | Bacteria | 29769 |
| 337 | Ga0207428_10111248 | 3300027907 | Bacteria | 2107 |
| 338 | Ga0207428_11039314 | 3300027907 | Bacteria | 574 |
| 339 | Ga0207428_11299269 | 3300027907 | Bacteria | 504 |
| 340 | Ga0265357_1014201 | 3300028023 | Bacteria | 834 |
| 341 | Ga0268265_10043339 | 3300028380 | Bacteria | 3344 |
| 342 | Ga0268265_10459476 | 3300028380 | Unclassified | 1191 |
| 343 | Ga0268264_10171746 | 3300028381 | Bacteria | 1961 |
| 344 | Ga0265319_1161900 | 3300028563 | Unclassified | 691 |
| 345 | Ga0265318_10241875 | 3300028577 | Unclassified | 658 |
| 346 | Ga0265338_10001437 | 3300028800 | Bacteria | 38679 |
| 347 | Ga0265338_10046571 | 3300028800 | Bacteria | 3973 |
| 348 | Ga0265338_10134835 | 3300028800 | Bacteria | 1943 |
| 349 | Ga0265338_10432325 | 3300028800 | Bacteria | 934 |
| 350 | Ga0265338_11213533 | 3300028800 | Unclassified | 506 |
| 351 | Ga0265328_10349672 | 3300031239 | Unclassified | 575 |
| 352 | Ga0265320_10049948 | 3300031240 | Bacteria | 2035 |
| 353 | Ga0265320_10195689 | 3300031240 | Bacteria | 903 |
| 354 | Ga0265325_10000141 | 3300031241 | Bacteria | 50291 |
| 355 | Ga0265325_10017307 | 3300031241 | Bacteria | 4008 |
| 356 | Ga0265325_10090524 | 3300031241 | Bacteria | 1509 |
| 357 | Ga0265325_10103557 | 3300031241 | Bacteria | 1390 |
| 358 | Ga0265340_10020501 | 3300031247 | Bacteria | 3397 |
| 359 | Ga0265340_10023384 | 3300031247 | Bacteria | 3152 |
| 360 | Ga0265339_10524528 | 3300031249 | Unclassified | 546 |
| 361 | Ga0265316_10150044 | 3300031344 | Bacteria | 1746 |
| 362 | Ga0265316_10756025 | 3300031344 | Unclassified | 683 |
| 363 | Ga0265316_10789014 | 3300031344 | Bacteria | 666 |
| 364 | Ga0265313_10001334 | 3300031595 | Bacteria | 23230 |
| 365 | Ga0265313_10006684 | 3300031595 | Bacteria | 8083 |
| 366 | Ga0265313_10146316 | 3300031595 | Bacteria | 1013 |
| 367 | Ga0265314_10020005 | 3300031711 | Bacteria | 5175 |
| 368 | Ga0265342_10000841 | 3300031712 | Bacteria | 30728 |
| 369 | Ga0373930_0000071 | 3300034816 | Bacteria | 9894 |
| 370 | Ga0373948_0050210 | 3300034817 | Bacteria | 894 |
| 371 | Ga0373958_0000121 | 3300034819 | Bacteria | 8561 |
| 372 | Ga0373958_0035341 | 3300034819 | Bacteria | 1000 |
| 373 | Ga0373959_0001747 | 3300034820 | Bacteria | 3470 |
| 374 | Ga0373938_0000045 | 3300034957 | Bacteria | 16308 |
| 375 | Ga0373926_0195144 | 3300035083 | Bacteria | 778 |
| 376 | Ga0373928_0002038 | 3300035084 | Bacteria | 3935 |
| 377 | Ga0373934_0013386 | 3300035086 | Bacteria | 3103 |
| 378 | Ga0373934_0063393 | 3300035086 | Bacteria | 1474 |
| 379 | Ga0373940_0001266 | 3300035088 | Bacteria | 4492 |
| 380 | Ga0373940_0245464 | 3300035088 | Bacteria | 602 |
| 381 | Ga0373944_0012601 | 3300035089 | Bacteria | 2333 |
| 382 | Ga0373949_0002879 | 3300035090 | Bacteria | 4250 |
| 383 | Ga0373951_0003036 | 3300035091 | Bacteria | 4156 |
| 384 | Ga0373952_0000221 | 3300035092 | Bacteria | 9091 |
| 385 | Ga0373923_0018198 | 3300035111 | Bacteria | 2700 |
| 386 | Ga0373923_0049783 | 3300035111 | Bacteria | 1753 |
| 387 | Ga0373923_0207939 | 3300035111 | Bacteria | 906 |
| 388 | Ga0373932_0001518 | 3300035112 | Bacteria | 6450 |
| 389 | Ga0373932_0014657 | 3300035112 | Bacteria | 1975 |
| 390 | Ga0373936_0353974 | 3300035113 | Bacteria | 669 |
| 391 | Ga0373939_0000875 | 3300035114 | Bacteria | 7460 |
| 392 | Ga0373939_0152634 | 3300035114 | Bacteria | 842 |
| 393 | Ga0373941_0013562 | 3300035115 | Bacteria | 2157 |
| 394 | Ga0373945_0020170 | 3300035116 | Bacteria | 2279 |
| 395 | Ga0373945_0197457 | 3300035116 | Bacteria | 834 |
| 396 | Ga0373945_0358777 | 3300035116 | Bacteria | 633 |
| 397 | Ga0373953_0004191 | 3300035117 | Bacteria | 4576 |
| 398 | Ga0373953_0073934 | 3300035117 | Bacteria | 1409 |
| 399 | Ga0373953_0410792 | 3300035117 | Bacteria | 596 |
| 400 | Ga0373954_0010833 | 3300035118 | Bacteria | 4031 |
| 401 | Ga0373954_0015085 | 3300035118 | Bacteria | 3452 |
| 402 | Ga0373954_0025923 | 3300035118 | Bacteria | 2684 |
| 403 | Ga0373954_0617224 | 3300035118 | Bacteria | 537 |
| 404 | Ga0373956_0004403 | 3300035119 | Bacteria | 5639 |
| 405 | Ga0373957_0003558 | 3300035120 | Bacteria | 4625 |
| 406 | Ga0373957_0044793 | 3300035120 | Bacteria | 1675 |
| 407 | Ga0373957_0044859 | 3300035120 | Bacteria | 1674 |
| 408 | Ga0373960_0000083 | 3300035121 | Bacteria | 14021 |
| 409 | Ga0373943_0269864 | 3300035170 | Bacteria | 959 |
| 410 | Ga0373946_0011149 | 3300035171 | Bacteria | 3346 |
| 411 | Ga0373946_0047447 | 3300035171 | Bacteria | 1784 |
| 412 | Ga0373955_0000946 | 3300035172 | Bacteria | 12419 |
| 413 | Ga0373955_0003642 | 3300035172 | Bacteria | 6781 |
| 414 | Ga0373955_0233632 | 3300035172 | Bacteria | 1100 |
| 415 | Ga0373955_0713886 | 3300035172 | Bacteria | 615 |
| 416 | Ga0373942_0000535 | 3300035207 | Bacteria | 10652 |
| 417 | Ga0373961_0001186 | 3300035241 | Bacteria | 8073 |
| 418 | Ga0373962_0002152 | 3300035242 | Bacteria | 4701 |
| 419 | Ga0373962_0165427 | 3300035242 | Unclassified | 732 |
| 420 | Ga0373924_0015278 | 3300035410 | Bacteria | 2917 |
| 421 | Ga0373924_0041803 | 3300035410 | Bacteria | 1879 |
| 422 | Ga0373924_0043968 | 3300035410 | Bacteria | 1835 |
| 423 | Ga0373931_0007820 | 3300035691 | Bacteria | 5052 |
| 424 | Ga0373931_0120639 | 3300035691 | Bacteria | 1498 |
| 425 | Ga0373935_0026703 | 3300035692 | Bacteria | 3566 |
| 426 | Ga0373935_1360989 | 3300035692 | Unclassified | 530 |
| 427 | Ga0373927_0024375 | 3300035695 | Bacteria | 3958 |
| 428 | Ga0373933_0002265 | 3300035724 | Bacteria | 10966 |
| 429 | Ga0373933_0037972 | 3300035724 | Bacteria | 2828 |
| 430 | Ga0373933_0047863 | 3300035724 | Bacteria | 2544 |
| 431 | Ga0373933_0063519 | 3300035724 | Bacteria | 2232 |
| 432 | Ga0373933_0620621 | 3300035724 | Bacteria | 710 |
| 433 | Ga0373947_0018586 | 3300035725 | Bacteria | 4003 |
| 434 | Ga0373947_0705139 | 3300035725 | Bacteria | 689 |
| 435 | Ga0373937_0000879 | 3300036401 | Bacteria | 25733 |
| 436 | Ga0373937_0003184 | 3300036401 | Bacteria | 13739 |
| 437 | Ga0373937_0004474 | 3300036401 | Bacteria | 11870 |
| 438 | Ga0373937_0114369 | 3300036401 | Bacteria | 2512 |
| 439 | Ga0373937_0194500 | 3300036401 | Bacteria | 1906 |
| 440 | Ga0373937_0284914 | 3300036401 | Unclassified | 1561 |
| 441 | Ga0373937_0402609 | 3300036401 | Bacteria | 1299 |
| 442 | Ga0373925_0028815 | 3300037068 | Bacteria | 4071 |
| 443 | Ga0373925_0725138 | 3300037068 | Bacteria | 819 |
| 444 | Ga0395900_0614785 | 3300037418 | Bacteria | 1026 |
| 445 | Ga0395901_0255746 | 3300038443 | Bacteria | 1824 |
| 446 | Ga0395901_1907938 | 3300038443 | Bacteria | 541 |
| 447 | Ga0436365_1381709 | 3300039437 | Bacteria | 630 |
| 448 | Ga0439450_146676 | 3300042008 | Bacteria | 617 |
| 449 | Ga0439455_0074871 | 3300042012 | Bacteria | 914 |
| 450 | Ga0439434_0096394 | 3300042435 | Bacteria | 950 |
| 451 | Ga0439464_0020384 | 3300042439 | Bacteria | 1816 |
| 452 | Ga0439460_0038275 | 3300042461 | Bacteria | 1398 |
| 453 | Ga0450893_0108521 | 3300042532 | Bacteria | 571 |
| 454 | Ga0451577_0166584 | 3300042876 | Bacteria | 1985 |
| 455 | Ga0439440_0139293 | 3300042993 | Bacteria | 688 |
| 456 | Ga0453683_1216594 | 3300044673 | Bacteria | 505 |
| 457 | Ga0466963_0903170 | 3300044694 | Bacteria | 622 |
| 458 | Ga0453684_1704701 | 3300044712 | Unclassified | 644 |
| 459 | Ga0453684_2383803 | 3300044712 | Unclassified | 524 |
| 460 | Ga0466971_0286728 | 3300044719 | Bacteria | 789 |
| 461 | Ga0466959_0249028 | 3300045049 | Bacteria | 1226 |
| 462 | Ga0451576_0004698 | 3300045051 | Bacteria | 17570 |
| 463 | Ga0495592_0050743 | 3300046454 | Bacteria | 3082 |
| 464 | Ga0495592_0102143 | 3300046454 | Bacteria | 2042 |
| 465 | Ga0495592_0200286 | 3300046454 | Bacteria | 1348 |
| 466 | Ga0495603_0059610 | 3300046455 | Bacteria | 2256 |
| 467 | Ga0495629_0414830 | 3300046459 | Bacteria | 914 |
| 468 | Ga0495651_0000895 | 3300046462 | Bacteria | 23161 |
| 469 | Ga0495651_0021886 | 3300046462 | Bacteria | 4971 |
| 470 | Ga0495651_0076768 | 3300046462 | Bacteria | 2530 |
| 471 | Ga0495653_0004420 | 3300046463 | Bacteria | 11365 |
| 472 | Ga0495653_0089450 | 3300046463 | Bacteria | 2256 |
| 473 | Ga0495653_0244568 | 3300046463 | Bacteria | 1194 |
| 474 | Ga0495653_0444551 | 3300046463 | Bacteria | 816 |
| 475 | Ga0495580_0670585 | 3300046472 | Bacteria | 681 |
| 476 | Ga0495582_0395005 | 3300046473 | Bacteria | 797 |
| 477 | Ga0495639_0135258 | 3300046475 | Bacteria | 1182 |
| 478 | Ga0495664_0006433 | 3300046477 | Bacteria | 6488 |
| 479 | Ga0495664_0045094 | 3300046477 | Bacteria | 2614 |
| 480 | Ga0495664_0757598 | 3300046477 | Bacteria | 572 |
| 481 | Ga0495594_0744423 | 3300046499 | Unclassified | 553 |
| 482 | Ga0495608_0000129 | 3300046511 | Bacteria | 53862 |
| 483 | Ga0495608_0073810 | 3300046511 | Bacteria | 2224 |
| 484 | Ga0495608_0227804 | 3300046511 | Bacteria | 1168 |
| 485 | Ga0495608_0376970 | 3300046511 | Bacteria | 870 |
| 486 | Ga0495618_0003211 | 3300046514 | Bacteria | 10242 |
| 487 | Ga0495618_0040562 | 3300046514 | Bacteria | 2930 |
| 488 | Ga0495618_0074607 | 3300046514 | Bacteria | 2160 |
| 489 | Ga0495618_0477057 | 3300046514 | Bacteria | 754 |
| 490 | Ga0495628_0004609 | 3300046516 | Bacteria | 12184 |
| 491 | Ga0495628_0636356 | 3300046516 | Bacteria | 758 |
| 492 | Ga0495630_0331755 | 3300046517 | Bacteria | 1163 |
| 493 | Ga0495630_1032043 | 3300046517 | Bacteria | 624 |
| 494 | Ga0495666_0177263 | 3300046526 | Bacteria | 985 |
| 495 | Ga0495652_0035109 | 3300046529 | Bacteria | 4365 |
| 496 | Ga0495652_0135100 | 3300046529 | Bacteria | 1947 |
| 497 | Ga0495652_0178454 | 3300046529 | Bacteria | 1632 |
| 498 | Ga0495652_0590805 | 3300046529 | Bacteria | 758 |
| 499 | Ga0495665_0214700 | 3300046531 | Bacteria | 995 |
| 500 | Ga0495640_0007245 | 3300046533 | Bacteria | 8736 |
| 501 | Ga0495586_0115804 | 3300046535 | Bacteria | 1494 |
| 502 | Ga0495587_0001060 | 3300046536 | Bacteria | 18094 |
| 503 | Ga0495587_0002945 | 3300046536 | Bacteria | 11379 |
| 504 | Ga0495587_0096875 | 3300046536 | Bacteria | 1701 |
| 505 | Ga0495645_0000974 | 3300046543 | Bacteria | 19495 |
| 506 | Ga0495645_0008141 | 3300046543 | Bacteria | 7311 |
| 507 | Ga0495622_0153753 | 3300046557 | Bacteria | 1040 |
| 508 | Ga0495667_0006860 | 3300046559 | Bacteria | 7731 |
| 509 | Ga0495667_0007026 | 3300046559 | Bacteria | 7639 |
| 510 | Ga0495667_0016191 | 3300046559 | Bacteria | 5037 |
| 511 | Ga0495667_0534087 | 3300046559 | Bacteria | 733 |
| 512 | Ga0495667_0663597 | 3300046559 | Bacteria | 647 |
| 513 | Ga0495656_0074087 | 3300046615 | Bacteria | 1520 |
| 514 | Ga0495634_0017126 | 3300046642 | Bacteria | 5175 |
| 515 | Ga0495634_0272628 | 3300046642 | Bacteria | 1029 |
| 516 | Ga0495635_0033965 | 3300046663 | Bacteria | 3538 |
| 517 | Ga0495635_0100594 | 3300046663 | Bacteria | 1976 |
| 518 | Ga0495635_0124575 | 3300046663 | Bacteria | 1757 |
| 519 | Ga0495657_0001374 | 3300046675 | Bacteria | 21110 |
| 520 | Ga0495657_0047782 | 3300046675 | Bacteria | 2891 |
| 521 | Ga0495657_0077155 | 3300046675 | Bacteria | 2162 |
| 522 | Ga0495657_0309315 | 3300046675 | Bacteria | 941 |
| 523 | Ga0495599_0000294 | 3300046678 | Bacteria | 30376 |
| 524 | Ga0495599_0002371 | 3300046678 | Bacteria | 10951 |
| 525 | Ga0495599_0409494 | 3300046678 | Bacteria | 807 |
| 526 | Ga0495623_0001158 | 3300046679 | Bacteria | 17853 |
| 527 | Ga0495646_0037980 | 3300046680 | Bacteria | 2975 |
| 528 | Ga0495646_0071382 | 3300046680 | Bacteria | 2043 |
| 529 | Ga0495647_0299561 | 3300046681 | Bacteria | 724 |
| 530 | Ga0495624_0111631 | 3300046690 | Bacteria | 1680 |
| 531 | Ga0495600_0000977 | 3300046809 | Bacteria | 15417 |
| 532 | Ga0495600_0008473 | 3300046809 | Bacteria | 6318 |
| 533 | Ga0495600_0030521 | 3300046809 | Bacteria | 3492 |
| 534 | Ga0495600_0105691 | 3300046809 | Bacteria | 1834 |
| 535 | Ga0495581_0421366 | 3300047315 | Bacteria | 778 |
| 536 | Ga0495604_0001139 | 3300047317 | Bacteria | 22028 |
| 537 | Ga0495604_0008733 | 3300047317 | Bacteria | 8009 |
| 538 | Ga0495604_0016220 | 3300047317 | Bacteria | 5952 |
| 539 | Ga0495604_0162429 | 3300047317 | Bacteria | 1577 |
| 540 | Ga0495636_0206031 | 3300047318 | Unclassified | 899 |
| 541 | Ga0495674_0010157 | 3300047319 | Bacteria | 8918 |
| 542 | Ga0495674_0062334 | 3300047319 | Bacteria | 3247 |
| 543 | Ga0495676_0150290 | 3300047321 | Bacteria | 1658 |
| 544 | Ga0495680_0003174 | 3300047322 | Bacteria | 16366 |
| 545 | Ga0495680_0003711 | 3300047322 | Bacteria | 14906 |
| 546 | Ga0495680_0065679 | 3300047322 | Bacteria | 2778 |
| 547 | Ga0495680_0388539 | 3300047322 | Bacteria | 965 |
| 548 | Ga0495680_0789980 | 3300047322 | Bacteria | 621 |
| 549 | Ga0495675_0000190 | 3300047444 | Bacteria | 44968 |
| 550 | Ga0495684_0082590 | 3300047471 | Bacteria | 2437 |
| 551 | Ga0495593_0019723 | 3300047673 | Bacteria | 3779 |
| 552 | Ga0495593_0455347 | 3300047673 | Bacteria | 640 |
| 553 | Ga0495602_0013848 | 3300048088 | Bacteria | 8223 |
| 554 | Ga0495602_0018144 | 3300048088 | Bacteria | 7038 |
| 555 | Ga0495602_0082549 | 3300048088 | Bacteria | 2697 |
| 556 | Ga0495614_0089099 | 3300048089 | Bacteria | 1341 |
| 557 | Ga0496101_0422672 | 3300048904 | Bacteria | 1050 |
| 558 | Ga0496102_0045426 | 3300048905 | Bacteria | 3988 |
| 559 | Ga0496102_0071286 | 3300048905 | Bacteria | 3190 |
| 560 | Ga0496102_0083438 | 3300048905 | Unclassified | 2949 |
| 561 | Ga0496102_0102034 | 3300048905 | Bacteria | 2666 |
| 562 | Ga0496104_0035483 | 3300048907 | Bacteria | 4655 |
| 563 | Ga0496104_0268074 | 3300048907 | Bacteria | 1620 |
| 564 | Ga0496105_0888766 | 3300048908 | Unclassified | 672 |
| 565 | Ga0496106_0024535 | 3300048909 | Bacteria | 4483 |
| 566 | Ga0496106_0148887 | 3300048909 | Bacteria | 1845 |
| 567 | Ga0496106_0182027 | 3300048909 | Bacteria | 1668 |
| 568 | Ga0496107_0053534 | 3300048910 | Bacteria | 2911 |
| 569 | Ga0496107_0190043 | 3300048910 | Bacteria | 1525 |
| 570 | Ga0496107_1066766 | 3300048910 | Bacteria | 584 |
| 571 | Ga0496108_0006074 | 3300048911 | Bacteria | 9765 |
| 572 | Ga0496108_0131099 | 3300048911 | Bacteria | 2155 |
| 573 | Ga0496109_0520694 | 3300048912 | Bacteria | 1122 |
| 574 | Ga0496109_0605302 | 3300048912 | Bacteria | 1032 |
| 575 | Ga0496112_0251754 | 3300048915 | Bacteria | 1717 |
| 576 | Ga0496114_0097585 | 3300048917 | Bacteria | 2503 |
| 577 | Ga0496115_0053154 | 3300048918 | Bacteria | 3250 |
| 578 | Ga0496115_0073203 | 3300048918 | Bacteria | 2780 |
| 579 | Ga0496115_0891135 | 3300048918 | Bacteria | 686 |
| 580 | Ga0496115_1167739 | 3300048918 | Bacteria | 580 |
| 581 | Ga0501033_0027386 | 3300049570 | Bacteria | 4285 |
| 582 | Ga0501034_0825168 | 3300049571 | Bacteria | 819 |
| 583 | Ga0501042_0771290 | 3300049578 | Bacteria | 700 |
| 584 | Ga0501043_0281876 | 3300049579 | Bacteria | 1274 |
| 585 | Ga0501046_0667829 | 3300049580 | Bacteria | 734 |
| 586 | Ga0501047_0836096 | 3300049581 | Bacteria | 735 |
| 587 | Ga0501047_0843243 | 3300049581 | Bacteria | 730 |
| 588 | Ga0501067_0078070 | 3300049583 | Bacteria | 1835 |
| 589 | Ga0501069_0218477 | 3300049585 | Bacteria | 1107 |
| 590 | Ga0501070_0643167 | 3300049586 | Bacteria | 843 |
| 591 | Ga0501071_0831095 | 3300049587 | Unclassified | 712 |
| 592 | Ga0501072_0303289 | 3300049588 | Bacteria | 1270 |
| 593 | Ga0501072_0642037 | 3300049588 | Bacteria | 836 |
| 594 | Ga0501072_1010998 | 3300049588 | Bacteria | 648 |
| 595 | Ga0501074_0542558 | 3300049590 | Bacteria | 823 |
| 596 | Ga0501074_0630285 | 3300049590 | Bacteria | 758 |
| 597 | Ga0501075_0256278 | 3300049591 | Bacteria | 1333 |
| 598 | Ga0501075_0300855 | 3300049591 | Bacteria | 1222 |
| 599 | Ga0501075_0457257 | 3300049591 | Bacteria | 974 |
| 600 | Ga0501076_0067231 | 3300049592 | Bacteria | 2862 |
| 601 | Ga0501076_0075333 | 3300049592 | Bacteria | 2705 |
| 602 | Ga0501077_0032711 | 3300049593 | Bacteria | 3311 |
| 603 | Ga0501077_0371641 | 3300049593 | Bacteria | 913 |
| 604 | Ga0501080_1762953 | 3300049742 | Bacteria | 521 |
| 605 | Ga0501081_0338446 | 3300049743 | Bacteria | 1108 |
| 606 | Ga0501081_0957722 | 3300049743 | Unclassified | 646 |
| 607 | Ga0501035_0320173 | 3300049822 | Bacteria | 1303 |
| 608 | Ga0501044_0125510 | 3300049823 | Bacteria | 2564 |
| 609 | Ga0501044_1361288 | 3300049823 | Bacteria | 576 |
| 610 | nmdc:mga03683_5582_c1 | 3300050489 | Bacteria | 4256 |
| 611 | nmdc:mga0k408_63606_c1 | 3300050493 | Bacteria | 2147 |
| 612 | nmdc:mga0k408_900996_c1 | 3300050493 | Bacteria | 513 |
| 613 | nmdc:mga06z11_719979_c1 | 3300050494 | Unclassified | 608 |
| 614 | nmdc:mga05p37_19_c2 | 3300050507 | Bacteria | 99994 |
| 615 | nmdc:mga05p37_50650_c1 | 3300050507 | Bacteria | 5108 |
| 616 | nmdc:mga05p37_998628_c1 | 3300050507 | Bacteria | 889 |
| 617 | nmdc:mga09592_39279_c1 | 3300050508 | Bacteria | 3975 |
| 618 | nmdc:mga0qj67_259_c1 | 3300050509 | Bacteria | 36242 |
| 619 | nmdc:mga06r32_1799963_c1 | 3300050510 | Unclassified | 548 |
| 620 | nmdc:mga06r32_2023_c1 | 3300050510 | Bacteria | 18128 |
| 621 | nmdc:mga08y16_103927_c1 | 3300050511 | Bacteria | 2957 |
| 622 | nmdc:mga08y16_202415_c1 | 3300050511 | Bacteria | 2057 |
| 623 | nmdc:mga08y16_2548_c1 | 3300050511 | Bacteria | 18740 |
| 624 | nmdc:mga08y16_79772_c1 | 3300050511 | Bacteria | 3412 |
| 625 | nmdc:mga0n895_1651_c1 | 3300050512 | Bacteria | 16871 |
| 626 | nmdc:mga0n895_394_c1 | 3300050512 | Bacteria | 29311 |
| 627 | nmdc:mga0n895_45970_c1 | 3300050512 | Bacteria | 4263 |
| 628 | nmdc:mga0rr50_154751_c1 | 3300050513 | Bacteria | 1856 |
| 629 | nmdc:mga0rr50_18314_c1 | 3300050513 | Bacteria | 4701 |
| 630 | nmdc:mga0rr50_785_c1 | 3300050513 | Bacteria | 17098 |
| 631 | nmdc:mga0rr50_826474_c1 | 3300050513 | Bacteria | 790 |
| 632 | nmdc:mga0rr50_999589_c1 | 3300050513 | Bacteria | 713 |
| 633 | nmdc:mga08x19_620079_c1 | 3300050514 | Bacteria | 767 |
| 634 | nmdc:mga08x19_78302_c1 | 3300050514 | Bacteria | 2166 |
| 635 | nmdc:mga0a205_10038_c1 | 3300050515 | Bacteria | 8688 |
| 636 | nmdc:mga0a205_1167_c2 | 3300050515 | Bacteria | 15903 |
| 637 | nmdc:mga0a205_161153_c1 | 3300050515 | Bacteria | 2140 |
| 638 | nmdc:mga0a205_249_c1 | 3300050515 | Bacteria | 38472 |
| 639 | nmdc:mga0a205_906623_c1 | 3300050515 | Bacteria | 728 |
| 640 | nmdc:mga0a205_934122_c1 | 3300050515 | Unclassified | 714 |
| 641 | Ga0495601_0000711 | 3300053077 | Bacteria | 17861 |
| 642 | Ga0495601_0001346 | 3300053077 | Bacteria | 13508 |
| 643 | Ga0495601_0002495 | 3300053077 | Bacteria | 10465 |
| 644 | Ga0495601_0006979 | 3300053077 | Bacteria | 6614 |
| 645 | Ga0495601_0051130 | 3300053077 | Bacteria | 2608 |
| 646 | Ga0495601_0525352 | 3300053077 | Bacteria | 762 |
| 647 | Ga0495612_0000089 | 3300053078 | Bacteria | 40250 |
| 648 | Ga0495612_0001553 | 3300053078 | Bacteria | 9464 |
| 649 | Ga0495612_0017287 | 3300053078 | Bacteria | 2889 |
| 650 | Ga0495612_0057435 | 3300053078 | Bacteria | 1607 |
| 651 | Ga0495595_0000305 | 3300053084 | Bacteria | 19108 |
| 652 | Ga0495595_0000952 | 3300053084 | Bacteria | 11135 |
| 653 | Ga0495595_0005742 | 3300053084 | Bacteria | 5027 |
| 654 | Ga0495595_0022830 | 3300053084 | Bacteria | 2749 |
| 655 | Ga0495595_0422407 | 3300053084 | Bacteria | 676 |
| 656 | Ga0495619_0000052 | 3300053085 | Bacteria | 98882 |
| 657 | Ga0495619_0001206 | 3300053085 | Bacteria | 16974 |
| 658 | Ga0495619_0035410 | 3300053085 | Bacteria | 3246 |
| 659 | Ga0495619_0257819 | 3300053085 | Bacteria | 1208 |
| 660 | Ga0495619_0282046 | 3300053085 | Bacteria | 1151 |
| 661 | Ga0500566_0244864 | 3300053094 | Bacteria | 876 |
| 662 | Ga0500608_276236 | 3300053122 | Bacteria | 639 |
| 663 | Ga0500568_0052530 | 3300053139 | Bacteria | 1600 |
| 664 | Ga0500616_0123737 | 3300053153 | Bacteria | 1231 |
| 665 | Ga0500636_0385303 | 3300053177 | Bacteria | 656 |
| 666 | Ga0501084_0076099 | 3300054114 | Bacteria | 2813 |
| 667 | Ga0501084_0232878 | 3300054114 | Bacteria | 1555 |
| 668 | Ga0501084_0711915 | 3300054114 | Bacteria | 847 |
| 669 | Ga0501082_0170506 | 3300060353 | Bacteria | 1892 |
| 670 | Ga0501082_0351037 | 3300060353 | Bacteria | 1286 |
| 671 | Ga0530510_0545615 | 3300061734 | Bacteria | 880 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300010375 | Ga0105239_13359783 | Ga0105239_133597831 | 83 |
| 2 | 3300035086 | Ga0373934_0063393 | Ga0373934_0063393_246_659 | 83 |
| 3 | 3300035116 | Ga0373945_0197457 | Ga0373945_0197457_172_585 | 83 |
| 4 | 3300035117 | Ga0373953_0004191 | Ga0373953_0004191_1640_2053 | 83 |
| 5 | 3300035118 | Ga0373954_0015085 | Ga0373954_0015085_778_1191 | 83 |
| 6 | 3300035120 | Ga0373957_0044793 | Ga0373957_0044793_86_499 | 83 |
| 7 | 3300035171 | Ga0373946_0047447 | Ga0373946_0047447_196_609 | 83 |
| 8 | 3300035172 | Ga0373955_0000946 | Ga0373955_0000946_2288_2701 | 83 |
| 9 | 3300035410 | Ga0373924_0041803 | Ga0373924_0041803_255_668 | 83 |
| 10 | 3300035695 | Ga0373927_0024375 | Ga0373927_0024375_187_600 | 83 |
| 11 | 3300035724 | Ga0373933_0047863 | Ga0373933_0047863_1350_1763 | 83 |
| 12 | 3300035725 | Ga0373947_0018586 | Ga0373947_0018586_3090_3503 | 83 |
| 13 | 3300036401 | Ga0373937_0003184 | Ga0373937_0003184_11532_11945 | 83 |
| 14 | 3300037068 | Ga0373925_0028815 | Ga0373925_0028815_1262_1675 | 83 |
| 15 | 3300046454 | Ga0495592_0050743 | Ga0495592_0050743_2267_2680 | 83 |
| 16 | 3300046462 | Ga0495651_0021886 | Ga0495651_0021886_762_1175 | 83 |
| 17 | 3300046463 | Ga0495653_0089450 | Ga0495653_0089450_1535_1948 | 83 |
| 18 | 3300046514 | Ga0495618_0477057 | Ga0495618_0477057_208_621 | 83 |
| 19 | 3300046516 | Ga0495628_0004609 | Ga0495628_0004609_9276_9689 | 83 |
| 20 | 3300046529 | Ga0495652_0035109 | Ga0495652_0035109_1535_1948 | 83 |
| 21 | 3300046536 | Ga0495587_0002945 | Ga0495587_0002945_4943_5356 | 83 |
| 22 | 3300046543 | Ga0495645_0000974 | Ga0495645_0000974_5638_6051 | 83 |
| 23 | 3300046559 | Ga0495667_0016191 | Ga0495667_0016191_2129_2542 | 83 |
| 24 | 3300046675 | Ga0495657_0047782 | Ga0495657_0047782_1641_2054 | 83 |
| 25 | 3300046678 | Ga0495599_0002371 | Ga0495599_0002371_2383_2796 | 83 |
| 26 | 3300046680 | Ga0495646_0071382 | Ga0495646_0071382_1499_1912 | 83 |
| 27 | 3300046809 | Ga0495600_0008473 | Ga0495600_0008473_5132_5545 | 83 |
| 28 | 3300047317 | Ga0495604_0016220 | Ga0495604_0016220_549_962 | 83 |
| 29 | 3300047322 | Ga0495680_0065679 | Ga0495680_0065679_438_851 | 83 |
| 30 | 3300048088 | Ga0495602_0013848 | Ga0495602_0013848_2980_3393 | 83 |
| 31 | 3300053077 | Ga0495601_0000711 | Ga0495601_0000711_4469_4882 | 83 |
| 32 | 3300053078 | Ga0495612_0000089 | Ga0495612_0000089_37675_38088 | 83 |
| 33 | 3300053084 | Ga0495595_0000952 | Ga0495595_0000952_5935_6348 | 83 |
| 34 | 3300012498 | Ga0157345_1002502 | Ga0157345_10025022 | 97 |
| 35 | 3300005340 | Ga0070689_100132230 | Ga0070689_1001322302 | 99 |
| 36 | 3300005434 | Ga0070709_10855111 | Ga0070709_108551111 | 99 |
| 37 | 3300005438 | Ga0070701_10376353 | Ga0070701_103763532 | 99 |
| 38 | 3300005467 | Ga0070706_100475797 | Ga0070706_1004757972 | 99 |
| 39 | 3300005617 | Ga0068859_101302103 | Ga0068859_1013021032 | 99 |
| 40 | 3300006871 | Ga0075434_100027835 | Ga0075434_1000278355 | 99 |
| 41 | 3300006931 | Ga0097620_101302282 | Ga0097620_1013022822 | 99 |
| 42 | 3300007076 | Ga0075435_101072839 | Ga0075435_1010728392 | 99 |
| 43 | 3300025910 | Ga0207684_10497909 | Ga0207684_104979092 | 99 |
| 44 | 3300025917 | Ga0207660_11383092 | Ga0207660_113830921 | 99 |
| 45 | 3300036401 | Ga0373937_0284914 | Ga0373937_0284914_1173_1478 | 99 |
| 46 | 3300050513 | nmdc:mga0rr50_154751_c1 | nmdc:mga0rr50_154751_c1_1392_1697 | 99 |
| 47 | 3300005336 | Ga0070680_100363287 | Ga0070680_1003632871 | 100 |
| 48 | 3300005336 | Ga0070680_100498496 | Ga0070680_1004984961 | 100 |
| 49 | 3300005339 | Ga0070660_100130906 | Ga0070660_1001309063 | 100 |
| 50 | 3300005339 | Ga0070660_100240451 | Ga0070660_1002404512 | 100 |
| 51 | 3300005344 | Ga0070661_100859956 | Ga0070661_1008599561 | 100 |
| 52 | 3300005435 | Ga0070714_101009288 | Ga0070714_1010092882 | 100 |
| 53 | 3300005458 | Ga0070681_10012985 | Ga0070681_100129851 | 100 |
| 54 | 3300005530 | Ga0070679_100376970 | Ga0070679_1003769702 | 100 |
| 55 | 3300005530 | Ga0070679_100720363 | Ga0070679_1007203632 | 100 |
| 56 | 3300005548 | Ga0070665_101152896 | Ga0070665_1011528961 | 100 |
| 57 | 3300005563 | Ga0068855_100613714 | Ga0068855_1006137142 | 100 |
| 58 | 3300005578 | Ga0068854_100684475 | Ga0068854_1006844752 | 100 |
| 59 | 3300005614 | Ga0068856_101156346 | Ga0068856_1011563462 | 100 |
| 60 | 3300005616 | Ga0068852_100494026 | Ga0068852_1004940262 | 100 |
| 61 | 3300005616 | Ga0068852_100498989 | Ga0068852_1004989892 | 100 |
| 62 | 3300006847 | Ga0075431_102131501 | Ga0075431_1021315011 | 100 |
| 63 | 3300006852 | Ga0075433_10086034 | Ga0075433_100860344 | 100 |
| 64 | 3300006871 | Ga0075434_100072274 | Ga0075434_1000722744 | 100 |
| 65 | 3300007076 | Ga0075435_100049803 | Ga0075435_1000498034 | 100 |
| 66 | 3300009093 | Ga0105240_10028987 | Ga0105240_1002898711 | 100 |
| 67 | 3300009094 | Ga0111539_10077351 | Ga0111539_100773511 | 100 |
| 68 | 3300009147 | Ga0114129_10654038 | Ga0114129_106540382 | 100 |
| 69 | 3300013100 | Ga0157373_10776649 | Ga0157373_107766492 | 100 |
| 70 | 3300013102 | Ga0157371_10124619 | Ga0157371_101246193 | 100 |
| 71 | 3300013102 | Ga0157371_10500097 | Ga0157371_105000972 | 100 |
| 72 | 3300013104 | Ga0157370_10151577 | Ga0157370_101515771 | 100 |
| 73 | 3300013105 | Ga0157369_10355943 | Ga0157369_103559432 | 100 |
| 74 | 3300013105 | Ga0157369_10575740 | Ga0157369_105757402 | 100 |
| 75 | 3300013105 | Ga0157369_11240425 | Ga0157369_112404252 | 100 |
| 76 | 3300020081 | Ga0206354_10070906 | Ga0206354_100709061 | 100 |
| 77 | 3300025909 | Ga0207705_10204831 | Ga0207705_102048312 | 100 |
| 78 | 3300025912 | Ga0207707_10167329 | Ga0207707_101673291 | 100 |
| 79 | 3300025912 | Ga0207707_10318361 | Ga0207707_103183612 | 100 |
| 80 | 3300025913 | Ga0207695_10526180 | Ga0207695_105261802 | 100 |
| 81 | 3300025917 | Ga0207660_10199241 | Ga0207660_101992412 | 100 |
| 82 | 3300025917 | Ga0207660_10621581 | Ga0207660_106215812 | 100 |
| 83 | 3300025919 | Ga0207657_10070172 | Ga0207657_100701722 | 100 |
| 84 | 3300025920 | Ga0207649_10939050 | Ga0207649_109390502 | 100 |
| 85 | 3300025921 | Ga0207652_10181847 | Ga0207652_101818472 | 100 |
| 86 | 3300025921 | Ga0207652_10206046 | Ga0207652_102060463 | 100 |
| 87 | 3300025929 | Ga0207664_11292732 | Ga0207664_112927321 | 100 |
| 88 | 3300025949 | Ga0207667_10154285 | Ga0207667_101542852 | 100 |
| 89 | 3300025949 | Ga0207667_11613522 | Ga0207667_116135221 | 100 |
| 90 | 3300025981 | Ga0207640_10889405 | Ga0207640_108894051 | 100 |
| 91 | 3300026142 | Ga0207698_10509200 | Ga0207698_105092002 | 100 |
| 92 | 3300026142 | Ga0207698_11565583 | Ga0207698_115655832 | 100 |
| 93 | 3300027360 | Ga0209969_1008696 | Ga0209969_10086961 | 100 |
| 94 | 3300027471 | Ga0209995_1040909 | Ga0209995_10409091 | 100 |
| 95 | 3300027552 | Ga0209982_1004183 | Ga0209982_10041832 | 100 |
| 96 | 3300027695 | Ga0209966_1001176 | Ga0209966_10011762 | 100 |
| 97 | 3300027717 | Ga0209998_10009463 | Ga0209998_100094634 | 100 |
| 98 | 3300031249 | Ga0265339_10524528 | Ga0265339_105245281 | 100 |
| 99 | 3300031344 | Ga0265316_10789014 | Ga0265316_107890142 | 100 |
| 100 | 3300031595 | Ga0265313_10006684 | Ga0265313_100066848 | 100 |
| 101 | 3300031711 | Ga0265314_10020005 | Ga0265314_100200053 | 100 |
| 102 | 3300031712 | Ga0265342_10000841 | Ga0265342_1000084121 | 100 |
| 103 | 3300035118 | Ga0373954_0617224 | Ga0373954_0617224_96_419 | 100 |
| 104 | 3300035172 | Ga0373955_0233632 | Ga0373955_0233632_124_447 | 100 |
| 105 | 3300035724 | Ga0373933_0063519 | Ga0373933_0063519_617_940 | 100 |
| 106 | 3300036401 | Ga0373937_0114369 | Ga0373937_0114369_1971_2282 | 100 |
| 107 | 3300036401 | Ga0373937_0194500 | Ga0373937_0194500_1298_1621 | 100 |
| 108 | 3300037418 | Ga0395900_0614785 | Ga0395900_0614785_340_642 | 100 |
| 109 | 3300038443 | Ga0395901_0255746 | Ga0395901_0255746_613_915 | 100 |
| 110 | 3300038443 | Ga0395901_1907938 | Ga0395901_1907938_56_358 | 100 |
| 111 | 3300042012 | Ga0439455_0074871 | Ga0439455_0074871_62_364 | 100 |
| 112 | 3300042461 | Ga0439460_0038275 | Ga0439460_0038275_702_1004 | 100 |
| 113 | 3300044694 | Ga0466963_0903170 | Ga0466963_0903170_21_323 | 100 |
| 114 | 3300044712 | Ga0453684_1704701 | Ga0453684_1704701_179_481 | 100 |
| 115 | 3300044719 | Ga0466971_0286728 | Ga0466971_0286728_412_714 | 100 |
| 116 | 3300045049 | Ga0466959_0249028 | Ga0466959_0249028_705_1007 | 100 |
| 117 | 3300046511 | Ga0495608_0376970 | Ga0495608_0376970_43_354 | 100 |
| 118 | 3300049571 | Ga0501034_0825168 | Ga0501034_0825168_229_531 | 100 |
| 119 | 3300049580 | Ga0501046_0667829 | Ga0501046_0667829_240_542 | 100 |
| 120 | 3300049581 | Ga0501047_0843243 | Ga0501047_0843243_226_528 | 100 |
| 121 | 3300049590 | Ga0501074_0542558 | Ga0501074_0542558_259_561 | 100 |
| 122 | 3300049822 | Ga0501035_0320173 | Ga0501035_0320173_58_360 | 100 |
| 123 | 3300049823 | Ga0501044_0125510 | Ga0501044_0125510_873_1175 | 100 |
| 124 | 3300050493 | nmdc:mga0k408_900996_c1 | nmdc:mga0k408_900996_c1_168_479 | 100 |
| 125 | 3300050507 | nmdc:mga05p37_998628_c1 | nmdc:mga05p37_998628_c1_415_726 | 100 |
| 126 | 3300050510 | nmdc:mga06r32_1799963_c1 | nmdc:mga06r32_1799963_c1_59_370 | 100 |
| 127 | 3300050511 | nmdc:mga08y16_103927_c1 | nmdc:mga08y16_103927_c1_1510_1821 | 100 |
| 128 | 3300050512 | nmdc:mga0n895_45970_c1 | nmdc:mga0n895_45970_c1_2721_3032 | 100 |
| 129 | 3300050513 | nmdc:mga0rr50_999589_c1 | nmdc:mga0rr50_999589_c1_244_555 | 100 |
| 130 | 3300050515 | nmdc:mga0a205_10038_c1 | nmdc:mga0a205_10038_c1_5566_5877 | 100 |
| 131 | 3300053084 | Ga0495595_0422407 | Ga0495595_0422407_23_346 | 100 |
| 132 | 3300053085 | Ga0495619_0282046 | Ga0495619_0282046_428_751 | 100 |
| 133 | 3300053153 | Ga0500616_0123737 | Ga0500616_0123737_685_996 | 100 |
| 134 | 3300006042 | Ga0075368_10019706 | Ga0075368_100197066 | 101 |
| 135 | 3300006048 | Ga0075363_100047592 | Ga0075363_1000475923 | 101 |
| 136 | 3300006051 | Ga0075364_10037083 | Ga0075364_100370833 | 101 |
| 137 | 3300006177 | Ga0075362_10032958 | Ga0075362_100329583 | 101 |
| 138 | 3300006178 | Ga0075367_10053650 | Ga0075367_100536502 | 101 |
| 139 | 3300006186 | Ga0075369_10027920 | Ga0075369_100279202 | 101 |
| 140 | 3300006195 | Ga0075366_10678908 | Ga0075366_106789081 | 101 |
| 141 | 3300006353 | Ga0075370_10081079 | Ga0075370_100810792 | 101 |
| 142 | 3300027866 | Ga0209813_10001100 | Ga0209813_100011008 | 101 |
| 143 | 3300049587 | Ga0501071_0831095 | Ga0501071_0831095_142_453 | 101 |
| 144 | 3300049591 | Ga0501075_0300855 | Ga0501075_0300855_456_767 | 101 |
| 145 | 3300049743 | Ga0501081_0957722 | Ga0501081_0957722_116_427 | 101 |
| 146 | 3300050489 | nmdc:mga03683_5582_c1 | nmdc:mga03683_5582_c1_282_587 | 101 |
| 147 | 3300050493 | nmdc:mga0k408_63606_c1 | nmdc:mga0k408_63606_c1_709_1014 | 101 |
| 148 | 3300054114 | Ga0501084_0232878 | Ga0501084_0232878_516_827 | 101 |
| 149 | 3300061734 | Ga0530510_0545615 | Ga0530510_0545615_449_760 | 101 |
| 150 | 3300006852 | Ga0075433_11051906 | Ga0075433_110519062 | 102 |
| 151 | 3300009147 | Ga0114129_11110381 | Ga0114129_111103812 | 102 |
| 152 | 3300014968 | Ga0157379_10952289 | Ga0157379_109522891 | 102 |
| 153 | 3300039437 | Ga0436365_1381709 | Ga0436365_1381709_21_335 | 102 |
| 154 | 3300044673 | Ga0453683_1216594 | Ga0453683_1216594_26_337 | 102 |
| 155 | 3300049578 | Ga0501042_0771290 | Ga0501042_0771290_240_554 | 102 |
| 156 | 3300049588 | Ga0501072_0303289 | Ga0501072_0303289_570_890 | 102 |
| 157 | 3300049588 | Ga0501072_0642037 | Ga0501072_0642037_422_736 | 102 |
| 158 | 3300049591 | Ga0501075_0457257 | Ga0501075_0457257_423_737 | 102 |
| 159 | 3300049592 | Ga0501076_0067231 | Ga0501076_0067231_1296_1610 | 102 |
| 160 | 3300049743 | Ga0501081_0338446 | Ga0501081_0338446_530_844 | 102 |
| 161 | 3300050515 | nmdc:mga0a205_906623_c1 | nmdc:mga0a205_906623_c1_248_562 | 102 |
| 162 | 3300053139 | Ga0500568_0052530 | Ga0500568_0052530_771_1091 | 102 |
| 163 | 3300054114 | Ga0501084_0711915 | Ga0501084_0711915_271_585 | 102 |
| 164 | 3300060353 | Ga0501082_0351037 | Ga0501082_0351037_572_886 | 102 |
| 165 | 3300003911 | JGI25405J52794_10019710 | JGI25405J52794_100197102 | 103 |
| 166 | 3300005329 | Ga0070683_101225567 | Ga0070683_1012255671 | 103 |
| 167 | 3300005330 | Ga0070690_100266051 | Ga0070690_1002660513 | 103 |
| 168 | 3300005337 | Ga0070682_100062566 | Ga0070682_1000625665 | 103 |
| 169 | 3300005337 | Ga0070682_100378969 | Ga0070682_1003789692 | 103 |
| 170 | 3300005337 | Ga0070682_101036272 | Ga0070682_1010362722 | 103 |
| 171 | 3300005339 | Ga0070660_100612262 | Ga0070660_1006122622 | 103 |
| 172 | 3300005344 | Ga0070661_100228093 | Ga0070661_1002280932 | 103 |
| 173 | 3300005355 | Ga0070671_100061508 | Ga0070671_1000615085 | 103 |
| 174 | 3300005435 | Ga0070714_100202442 | Ga0070714_1002024422 | 103 |
| 175 | 3300005438 | Ga0070701_10194971 | Ga0070701_101949712 | 103 |
| 176 | 3300005439 | Ga0070711_100015569 | Ga0070711_1000155695 | 103 |
| 177 | 3300005439 | Ga0070711_100249465 | Ga0070711_1002494651 | 103 |
| 178 | 3300005445 | Ga0070708_100010550 | Ga0070708_1000105502 | 103 |
| 179 | 3300005455 | Ga0070663_100527909 | Ga0070663_1005279092 | 103 |
| 180 | 3300005456 | Ga0070678_100061654 | Ga0070678_1000616542 | 103 |
| 181 | 3300005457 | Ga0070662_100467770 | Ga0070662_1004677702 | 103 |
| 182 | 3300005457 | Ga0070662_100520410 | Ga0070662_1005204102 | 103 |
| 183 | 3300005458 | Ga0070681_10206806 | Ga0070681_102068063 | 103 |
| 184 | 3300005458 | Ga0070681_10224839 | Ga0070681_102248391 | 103 |
| 185 | 3300005468 | Ga0070707_100410356 | Ga0070707_1004103562 | 103 |
| 186 | 3300005530 | Ga0070679_100178466 | Ga0070679_1001784662 | 103 |
| 187 | 3300005530 | Ga0070679_100961102 | Ga0070679_1009611022 | 103 |
| 188 | 3300005530 | Ga0070679_101788471 | Ga0070679_1017884712 | 103 |
| 189 | 3300005535 | Ga0070684_100446112 | Ga0070684_1004461123 | 103 |
| 190 | 3300005545 | Ga0070695_100487841 | Ga0070695_1004878412 | 103 |
| 191 | 3300005564 | Ga0070664_100235074 | Ga0070664_1002350743 | 103 |
| 192 | 3300005842 | Ga0068858_101163939 | Ga0068858_1011639392 | 103 |
| 193 | 3300005937 | Ga0081455_10000002 | Ga0081455_10000002406 | 103 |
| 194 | 3300005937 | Ga0081455_10027656 | Ga0081455_100276566 | 103 |
| 195 | 3300005937 | Ga0081455_10050997 | Ga0081455_100509975 | 103 |
| 196 | 3300005983 | Ga0081540_1026148 | Ga0081540_10261483 | 103 |
| 197 | 3300006028 | Ga0070717_10517872 | Ga0070717_105178722 | 103 |
| 198 | 3300006058 | Ga0075432_10006215 | Ga0075432_100062155 | 103 |
| 199 | 3300006163 | Ga0070715_10957021 | Ga0070715_109570211 | 103 |
| 200 | 3300006844 | Ga0075428_100002408 | Ga0075428_10000240824 | 103 |
| 201 | 3300006846 | Ga0075430_100000032 | Ga0075430_10000003242 | 103 |
| 202 | 3300006847 | Ga0075431_100009024 | Ga0075431_1000090248 | 103 |
| 203 | 3300006852 | Ga0075433_10000976 | Ga0075433_1000097624 | 103 |
| 204 | 3300006852 | Ga0075433_10044742 | Ga0075433_100447424 | 103 |
| 205 | 3300006852 | Ga0075433_11727494 | Ga0075433_117274941 | 103 |
| 206 | 3300006871 | Ga0075434_100000341 | Ga0075434_10000034127 | 103 |
| 207 | 3300006871 | Ga0075434_100059042 | Ga0075434_1000590422 | 103 |
| 208 | 3300006880 | Ga0075429_100000631 | Ga0075429_10000063129 | 103 |
| 209 | 3300006880 | Ga0075429_101042700 | Ga0075429_1010427001 | 103 |
| 210 | 3300006914 | Ga0075436_100116041 | Ga0075436_1001160414 | 103 |
| 211 | 3300006914 | Ga0075436_100756477 | Ga0075436_1007564772 | 103 |
| 212 | 3300007076 | Ga0075435_100022993 | Ga0075435_1000229933 | 103 |
| 213 | 3300007076 | Ga0075435_100060236 | Ga0075435_1000602364 | 103 |
| 214 | 3300007076 | Ga0075435_100863239 | Ga0075435_1008632392 | 103 |
| 215 | 3300009093 | Ga0105240_10111765 | Ga0105240_101117653 | 103 |
| 216 | 3300009094 | Ga0111539_10001270 | Ga0111539_100012701 | 103 |
| 217 | 3300009094 | Ga0111539_10197339 | Ga0111539_101973395 | 103 |
| 218 | 3300009094 | Ga0111539_12459714 | Ga0111539_124597142 | 103 |
| 219 | 3300009098 | Ga0105245_10039789 | Ga0105245_100397894 | 103 |
| 220 | 3300009147 | Ga0114129_10001035 | Ga0114129_1000103520 | 103 |
| 221 | 3300009147 | Ga0114129_10001551 | Ga0114129_1000155134 | 103 |
| 222 | 3300009176 | Ga0105242_10106058 | Ga0105242_101060582 | 103 |
| 223 | 3300009177 | Ga0105248_10332388 | Ga0105248_103323883 | 103 |
| 224 | 3300009545 | Ga0105237_10084828 | Ga0105237_100848283 | 103 |
| 225 | 3300009551 | Ga0105238_11459457 | Ga0105238_114594572 | 103 |
| 226 | 3300009551 | Ga0105238_11771762 | Ga0105238_117717621 | 103 |
| 227 | 3300010375 | Ga0105239_11050476 | Ga0105239_110504762 | 103 |
| 228 | 3300010375 | Ga0105239_12826958 | Ga0105239_128269581 | 103 |
| 229 | 3300013100 | Ga0157373_10032188 | Ga0157373_100321883 | 103 |
| 230 | 3300013100 | Ga0157373_10088443 | Ga0157373_100884432 | 103 |
| 231 | 3300013105 | Ga0157369_10421221 | Ga0157369_104212213 | 103 |
| 232 | 3300013296 | Ga0157374_10045943 | Ga0157374_100459432 | 103 |
| 233 | 3300013306 | Ga0163162_10047201 | Ga0163162_100472014 | 103 |
| 234 | 3300013307 | Ga0157372_10099175 | Ga0157372_100991751 | 103 |
| 235 | 3300013307 | Ga0157372_10182904 | Ga0157372_101829043 | 103 |
| 236 | 3300014326 | Ga0157380_11007189 | Ga0157380_110071891 | 103 |
| 237 | 3300014969 | Ga0157376_10454158 | Ga0157376_104541583 | 103 |
| 238 | 3300014969 | Ga0157376_11425947 | Ga0157376_114259472 | 103 |
| 239 | 3300017792 | Ga0163161_10220614 | Ga0163161_102206142 | 103 |
| 240 | 3300025903 | Ga0207680_10105667 | Ga0207680_101056674 | 103 |
| 241 | 3300025905 | Ga0207685_10664139 | Ga0207685_106641392 | 103 |
| 242 | 3300025907 | Ga0207645_10293008 | Ga0207645_102930082 | 103 |
| 243 | 3300025912 | Ga0207707_10312794 | Ga0207707_103127943 | 103 |
| 244 | 3300025913 | Ga0207695_10848468 | Ga0207695_108484682 | 103 |
| 245 | 3300025914 | Ga0207671_10496670 | Ga0207671_104966702 | 103 |
| 246 | 3300025915 | Ga0207693_10016657 | Ga0207693_100166574 | 103 |
| 247 | 3300025916 | Ga0207663_10064670 | Ga0207663_100646702 | 103 |
| 248 | 3300025921 | Ga0207652_10666498 | Ga0207652_106664981 | 103 |
| 249 | 3300025921 | Ga0207652_11568289 | Ga0207652_115682891 | 103 |
| 250 | 3300025922 | Ga0207646_11054632 | Ga0207646_110546322 | 103 |
| 251 | 3300025924 | Ga0207694_11737218 | Ga0207694_117372182 | 103 |
| 252 | 3300025927 | Ga0207687_10581368 | Ga0207687_105813682 | 103 |
| 253 | 3300025928 | Ga0207700_10046780 | Ga0207700_100467803 | 103 |
| 254 | 3300025929 | Ga0207664_10266135 | Ga0207664_102661352 | 103 |
| 255 | 3300025933 | Ga0207706_10128113 | Ga0207706_101281132 | 103 |
| 256 | 3300025933 | Ga0207706_10545189 | Ga0207706_105451892 | 103 |
| 257 | 3300025937 | Ga0207669_10797829 | Ga0207669_107978291 | 103 |
| 258 | 3300025941 | Ga0207711_10298219 | Ga0207711_102982192 | 103 |
| 259 | 3300025945 | Ga0207679_10098964 | Ga0207679_100989642 | 103 |
| 260 | 3300025986 | Ga0207658_10216638 | Ga0207658_102166382 | 103 |
| 261 | 3300026121 | Ga0207683_10029889 | Ga0207683_100298894 | 103 |
| 262 | 3300027526 | Ga0209968_1021237 | Ga0209968_10212371 | 103 |
| 263 | 3300027907 | Ga0207428_10000082 | Ga0207428_1000008297 | 103 |
| 264 | 3300027907 | Ga0207428_10111248 | Ga0207428_101112481 | 103 |
| 265 | 3300027907 | Ga0207428_11039314 | Ga0207428_110393141 | 103 |
| 266 | 3300027907 | Ga0207428_11299269 | Ga0207428_112992691 | 103 |
| 267 | 3300031344 | Ga0265316_10756025 | Ga0265316_107560251 | 103 |
| 268 | 3300031595 | Ga0265313_10146316 | Ga0265313_101463162 | 103 |
| 269 | 3300035083 | Ga0373926_0195144 | Ga0373926_0195144_267_635 | 103 |
| 270 | 3300035089 | Ga0373944_0012601 | Ga0373944_0012601_175_543 | 103 |
| 271 | 3300035111 | Ga0373923_0018198 | Ga0373923_0018198_846_1163 | 103 |
| 272 | 3300035111 | Ga0373923_0207939 | Ga0373923_0207939_319_687 | 103 |
| 273 | 3300035112 | Ga0373932_0014657 | Ga0373932_0014657_895_1263 | 103 |
| 274 | 3300035116 | Ga0373945_0020170 | Ga0373945_0020170_1325_1693 | 103 |
| 275 | 3300035116 | Ga0373945_0358777 | Ga0373945_0358777_269_586 | 103 |
| 276 | 3300035117 | Ga0373953_0073934 | Ga0373953_0073934_1023_1340 | 103 |
| 277 | 3300035118 | Ga0373954_0010833 | Ga0373954_0010833_233_550 | 103 |
| 278 | 3300035120 | Ga0373957_0044859 | Ga0373957_0044859_231_548 | 103 |
| 279 | 3300035170 | Ga0373943_0269864 | Ga0373943_0269864_53_421 | 103 |
| 280 | 3300035171 | Ga0373946_0011149 | Ga0373946_0011149_230_598 | 103 |
| 281 | 3300035172 | Ga0373955_0713886 | Ga0373955_0713886_36_353 | 103 |
| 282 | 3300035410 | Ga0373924_0043968 | Ga0373924_0043968_1016_1333 | 103 |
| 283 | 3300035692 | Ga0373935_0026703 | Ga0373935_0026703_990_1358 | 103 |
| 284 | 3300035724 | Ga0373933_0037972 | Ga0373933_0037972_2421_2738 | 103 |
| 285 | 3300035724 | Ga0373933_0620621 | Ga0373933_0620621_257_574 | 103 |
| 286 | 3300035725 | Ga0373947_0705139 | Ga0373947_0705139_59_427 | 103 |
| 287 | 3300036401 | Ga0373937_0000879 | Ga0373937_0000879_22067_22384 | 103 |
| 288 | 3300036401 | Ga0373937_0402609 | Ga0373937_0402609_795_1112 | 103 |
| 289 | 3300037068 | Ga0373925_0725138 | Ga0373925_0725138_233_601 | 103 |
| 290 | 3300042008 | Ga0439450_146676 | Ga0439450_146676_262_579 | 103 |
| 291 | 3300042532 | Ga0450893_0108521 | Ga0450893_0108521_43_360 | 103 |
| 292 | 3300046454 | Ga0495592_0102143 | Ga0495592_0102143_67_384 | 103 |
| 293 | 3300046455 | Ga0495603_0059610 | Ga0495603_0059610_274_642 | 103 |
| 294 | 3300046459 | Ga0495629_0414830 | Ga0495629_0414830_296_613 | 103 |
| 295 | 3300046462 | Ga0495651_0000895 | Ga0495651_0000895_788_1105 | 103 |
| 296 | 3300046463 | Ga0495653_0004420 | Ga0495653_0004420_1978_2295 | 103 |
| 297 | 3300046463 | Ga0495653_0444551 | Ga0495653_0444551_482_799 | 103 |
| 298 | 3300046472 | Ga0495580_0670585 | Ga0495580_0670585_193_510 | 103 |
| 299 | 3300046473 | Ga0495582_0395005 | Ga0495582_0395005_400_717 | 103 |
| 300 | 3300046475 | Ga0495639_0135258 | Ga0495639_0135258_303_671 | 103 |
| 301 | 3300046477 | Ga0495664_0006433 | Ga0495664_0006433_3351_3668 | 103 |
| 302 | 3300046477 | Ga0495664_0045094 | Ga0495664_0045094_1081_1449 | 103 |
| 303 | 3300046477 | Ga0495664_0757598 | Ga0495664_0757598_34_351 | 103 |
| 304 | 3300046499 | Ga0495594_0744423 | Ga0495594_0744423_193_510 | 103 |
| 305 | 3300046511 | Ga0495608_0000129 | Ga0495608_0000129_5924_6241 | 103 |
| 306 | 3300046511 | Ga0495608_0227804 | Ga0495608_0227804_691_1008 | 103 |
| 307 | 3300046514 | Ga0495618_0003211 | Ga0495618_0003211_5375_5692 | 103 |
| 308 | 3300046514 | Ga0495618_0040562 | Ga0495618_0040562_2140_2508 | 103 |
| 309 | 3300046514 | Ga0495618_0074607 | Ga0495618_0074607_716_1033 | 103 |
| 310 | 3300046516 | Ga0495628_0636356 | Ga0495628_0636356_232_549 | 103 |
| 311 | 3300046517 | Ga0495630_0331755 | Ga0495630_0331755_707_1075 | 103 |
| 312 | 3300046517 | Ga0495630_1032043 | Ga0495630_1032043_252_569 | 103 |
| 313 | 3300046526 | Ga0495666_0177263 | Ga0495666_0177263_14_382 | 103 |
| 314 | 3300046529 | Ga0495652_0135100 | Ga0495652_0135100_257_625 | 103 |
| 315 | 3300046529 | Ga0495652_0178454 | Ga0495652_0178454_1143_1460 | 103 |
| 316 | 3300046529 | Ga0495652_0590805 | Ga0495652_0590805_232_549 | 103 |
| 317 | 3300046531 | Ga0495665_0214700 | Ga0495665_0214700_68_436 | 103 |
| 318 | 3300046533 | Ga0495640_0007245 | Ga0495640_0007245_175_492 | 103 |
| 319 | 3300046535 | Ga0495586_0115804 | Ga0495586_0115804_364_681 | 103 |
| 320 | 3300046536 | Ga0495587_0001060 | Ga0495587_0001060_17405_17722 | 103 |
| 321 | 3300046543 | Ga0495645_0008141 | Ga0495645_0008141_2567_2884 | 103 |
| 322 | 3300046557 | Ga0495622_0153753 | Ga0495622_0153753_466_783 | 103 |
| 323 | 3300046559 | Ga0495667_0007026 | Ga0495667_0007026_4428_4745 | 103 |
| 324 | 3300046559 | Ga0495667_0534087 | Ga0495667_0534087_23_340 | 103 |
| 325 | 3300046559 | Ga0495667_0663597 | Ga0495667_0663597_52_420 | 103 |
| 326 | 3300046642 | Ga0495634_0017126 | Ga0495634_0017126_2853_3170 | 103 |
| 327 | 3300046642 | Ga0495634_0272628 | Ga0495634_0272628_412_780 | 103 |
| 328 | 3300046663 | Ga0495635_0033965 | Ga0495635_0033965_2851_3219 | 103 |
| 329 | 3300046663 | Ga0495635_0124575 | Ga0495635_0124575_258_575 | 103 |
| 330 | 3300046675 | Ga0495657_0001374 | Ga0495657_0001374_11_328 | 103 |
| 331 | 3300046675 | Ga0495657_0309315 | Ga0495657_0309315_495_812 | 103 |
| 332 | 3300046678 | Ga0495599_0000294 | Ga0495599_0000294_24136_24453 | 103 |
| 333 | 3300046678 | Ga0495599_0409494 | Ga0495599_0409494_377_700 | 103 |
| 334 | 3300046679 | Ga0495623_0001158 | Ga0495623_0001158_17427_17744 | 103 |
| 335 | 3300046680 | Ga0495646_0037980 | Ga0495646_0037980_92_409 | 103 |
| 336 | 3300046681 | Ga0495647_0299561 | Ga0495647_0299561_262_630 | 103 |
| 337 | 3300046690 | Ga0495624_0111631 | Ga0495624_0111631_1141_1458 | 103 |
| 338 | 3300046809 | Ga0495600_0000977 | Ga0495600_0000977_13492_13809 | 103 |
| 339 | 3300046809 | Ga0495600_0105691 | Ga0495600_0105691_408_725 | 103 |
| 340 | 3300047315 | Ga0495581_0421366 | Ga0495581_0421366_265_633 | 103 |
| 341 | 3300047317 | Ga0495604_0001139 | Ga0495604_0001139_12850_13167 | 103 |
| 342 | 3300047317 | Ga0495604_0162429 | Ga0495604_0162429_1247_1564 | 103 |
| 343 | 3300047318 | Ga0495636_0206031 | Ga0495636_0206031_73_393 | 103 |
| 344 | 3300047319 | Ga0495674_0010157 | Ga0495674_0010157_5908_6225 | 103 |
| 345 | 3300047319 | Ga0495674_0062334 | Ga0495674_0062334_587_955 | 103 |
| 346 | 3300047321 | Ga0495676_0150290 | Ga0495676_0150290_204_572 | 103 |
| 347 | 3300047322 | Ga0495680_0003174 | Ga0495680_0003174_2826_3143 | 103 |
| 348 | 3300047322 | Ga0495680_0003711 | Ga0495680_0003711_420_737 | 103 |
| 349 | 3300047322 | Ga0495680_0789980 | Ga0495680_0789980_231_599 | 103 |
| 350 | 3300047444 | Ga0495675_0000190 | Ga0495675_0000190_23735_24052 | 103 |
| 351 | 3300047471 | Ga0495684_0082590 | Ga0495684_0082590_2066_2383 | 103 |
| 352 | 3300047673 | Ga0495593_0019723 | Ga0495593_0019723_2478_2795 | 103 |
| 353 | 3300047673 | Ga0495593_0455347 | Ga0495593_0455347_40_357 | 103 |
| 354 | 3300048088 | Ga0495602_0018144 | Ga0495602_0018144_6110_6427 | 103 |
| 355 | 3300048089 | Ga0495614_0089099 | Ga0495614_0089099_1007_1324 | 103 |
| 356 | 3300048904 | Ga0496101_0422672 | Ga0496101_0422672_655_972 | 103 |
| 357 | 3300048905 | Ga0496102_0102034 | Ga0496102_0102034_2312_2629 | 103 |
| 358 | 3300048907 | Ga0496104_0035483 | Ga0496104_0035483_338_655 | 103 |
| 359 | 3300048909 | Ga0496106_0182027 | Ga0496106_0182027_746_1063 | 103 |
| 360 | 3300048910 | Ga0496107_1066766 | Ga0496107_1066766_231_548 | 103 |
| 361 | 3300048911 | Ga0496108_0006074 | Ga0496108_0006074_9214_9531 | 103 |
| 362 | 3300048911 | Ga0496108_0131099 | Ga0496108_0131099_1348_1665 | 103 |
| 363 | 3300048912 | Ga0496109_0605302 | Ga0496109_0605302_161_478 | 103 |
| 364 | 3300048917 | Ga0496114_0097585 | Ga0496114_0097585_590_907 | 103 |
| 365 | 3300048918 | Ga0496115_0073203 | Ga0496115_0073203_1852_2169 | 103 |
| 366 | 3300048918 | Ga0496115_0891135 | Ga0496115_0891135_161_478 | 103 |
| 367 | 3300048918 | Ga0496115_1167739 | Ga0496115_1167739_210_527 | 103 |
| 368 | 3300049579 | Ga0501043_0281876 | Ga0501043_0281876_267_584 | 103 |
| 369 | 3300049581 | Ga0501047_0836096 | Ga0501047_0836096_185_502 | 103 |
| 370 | 3300049583 | Ga0501067_0078070 | Ga0501067_0078070_795_1112 | 103 |
| 371 | 3300049585 | Ga0501069_0218477 | Ga0501069_0218477_454_771 | 103 |
| 372 | 3300049588 | Ga0501072_1010998 | Ga0501072_1010998_96_413 | 103 |
| 373 | 3300049590 | Ga0501074_0630285 | Ga0501074_0630285_144_461 | 103 |
| 374 | 3300049591 | Ga0501075_0256278 | Ga0501075_0256278_740_1057 | 103 |
| 375 | 3300049592 | Ga0501076_0075333 | Ga0501076_0075333_1405_1722 | 103 |
| 376 | 3300049593 | Ga0501077_0032711 | Ga0501077_0032711_1210_1527 | 103 |
| 377 | 3300049593 | Ga0501077_0371641 | Ga0501077_0371641_166_483 | 103 |
| 378 | 3300049742 | Ga0501080_1762953 | Ga0501080_1762953_35_352 | 103 |
| 379 | 3300050494 | nmdc:mga06z11_719979_c1 | nmdc:mga06z11_719979_c1_218_535 | 103 |
| 380 | 3300050507 | nmdc:mga05p37_19_c2 | nmdc:mga05p37_19_c2_44225_44542 | 103 |
| 381 | 3300050507 | nmdc:mga05p37_50650_c1 | nmdc:mga05p37_50650_c1_3621_3938 | 103 |
| 382 | 3300050508 | nmdc:mga09592_39279_c1 | nmdc:mga09592_39279_c1_282_599 | 103 |
| 383 | 3300050509 | nmdc:mga0qj67_259_c1 | nmdc:mga0qj67_259_c1_23855_24172 | 103 |
| 384 | 3300050510 | nmdc:mga06r32_2023_c1 | nmdc:mga06r32_2023_c1_13338_13655 | 103 |
| 385 | 3300050511 | nmdc:mga08y16_202415_c1 | nmdc:mga08y16_202415_c1_19_378 | 103 |
| 386 | 3300050511 | nmdc:mga08y16_79772_c1 | nmdc:mga08y16_79772_c1_2951_3268 | 103 |
| 387 | 3300050512 | nmdc:mga0n895_1651_c1 | nmdc:mga0n895_1651_c1_9805_10122 | 103 |
| 388 | 3300050512 | nmdc:mga0n895_394_c1 | nmdc:mga0n895_394_c1_6056_6373 | 103 |
| 389 | 3300050513 | nmdc:mga0rr50_18314_c1 | nmdc:mga0rr50_18314_c1_637_954 | 103 |
| 390 | 3300050513 | nmdc:mga0rr50_785_c1 | nmdc:mga0rr50_785_c1_2496_2813 | 103 |
| 391 | 3300050513 | nmdc:mga0rr50_826474_c1 | nmdc:mga0rr50_826474_c1_164_490 | 103 |
| 392 | 3300050514 | nmdc:mga08x19_620079_c1 | nmdc:mga08x19_620079_c1_205_522 | 103 |
| 393 | 3300050514 | nmdc:mga08x19_78302_c1 | nmdc:mga08x19_78302_c1_1539_1856 | 103 |
| 394 | 3300050515 | nmdc:mga0a205_1167_c2 | nmdc:mga0a205_1167_c2_9752_10069 | 103 |
| 395 | 3300050515 | nmdc:mga0a205_249_c1 | nmdc:mga0a205_249_c1_26085_26402 | 103 |
| 396 | 3300050515 | nmdc:mga0a205_934122_c1 | nmdc:mga0a205_934122_c1_113_472 | 103 |
| 397 | 3300053077 | Ga0495601_0002495 | Ga0495601_0002495_9826_10143 | 103 |
| 398 | 3300053077 | Ga0495601_0006979 | Ga0495601_0006979_2102_2470 | 103 |
| 399 | 3300053077 | Ga0495601_0051130 | Ga0495601_0051130_307_624 | 103 |
| 400 | 3300053077 | Ga0495601_0525352 | Ga0495601_0525352_71_388 | 103 |
| 401 | 3300053078 | Ga0495612_0001553 | Ga0495612_0001553_8416_8733 | 103 |
| 402 | 3300053078 | Ga0495612_0017287 | Ga0495612_0017287_1886_2254 | 103 |
| 403 | 3300053084 | Ga0495595_0000305 | Ga0495595_0000305_15634_15951 | 103 |
| 404 | 3300053084 | Ga0495595_0005742 | Ga0495595_0005742_807_1124 | 103 |
| 405 | 3300053085 | Ga0495619_0000052 | Ga0495619_0000052_61756_62073 | 103 |
| 406 | 3300053085 | Ga0495619_0001206 | Ga0495619_0001206_6766_7134 | 103 |
| 407 | 3300053085 | Ga0495619_0035410 | Ga0495619_0035410_2826_3143 | 103 |
| 408 | 3300053094 | Ga0500566_0244864 | Ga0500566_0244864_145_513 | 103 |
| 409 | 3300053122 | Ga0500608_276236 | Ga0500608_276236_260_628 | 103 |
| 410 | 3300053177 | Ga0500636_0385303 | Ga0500636_0385303_30_347 | 103 |
| 411 | 3300054114 | Ga0501084_0076099 | Ga0501084_0076099_924_1241 | 103 |
| 412 | 3300060353 | Ga0501082_0170506 | Ga0501082_0170506_603_920 | 103 |
| 413 | 2162886007 | SwRhRL2b_contig_3134885 | SwRhRL2b_0609.00002310 | 104 |
| 414 | 3300000041 | ARcpr5oldR_c000007 | ARcpr5oldR_0000077 | 104 |
| 415 | 3300000042 | ARSoilYngRDRAFT_c00111 | ARSoilYngRDRAFT_001117 | 104 |
| 416 | 3300000043 | ARcpr5yngRDRAFT_c000090 | ARcpr5yngRDRAFT_00009015 | 104 |
| 417 | 3300000044 | ARSoilOldRDRAFT_c000004 | ARSoilOldRDRAFT_00000449 | 104 |
| 418 | 3300000045 | ARCol0oldRDRAFT_c00252 | ARCol0oldRDRAFT_002527 | 104 |
| 419 | 3300000652 | ARCol0yngRDRAFT_1000074 | ARCol0yngRDRAFT_100007415 | 104 |
| 420 | 3300001989 | JGI24739J22299_10120407 | JGI24739J22299_101204072 | 104 |
| 421 | 3300001990 | JGI24737J22298_10040242 | JGI24737J22298_100402422 | 104 |
| 422 | 3300002459 | JGI24751J29686_10035409 | JGI24751J29686_100354092 | 104 |
| 423 | 3300005289 | Ga0065704_10140814 | Ga0065704_101408142 | 104 |
| 424 | 3300005290 | Ga0065712_10074224 | Ga0065712_100742242 | 104 |
| 425 | 3300005293 | Ga0065715_10001507 | Ga0065715_100015074 | 104 |
| 426 | 3300005328 | Ga0070676_10178581 | Ga0070676_101785812 | 104 |
| 427 | 3300005328 | Ga0070676_10723112 | Ga0070676_107231122 | 104 |
| 428 | 3300005330 | Ga0070690_100016276 | Ga0070690_1000162766 | 104 |
| 429 | 3300005334 | Ga0068869_100481001 | Ga0068869_1004810012 | 104 |
| 430 | 3300005336 | Ga0070680_101489396 | Ga0070680_1014893962 | 104 |
| 431 | 3300005338 | Ga0068868_100131943 | Ga0068868_1001319434 | 104 |
| 432 | 3300005339 | Ga0070660_100023926 | Ga0070660_1000239262 | 104 |
| 433 | 3300005339 | Ga0070660_100212826 | Ga0070660_1002128262 | 104 |
| 434 | 3300005339 | Ga0070660_100544293 | Ga0070660_1005442933 | 104 |
| 435 | 3300005341 | Ga0070691_10015669 | Ga0070691_100156692 | 104 |
| 436 | 3300005343 | Ga0070687_100058634 | Ga0070687_1000586342 | 104 |
| 437 | 3300005347 | Ga0070668_100063032 | Ga0070668_1000630324 | 104 |
| 438 | 3300005356 | Ga0070674_100243238 | Ga0070674_1002432382 | 104 |
| 439 | 3300005365 | Ga0070688_100007418 | Ga0070688_1000074188 | 104 |
| 440 | 3300005366 | Ga0070659_100033098 | Ga0070659_1000330982 | 104 |
| 441 | 3300005437 | Ga0070710_10292538 | Ga0070710_102925382 | 104 |
| 442 | 3300005438 | Ga0070701_10086165 | Ga0070701_100861652 | 104 |
| 443 | 3300005439 | Ga0070711_100210514 | Ga0070711_1002105142 | 104 |
| 444 | 3300005440 | Ga0070705_100024922 | Ga0070705_1000249225 | 104 |
| 445 | 3300005440 | Ga0070705_100245552 | Ga0070705_1002455522 | 104 |
| 446 | 3300005441 | Ga0070700_100006176 | Ga0070700_1000061765 | 104 |
| 447 | 3300005444 | Ga0070694_100022606 | Ga0070694_1000226062 | 104 |
| 448 | 3300005444 | Ga0070694_100255402 | Ga0070694_1002554022 | 104 |
| 449 | 3300005455 | Ga0070663_100060440 | Ga0070663_1000604404 | 104 |
| 450 | 3300005455 | Ga0070663_100397782 | Ga0070663_1003977822 | 104 |
| 451 | 3300005456 | Ga0070678_100161142 | Ga0070678_1001611423 | 104 |
| 452 | 3300005457 | Ga0070662_100020477 | Ga0070662_1000204776 | 104 |
| 453 | 3300005457 | Ga0070662_100060479 | Ga0070662_1000604795 | 104 |
| 454 | 3300005458 | Ga0070681_10035954 | Ga0070681_100359546 | 104 |
| 455 | 3300005458 | Ga0070681_10375177 | Ga0070681_103751772 | 104 |
| 456 | 3300005459 | Ga0068867_100037428 | Ga0068867_1000374284 | 104 |
| 457 | 3300005459 | Ga0068867_101011014 | Ga0068867_1010110142 | 104 |
| 458 | 3300005467 | Ga0070706_100867938 | Ga0070706_1008679381 | 104 |
| 459 | 3300005471 | Ga0070698_100194771 | Ga0070698_1001947713 | 104 |
| 460 | 3300005507 | Ga0074259_10551873 | Ga0074259_105518731 | 104 |
| 461 | 3300005518 | Ga0070699_100276198 | Ga0070699_1002761982 | 104 |
| 462 | 3300005530 | Ga0070679_100174499 | Ga0070679_1001744992 | 104 |
| 463 | 3300005530 | Ga0070679_100414523 | Ga0070679_1004145232 | 104 |
| 464 | 3300005535 | Ga0070684_100013001 | Ga0070684_1000130017 | 104 |
| 465 | 3300005539 | Ga0068853_100265245 | Ga0068853_1002652453 | 104 |
| 466 | 3300005543 | Ga0070672_100520224 | Ga0070672_1005202242 | 104 |
| 467 | 3300005544 | Ga0070686_100375741 | Ga0070686_1003757412 | 104 |
| 468 | 3300005545 | Ga0070695_101137079 | Ga0070695_1011370791 | 104 |
| 469 | 3300005547 | Ga0070693_100185933 | Ga0070693_1001859332 | 104 |
| 470 | 3300005549 | Ga0070704_101243516 | Ga0070704_1012435161 | 104 |
| 471 | 3300005563 | Ga0068855_100047838 | Ga0068855_1000478386 | 104 |
| 472 | 3300005564 | Ga0070664_101240334 | Ga0070664_1012403342 | 104 |
| 473 | 3300005578 | Ga0068854_100412823 | Ga0068854_1004128231 | 104 |
| 474 | 3300005614 | Ga0068856_101446061 | Ga0068856_1014460612 | 104 |
| 475 | 3300005614 | Ga0068856_102137680 | Ga0068856_1021376802 | 104 |
| 476 | 3300005616 | Ga0068852_100189709 | Ga0068852_1001897093 | 104 |
| 477 | 3300005617 | Ga0068859_100029252 | Ga0068859_1000292526 | 104 |
| 478 | 3300005618 | Ga0068864_102373942 | Ga0068864_1023739422 | 104 |
| 479 | 3300005718 | Ga0068866_10274370 | Ga0068866_102743702 | 104 |
| 480 | 3300005719 | Ga0068861_100348775 | Ga0068861_1003487752 | 104 |
| 481 | 3300005840 | Ga0068870_10519446 | Ga0068870_105194462 | 104 |
| 482 | 3300005842 | Ga0068858_100057288 | Ga0068858_1000572884 | 104 |
| 483 | 3300005843 | Ga0068860_100020537 | Ga0068860_1000205376 | 104 |
| 484 | 3300005844 | Ga0068862_100070792 | Ga0068862_1000707922 | 104 |
| 485 | 3300005844 | Ga0068862_100581494 | Ga0068862_1005814941 | 104 |
| 486 | 3300006058 | Ga0075432_10132621 | Ga0075432_101326212 | 104 |
| 487 | 3300006173 | Ga0070716_101388129 | Ga0070716_1013881292 | 104 |
| 488 | 3300006175 | Ga0070712_100222014 | Ga0070712_1002220143 | 104 |
| 489 | 3300006852 | Ga0075433_10319165 | Ga0075433_103191652 | 104 |
| 490 | 3300006871 | Ga0075434_100431350 | Ga0075434_1004313502 | 104 |
| 491 | 3300006881 | Ga0068865_100938981 | Ga0068865_1009389812 | 104 |
| 492 | 3300006931 | Ga0097620_100029251 | Ga0097620_1000292513 | 104 |
| 493 | 3300009093 | Ga0105240_10055992 | Ga0105240_100559922 | 104 |
| 494 | 3300009094 | Ga0111539_10000915 | Ga0111539_1000091540 | 104 |
| 495 | 3300009101 | Ga0105247_10158180 | Ga0105247_101581803 | 104 |
| 496 | 3300009148 | Ga0105243_10106669 | Ga0105243_101066694 | 104 |
| 497 | 3300009148 | Ga0105243_10110965 | Ga0105243_101109654 | 104 |
| 498 | 3300009174 | Ga0105241_10096790 | Ga0105241_100967904 | 104 |
| 499 | 3300009174 | Ga0105241_10385179 | Ga0105241_103851792 | 104 |
| 500 | 3300009176 | Ga0105242_10066315 | Ga0105242_100663153 | 104 |
| 501 | 3300009176 | Ga0105242_10301072 | Ga0105242_103010722 | 104 |
| 502 | 3300009545 | Ga0105237_10160503 | Ga0105237_101605032 | 104 |
| 503 | 3300009545 | Ga0105237_10683485 | Ga0105237_106834852 | 104 |
| 504 | 3300009553 | Ga0105249_10061774 | Ga0105249_100617743 | 104 |
| 505 | 3300010375 | Ga0105239_12670758 | Ga0105239_126707582 | 104 |
| 506 | 3300011119 | Ga0105246_10141649 | Ga0105246_101416491 | 104 |
| 507 | 3300011119 | Ga0105246_10172008 | Ga0105246_101720082 | 104 |
| 508 | 3300012480 | Ga0157346_1005788 | Ga0157346_10057881 | 104 |
| 509 | 3300012495 | Ga0157323_1002789 | Ga0157323_10027892 | 104 |
| 510 | 3300012497 | Ga0157319_1043390 | Ga0157319_10433902 | 104 |
| 511 | 3300012502 | Ga0157347_1006398 | Ga0157347_10063981 | 104 |
| 512 | 3300012505 | Ga0157339_1006073 | Ga0157339_10060732 | 104 |
| 513 | 3300012507 | Ga0157342_1047034 | Ga0157342_10470342 | 104 |
| 514 | 3300012508 | Ga0157315_1022617 | Ga0157315_10226172 | 104 |
| 515 | 3300012512 | Ga0157327_1006620 | Ga0157327_10066202 | 104 |
| 516 | 3300012513 | Ga0157326_1002939 | Ga0157326_10029392 | 104 |
| 517 | 3300013100 | Ga0157373_11303407 | Ga0157373_113034071 | 104 |
| 518 | 3300013102 | Ga0157371_10288824 | Ga0157371_102888242 | 104 |
| 519 | 3300013297 | Ga0157378_10049474 | Ga0157378_100494746 | 104 |
| 520 | 3300013306 | Ga0163162_10030120 | Ga0163162_100301206 | 104 |
| 521 | 3300013306 | Ga0163162_10955272 | Ga0163162_109552722 | 104 |
| 522 | 3300013308 | Ga0157375_10434633 | Ga0157375_104346332 | 104 |
| 523 | 3300013308 | Ga0157375_12628648 | Ga0157375_126286482 | 104 |
| 524 | 3300014325 | Ga0163163_12102474 | Ga0163163_121024742 | 104 |
| 525 | 3300014326 | Ga0157380_10032786 | Ga0157380_100327865 | 104 |
| 526 | 3300014326 | Ga0157380_10151915 | Ga0157380_101519152 | 104 |
| 527 | 3300025885 | Ga0207653_10052169 | Ga0207653_100521692 | 104 |
| 528 | 3300025901 | Ga0207688_10059983 | Ga0207688_100599833 | 104 |
| 529 | 3300025904 | Ga0207647_10059863 | Ga0207647_100598634 | 104 |
| 530 | 3300025911 | Ga0207654_10081144 | Ga0207654_100811444 | 104 |
| 531 | 3300025912 | Ga0207707_10026505 | Ga0207707_100265054 | 104 |
| 532 | 3300025912 | Ga0207707_10257706 | Ga0207707_102577062 | 104 |
| 533 | 3300025912 | Ga0207707_10297165 | Ga0207707_102971652 | 104 |
| 534 | 3300025913 | Ga0207695_10167542 | Ga0207695_101675422 | 104 |
| 535 | 3300025917 | Ga0207660_10063690 | Ga0207660_100636904 | 104 |
| 536 | 3300025917 | Ga0207660_10150073 | Ga0207660_101500734 | 104 |
| 537 | 3300025917 | Ga0207660_10385177 | Ga0207660_103851771 | 104 |
| 538 | 3300025918 | Ga0207662_10277031 | Ga0207662_102770312 | 104 |
| 539 | 3300025919 | Ga0207657_10019263 | Ga0207657_100192632 | 104 |
| 540 | 3300025919 | Ga0207657_10192513 | Ga0207657_101925134 | 104 |
| 541 | 3300025921 | Ga0207652_10214732 | Ga0207652_102147324 | 104 |
| 542 | 3300025921 | Ga0207652_10376959 | Ga0207652_103769592 | 104 |
| 543 | 3300025923 | Ga0207681_10032490 | Ga0207681_100324905 | 104 |
| 544 | 3300025926 | Ga0207659_10380189 | Ga0207659_103801891 | 104 |
| 545 | 3300025926 | Ga0207659_10691460 | Ga0207659_106914602 | 104 |
| 546 | 3300025927 | Ga0207687_10122144 | Ga0207687_101221442 | 104 |
| 547 | 3300025932 | Ga0207690_10105670 | Ga0207690_101056703 | 104 |
| 548 | 3300025932 | Ga0207690_10330310 | Ga0207690_103303102 | 104 |
| 549 | 3300025933 | Ga0207706_10034222 | Ga0207706_100342226 | 104 |
| 550 | 3300025933 | Ga0207706_10079135 | Ga0207706_100791354 | 104 |
| 551 | 3300025935 | Ga0207709_10063259 | Ga0207709_100632594 | 104 |
| 552 | 3300025935 | Ga0207709_10692588 | Ga0207709_106925882 | 104 |
| 553 | 3300025936 | Ga0207670_10015675 | Ga0207670_100156756 | 104 |
| 554 | 3300025937 | Ga0207669_11734897 | Ga0207669_117348971 | 104 |
| 555 | 3300025939 | Ga0207665_10388782 | Ga0207665_103887822 | 104 |
| 556 | 3300025941 | Ga0207711_10179951 | Ga0207711_101799512 | 104 |
| 557 | 3300025942 | Ga0207689_10817001 | Ga0207689_108170012 | 104 |
| 558 | 3300025949 | Ga0207667_10395726 | Ga0207667_103957262 | 104 |
| 559 | 3300025981 | Ga0207640_11652805 | Ga0207640_116528052 | 104 |
| 560 | 3300026023 | Ga0207677_10831027 | Ga0207677_108310272 | 104 |
| 561 | 3300026041 | Ga0207639_10163344 | Ga0207639_101633441 | 104 |
| 562 | 3300026067 | Ga0207678_10132449 | Ga0207678_101324493 | 104 |
| 563 | 3300026075 | Ga0207708_10640002 | Ga0207708_106400022 | 104 |
| 564 | 3300026078 | Ga0207702_12183638 | Ga0207702_121836382 | 104 |
| 565 | 3300026089 | Ga0207648_10058329 | Ga0207648_100583294 | 104 |
| 566 | 3300026089 | Ga0207648_10191923 | Ga0207648_101919232 | 104 |
| 567 | 3300026089 | Ga0207648_10917847 | Ga0207648_109178472 | 104 |
| 568 | 3300026095 | Ga0207676_11414042 | Ga0207676_114140421 | 104 |
| 569 | 3300026116 | Ga0207674_10392848 | Ga0207674_103928482 | 104 |
| 570 | 3300026121 | Ga0207683_10211280 | Ga0207683_102112803 | 104 |
| 571 | 3300026142 | Ga0207698_11007605 | Ga0207698_110076051 | 104 |
| 572 | 3300027462 | Ga0210000_1005697 | Ga0210000_10056973 | 104 |
| 573 | 3300027617 | Ga0210002_1029513 | Ga0210002_10295131 | 104 |
| 574 | 3300027907 | Ga0207428_10001078 | Ga0207428_100010786 | 104 |
| 575 | 3300028023 | Ga0265357_1014201 | Ga0265357_10142011 | 104 |
| 576 | 3300028380 | Ga0268265_10043339 | Ga0268265_100433394 | 104 |
| 577 | 3300028380 | Ga0268265_10459476 | Ga0268265_104594762 | 104 |
| 578 | 3300028381 | Ga0268264_10171746 | Ga0268264_101717462 | 104 |
| 579 | 3300028563 | Ga0265319_1161900 | Ga0265319_11619002 | 104 |
| 580 | 3300028577 | Ga0265318_10241875 | Ga0265318_102418752 | 104 |
| 581 | 3300028800 | Ga0265338_10001437 | Ga0265338_1000143743 | 104 |
| 582 | 3300028800 | Ga0265338_10046571 | Ga0265338_100465712 | 104 |
| 583 | 3300028800 | Ga0265338_10134835 | Ga0265338_101348351 | 104 |
| 584 | 3300028800 | Ga0265338_10432325 | Ga0265338_104323251 | 104 |
| 585 | 3300028800 | Ga0265338_11213533 | Ga0265338_112135331 | 104 |
| 586 | 3300031239 | Ga0265328_10349672 | Ga0265328_103496722 | 104 |
| 587 | 3300031240 | Ga0265320_10049948 | Ga0265320_100499483 | 104 |
| 588 | 3300031240 | Ga0265320_10195689 | Ga0265320_101956892 | 104 |
| 589 | 3300031241 | Ga0265325_10000141 | Ga0265325_1000014140 | 104 |
| 590 | 3300031241 | Ga0265325_10017307 | Ga0265325_100173071 | 104 |
| 591 | 3300031241 | Ga0265325_10090524 | Ga0265325_100905242 | 104 |
| 592 | 3300031241 | Ga0265325_10103557 | Ga0265325_101035572 | 104 |
| 593 | 3300031247 | Ga0265340_10020501 | Ga0265340_100205016 | 104 |
| 594 | 3300031247 | Ga0265340_10023384 | Ga0265340_100233846 | 104 |
| 595 | 3300031344 | Ga0265316_10150044 | Ga0265316_101500444 | 104 |
| 596 | 3300031595 | Ga0265313_10001334 | Ga0265313_100013345 | 104 |
| 597 | 3300034816 | Ga0373930_0000071 | Ga0373930_0000071_5742_6056 | 104 |
| 598 | 3300034817 | Ga0373948_0050210 | Ga0373948_0050210_554_868 | 104 |
| 599 | 3300034819 | Ga0373958_0000121 | Ga0373958_0000121_5225_5539 | 104 |
| 600 | 3300034819 | Ga0373958_0035341 | Ga0373958_0035341_600_971 | 104 |
| 601 | 3300034820 | Ga0373959_0001747 | Ga0373959_0001747_106_420 | 104 |
| 602 | 3300034957 | Ga0373938_0000045 | Ga0373938_0000045_6382_6696 | 104 |
| 603 | 3300035084 | Ga0373928_0002038 | Ga0373928_0002038_76_390 | 104 |
| 604 | 3300035086 | Ga0373934_0013386 | Ga0373934_0013386_1586_1939 | 104 |
| 605 | 3300035088 | Ga0373940_0001266 | Ga0373940_0001266_4142_4456 | 104 |
| 606 | 3300035088 | Ga0373940_0245464 | Ga0373940_0245464_76_447 | 104 |
| 607 | 3300035090 | Ga0373949_0002879 | Ga0373949_0002879_3546_3860 | 104 |
| 608 | 3300035091 | Ga0373951_0003036 | Ga0373951_0003036_1741_2055 | 104 |
| 609 | 3300035092 | Ga0373952_0000221 | Ga0373952_0000221_2412_2726 | 104 |
| 610 | 3300035111 | Ga0373923_0049783 | Ga0373923_0049783_321_644 | 104 |
| 611 | 3300035112 | Ga0373932_0001518 | Ga0373932_0001518_5061_5375 | 104 |
| 612 | 3300035113 | Ga0373936_0353974 | Ga0373936_0353974_137_460 | 104 |
| 613 | 3300035114 | Ga0373939_0000875 | Ga0373939_0000875_5396_5710 | 104 |
| 614 | 3300035114 | Ga0373939_0152634 | Ga0373939_0152634_218_589 | 104 |
| 615 | 3300035115 | Ga0373941_0013562 | Ga0373941_0013562_1076_1390 | 104 |
| 616 | 3300035117 | Ga0373953_0410792 | Ga0373953_0410792_68_391 | 104 |
| 617 | 3300035118 | Ga0373954_0025923 | Ga0373954_0025923_1410_1733 | 104 |
| 618 | 3300035119 | Ga0373956_0004403 | Ga0373956_0004403_968_1291 | 104 |
| 619 | 3300035120 | Ga0373957_0003558 | Ga0373957_0003558_3403_3726 | 104 |
| 620 | 3300035121 | Ga0373960_0000083 | Ga0373960_0000083_9993_10307 | 104 |
| 621 | 3300035172 | Ga0373955_0003642 | Ga0373955_0003642_2109_2432 | 104 |
| 622 | 3300035207 | Ga0373942_0000535 | Ga0373942_0000535_5294_5608 | 104 |
| 623 | 3300035241 | Ga0373961_0001186 | Ga0373961_0001186_1118_1432 | 104 |
| 624 | 3300035242 | Ga0373962_0002152 | Ga0373962_0002152_2706_3020 | 104 |
| 625 | 3300035242 | Ga0373962_0165427 | Ga0373962_0165427_350_721 | 104 |
| 626 | 3300035410 | Ga0373924_0015278 | Ga0373924_0015278_1070_1423 | 104 |
| 627 | 3300035691 | Ga0373931_0007820 | Ga0373931_0007820_2988_3302 | 104 |
| 628 | 3300035691 | Ga0373931_0120639 | Ga0373931_0120639_372_743 | 104 |
| 629 | 3300035692 | Ga0373935_1360989 | Ga0373935_1360989_104_427 | 104 |
| 630 | 3300035724 | Ga0373933_0002265 | Ga0373933_0002265_10039_10362 | 104 |
| 631 | 3300036401 | Ga0373937_0004474 | Ga0373937_0004474_9922_10245 | 104 |
| 632 | 3300042435 | Ga0439434_0096394 | Ga0439434_0096394_263_622 | 104 |
| 633 | 3300042439 | Ga0439464_0020384 | Ga0439464_0020384_389_703 | 104 |
| 634 | 3300042876 | Ga0451577_0166584 | Ga0451577_0166584_30_344 | 104 |
| 635 | 3300042993 | Ga0439440_0139293 | Ga0439440_0139293_92_406 | 104 |
| 636 | 3300044712 | Ga0453684_2383803 | Ga0453684_2383803_109_423 | 104 |
| 637 | 3300045051 | Ga0451576_0004698 | Ga0451576_0004698_9614_9928 | 104 |
| 638 | 3300046454 | Ga0495592_0200286 | Ga0495592_0200286_430_783 | 104 |
| 639 | 3300046462 | Ga0495651_0076768 | Ga0495651_0076768_1364_1717 | 104 |
| 640 | 3300046463 | Ga0495653_0244568 | Ga0495653_0244568_856_1179 | 104 |
| 641 | 3300046511 | Ga0495608_0073810 | Ga0495608_0073810_300_623 | 104 |
| 642 | 3300046536 | Ga0495587_0096875 | Ga0495587_0096875_1121_1444 | 104 |
| 643 | 3300046559 | Ga0495667_0006860 | Ga0495667_0006860_5829_6182 | 104 |
| 644 | 3300046615 | Ga0495656_0074087 | Ga0495656_0074087_38_361 | 104 |
| 645 | 3300046663 | Ga0495635_0100594 | Ga0495635_0100594_1265_1618 | 104 |
| 646 | 3300046675 | Ga0495657_0077155 | Ga0495657_0077155_1562_1885 | 104 |
| 647 | 3300046809 | Ga0495600_0030521 | Ga0495600_0030521_441_794 | 104 |
| 648 | 3300047317 | Ga0495604_0008733 | Ga0495604_0008733_5734_6057 | 104 |
| 649 | 3300047322 | Ga0495680_0388539 | Ga0495680_0388539_479_802 | 104 |
| 650 | 3300048088 | Ga0495602_0082549 | Ga0495602_0082549_441_764 | 104 |
| 651 | 3300048905 | Ga0496102_0045426 | Ga0496102_0045426_799_1170 | 104 |
| 652 | 3300048905 | Ga0496102_0071286 | Ga0496102_0071286_1913_2227 | 104 |
| 653 | 3300048905 | Ga0496102_0083438 | Ga0496102_0083438_2053_2406 | 104 |
| 654 | 3300048907 | Ga0496104_0268074 | Ga0496104_0268074_1167_1538 | 104 |
| 655 | 3300048908 | Ga0496105_0888766 | Ga0496105_0888766_251_622 | 104 |
| 656 | 3300048909 | Ga0496106_0024535 | Ga0496106_0024535_2631_3002 | 104 |
| 657 | 3300048909 | Ga0496106_0148887 | Ga0496106_0148887_1250_1564 | 104 |
| 658 | 3300048910 | Ga0496107_0053534 | Ga0496107_0053534_590_904 | 104 |
| 659 | 3300048910 | Ga0496107_0190043 | Ga0496107_0190043_900_1271 | 104 |
| 660 | 3300048912 | Ga0496109_0520694 | Ga0496109_0520694_195_509 | 104 |
| 661 | 3300048915 | Ga0496112_0251754 | Ga0496112_0251754_122_436 | 104 |
| 662 | 3300048918 | Ga0496115_0053154 | Ga0496115_0053154_1618_1989 | 104 |
| 663 | 3300049570 | Ga0501033_0027386 | Ga0501033_0027386_3191_3517 | 104 |
| 664 | 3300049586 | Ga0501070_0643167 | Ga0501070_0643167_318_644 | 104 |
| 665 | 3300049823 | Ga0501044_1361288 | Ga0501044_1361288_152_478 | 104 |
| 666 | 3300050511 | nmdc:mga08y16_2548_c1 | nmdc:mga08y16_2548_c1_3546_3860 | 104 |
| 667 | 3300050515 | nmdc:mga0a205_161153_c1 | nmdc:mga0a205_161153_c1_1211_1525 | 104 |
| 668 | 3300053077 | Ga0495601_0001346 | Ga0495601_0001346_1865_2218 | 104 |
| 669 | 3300053078 | Ga0495612_0057435 | Ga0495612_0057435_226_579 | 104 |
| 670 | 3300053084 | Ga0495595_0022830 | Ga0495595_0022830_1637_1960 | 104 |
| 671 | 3300053085 | Ga0495619_0257819 | Ga0495619_0257819_841_1164 | 104 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2bbe-assembly1.cif.gz_A | crystal structure of protein so0527 from shewanella oneidensis | 0.9144 | 2 | 89 |
| 4dpo-assembly1.cif.gz_B | crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 | 0.9056 | 2 | 89 |
| 1y0h-assembly1.cif.gz_B | structure of rv0793 from mycobacterium tuberculosis | 0.8951 | 2 | 96 |
| 4zos-assembly1.cif.gz_C | 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] | 0.8894 | 2 | 94 |
| 3bm7-assembly1.cif.gz_A-2 | crystal structure of a putative antibiotic biosynthesis monooxygenase (cc_2132) from caulobacter crescentus cb15 at 1.35 a resolution | 0.8826 | 2 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54J03_9_103_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9339 | 2 | 91 | 3.30.70.100 |
| af_A0A1D8PRM8_52_147_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9332 | 2 | 91 | 3.30.70.100 |
| 2bbeA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9144 | 2 | 89 | 3.30.70.100 |
| af_O06569_1_91_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8983 | 1 | 89 | 3.30.70.100 |
| 1y0hB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8951 | 2 | 96 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5U8W9-F1-model_v4 | CENP-V/GFA domain-containing protein | 0.9716 | 2 | 97 |
GO:0016846
GO:0046872 |
| AF-A0A2N9LVH3-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9702 | 2 | 99 |
GO:0004497
|
| AF-A0A521TH10-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9693 | 1 | 99 |
GO:0004497
|
| AF-A0A521ZBV9-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.963 | 1 | 100 |
GO:0004497
|
| AF-A0A5D0VCS5-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9607 | 1 | 96 |
GO:0004497
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar