F474145
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 671 | 273 | 665 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10044037|Ga0081455_100440373 |
| Length | 334 |
| Sequence | MSPACSASSIVPSSNNSEAELRLRERLSRLRRLRLLGGARLSGELERLQKQIDRITTEEPSDEEIWRSVEAARNEDRPYVLDYAERMLDEFVELHGDRARAEDPALIAGLGRFRGRTVGFMGTQKGRDIKERTKRNFGMTHPEGYRKAMRVMEIAERHRFPVISLIDTPGAYPGVAAEQHGQGGAIARSQALMARLSVPIVACVIGEGSSGGAVAIGLADRVLMQENAIYVVISPEGCAAILWRDAGEREKAAAAFRPDAVHCLELGIIDAIVPEPEGGAHTDYDAAAQLLATSLEASLSELEGVAGADLRRRRRDRYRALGVFADVVAEPQRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 2 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 3 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 4 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 5 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 6 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 140 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 145 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 147 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 156 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 163 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 164 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 174 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 175 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 176 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 177 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 178 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 179 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 180 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 181 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 182 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 183 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 214 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 219 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 222 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 250 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 256 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 257 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 259 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 271 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 272 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.11 |
| Metatranscriptomes | 0 |
| Isolates | 0.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0.15 |
| Rhizoplane | 6.71 |
| Rhizosphere | 91.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10000027 | 3300003373 | Bacteria | 15777 |
| 2 | Ga0065715_10094516 | 3300005293 | Bacteria | 4316 |
| 3 | Ga0070676_10014751 | 3300005328 | Bacteria | 4298 |
| 4 | Ga0070683_100374438 | 3300005329 | Bacteria | 1357 |
| 5 | Ga0070677_10020873 | 3300005333 | Bacteria | 2394 |
| 6 | Ga0068869_100002403 | 3300005334 | Bacteria | 11278 |
| 7 | Ga0070680_100026714 | 3300005336 | Bacteria | 4617 |
| 8 | Ga0070682_100009960 | 3300005337 | Bacteria | 5384 |
| 9 | Ga0070691_10010514 | 3300005341 | Bacteria | 4224 |
| 10 | Ga0070691_10030710 | 3300005341 | Bacteria | 2517 |
| 11 | Ga0070692_10013875 | 3300005345 | Bacteria | 3766 |
| 12 | Ga0070668_100018405 | 3300005347 | Bacteria | 5244 |
| 13 | Ga0070668_100083964 | 3300005347 | Bacteria | 2501 |
| 14 | Ga0070668_100120331 | 3300005347 | Bacteria | 2098 |
| 15 | Ga0070675_100238574 | 3300005354 | Bacteria | 1588 |
| 16 | Ga0070674_100000417 | 3300005356 | Bacteria | 21451 |
| 17 | Ga0070673_100060821 | 3300005364 | Bacteria | 2994 |
| 18 | Ga0070667_100032929 | 3300005367 | Bacteria | 4326 |
| 19 | Ga0070703_10000141 | 3300005406 | Bacteria | 37278 |
| 20 | Ga0070714_100057012 | 3300005435 | Bacteria | 3342 |
| 21 | Ga0070714_100103320 | 3300005435 | Bacteria | 2514 |
| 22 | Ga0070713_100079611 | 3300005436 | Bacteria | 2792 |
| 23 | Ga0070713_100105297 | 3300005436 | Bacteria | 2450 |
| 24 | Ga0070711_100000044 | 3300005439 | Bacteria | 83348 |
| 25 | Ga0070711_100004065 | 3300005439 | Bacteria | 8600 |
| 26 | Ga0070711_100033054 | 3300005439 | Bacteria | 3443 |
| 27 | Ga0070711_100130012 | 3300005439 | Bacteria | 1874 |
| 28 | Ga0070705_100007260 | 3300005440 | Bacteria | 5450 |
| 29 | Ga0070705_100017079 | 3300005440 | Bacteria | 3782 |
| 30 | Ga0070705_100027588 | 3300005440 | Bacteria | 3102 |
| 31 | Ga0070705_100043698 | 3300005440 | Bacteria | 2570 |
| 32 | Ga0070700_100036797 | 3300005441 | Bacteria | 2971 |
| 33 | Ga0070700_100091987 | 3300005441 | Bacteria | 1981 |
| 34 | Ga0070700_100418527 | 3300005441 | Bacteria | 1012 |
| 35 | Ga0070694_100000349 | 3300005444 | Bacteria | 24772 |
| 36 | Ga0070694_100006398 | 3300005444 | Bacteria | 7144 |
| 37 | Ga0070694_100012643 | 3300005444 | Bacteria | 5255 |
| 38 | Ga0070694_100045824 | 3300005444 | Bacteria | 2933 |
| 39 | Ga0070694_100046819 | 3300005444 | Bacteria | 2906 |
| 40 | Ga0070694_100077997 | 3300005444 | Bacteria | 2296 |
| 41 | Ga0070708_100008655 | 3300005445 | Bacteria | 8177 |
| 42 | Ga0070708_100011209 | 3300005445 | Bacteria | 7290 |
| 43 | Ga0070708_100018920 | 3300005445 | Bacteria | 5772 |
| 44 | Ga0070708_100109329 | 3300005445 | Bacteria | 2540 |
| 45 | Ga0070708_100386147 | 3300005445 | Bacteria | 1320 |
| 46 | Ga0070708_100443364 | 3300005445 | Bacteria | 1225 |
| 47 | Ga0070678_100000172 | 3300005456 | Bacteria | 27651 |
| 48 | Ga0070662_100000235 | 3300005457 | Bacteria | 32681 |
| 49 | Ga0070662_100112474 | 3300005457 | Bacteria | 2076 |
| 50 | Ga0070681_10023981 | 3300005458 | Bacteria | 6142 |
| 51 | Ga0070681_10067510 | 3300005458 | Bacteria | 3544 |
| 52 | Ga0070681_10084845 | 3300005458 | Bacteria | 3119 |
| 53 | Ga0070681_10355426 | 3300005458 | Bacteria | 1375 |
| 54 | Ga0068867_100000212 | 3300005459 | Bacteria | 38648 |
| 55 | Ga0068867_100061882 | 3300005459 | Bacteria | 2780 |
| 56 | Ga0070706_100001803 | 3300005467 | Bacteria | 22182 |
| 57 | Ga0070706_100007748 | 3300005467 | Bacteria | 10040 |
| 58 | Ga0070706_100020867 | 3300005467 | Bacteria | 6031 |
| 59 | Ga0070706_100032312 | 3300005467 | Bacteria | 4827 |
| 60 | Ga0070706_100040632 | 3300005467 | Bacteria | 4293 |
| 61 | Ga0070706_100059484 | 3300005467 | Bacteria | 3526 |
| 62 | Ga0070706_100068002 | 3300005467 | Bacteria | 3294 |
| 63 | Ga0070706_100119847 | 3300005467 | Bacteria | 2452 |
| 64 | Ga0070706_100141561 | 3300005467 | Bacteria | 2245 |
| 65 | Ga0070706_100211976 | 3300005467 | Bacteria | 1809 |
| 66 | Ga0070706_100331631 | 3300005467 | Bacteria | 1419 |
| 67 | Ga0070707_100001254 | 3300005468 | Bacteria | 24951 |
| 68 | Ga0070707_100006175 | 3300005468 | Bacteria | 11160 |
| 69 | Ga0070707_100019542 | 3300005468 | Bacteria | 6382 |
| 70 | Ga0070707_100070945 | 3300005468 | Bacteria | 3356 |
| 71 | Ga0070707_100101197 | 3300005468 | Bacteria | 2792 |
| 72 | Ga0070707_100132928 | 3300005468 | Bacteria | 2420 |
| 73 | Ga0070707_100324351 | 3300005468 | Bacteria | 1496 |
| 74 | Ga0070698_100000588 | 3300005471 | Bacteria | 39030 |
| 75 | Ga0070698_100001523 | 3300005471 | Bacteria | 25707 |
| 76 | Ga0070698_100022851 | 3300005471 | Bacteria | 6538 |
| 77 | Ga0070698_100034305 | 3300005471 | Bacteria | 5254 |
| 78 | Ga0070698_100062050 | 3300005471 | Bacteria | 3771 |
| 79 | Ga0070698_100128214 | 3300005471 | Bacteria | 2494 |
| 80 | Ga0070698_100257753 | 3300005471 | Bacteria | 1676 |
| 81 | Ga0070698_100372187 | 3300005471 | Bacteria | 1361 |
| 82 | Ga0070699_100003805 | 3300005518 | Bacteria | 13339 |
| 83 | Ga0070699_100023516 | 3300005518 | Bacteria | 5309 |
| 84 | Ga0070699_100040468 | 3300005518 | Bacteria | 4036 |
| 85 | Ga0070699_100045776 | 3300005518 | Bacteria | 3786 |
| 86 | Ga0070699_100070881 | 3300005518 | Bacteria | 3030 |
| 87 | Ga0070699_100075978 | 3300005518 | Bacteria | 2924 |
| 88 | Ga0070699_100083473 | 3300005518 | Bacteria | 2787 |
| 89 | Ga0070699_100108274 | 3300005518 | Bacteria | 2439 |
| 90 | Ga0070699_100113085 | 3300005518 | Bacteria | 2385 |
| 91 | Ga0070699_100119611 | 3300005518 | Bacteria | 2315 |
| 92 | Ga0070699_100149521 | 3300005518 | Bacteria | 2065 |
| 93 | Ga0070684_100031078 | 3300005535 | Bacteria | 4543 |
| 94 | Ga0070684_100424545 | 3300005535 | Bacteria | 1227 |
| 95 | Ga0070697_100006687 | 3300005536 | Bacteria | 8946 |
| 96 | Ga0070697_100020132 | 3300005536 | Bacteria | 5274 |
| 97 | Ga0070697_100031584 | 3300005536 | Bacteria | 4261 |
| 98 | Ga0070697_100038923 | 3300005536 | Bacteria | 3843 |
| 99 | Ga0070697_100086726 | 3300005536 | Bacteria | 2584 |
| 100 | Ga0070697_100142924 | 3300005536 | Bacteria | 2013 |
| 101 | Ga0070697_100351840 | 3300005536 | Bacteria | 1272 |
| 102 | Ga0068853_100131889 | 3300005539 | Bacteria | 2237 |
| 103 | Ga0070672_100045871 | 3300005543 | Bacteria | 3384 |
| 104 | Ga0070672_100068055 | 3300005543 | Bacteria | 2824 |
| 105 | Ga0070672_100305864 | 3300005543 | Bacteria | 1349 |
| 106 | Ga0070686_100016210 | 3300005544 | Bacteria | 4332 |
| 107 | Ga0070686_100071516 | 3300005544 | Bacteria | 2271 |
| 108 | Ga0070695_100000600 | 3300005545 | Bacteria | 19071 |
| 109 | Ga0070695_100002934 | 3300005545 | Bacteria | 9933 |
| 110 | Ga0070695_100017718 | 3300005545 | Bacteria | 4321 |
| 111 | Ga0070695_100027419 | 3300005545 | Bacteria | 3528 |
| 112 | Ga0070695_100046469 | 3300005545 | Bacteria | 2770 |
| 113 | Ga0070695_100083256 | 3300005545 | Bacteria | 2119 |
| 114 | Ga0070695_100083524 | 3300005545 | Bacteria | 2116 |
| 115 | Ga0070695_100195405 | 3300005545 | Bacteria | 1442 |
| 116 | Ga0070696_100000972 | 3300005546 | Bacteria | 18569 |
| 117 | Ga0070696_100001632 | 3300005546 | Bacteria | 14723 |
| 118 | Ga0070696_100004068 | 3300005546 | Bacteria | 9753 |
| 119 | Ga0070696_100005183 | 3300005546 | Bacteria | 8712 |
| 120 | Ga0070696_100006176 | 3300005546 | Bacteria | 8006 |
| 121 | Ga0070696_100013566 | 3300005546 | Bacteria | 5469 |
| 122 | Ga0070696_100028190 | 3300005546 | Bacteria | 3831 |
| 123 | Ga0070696_100044069 | 3300005546 | Bacteria | 3089 |
| 124 | Ga0070696_100235141 | 3300005546 | Bacteria | 1380 |
| 125 | Ga0070696_100272462 | 3300005546 | Bacteria | 1287 |
| 126 | Ga0070693_100019750 | 3300005547 | Bacteria | 3540 |
| 127 | Ga0070693_100180452 | 3300005547 | Bacteria | 1359 |
| 128 | Ga0070704_100003237 | 3300005549 | Bacteria | 9305 |
| 129 | Ga0070704_100006805 | 3300005549 | Bacteria | 6768 |
| 130 | Ga0070704_100007802 | 3300005549 | Bacteria | 6381 |
| 131 | Ga0070704_100079161 | 3300005549 | Bacteria | 2413 |
| 132 | Ga0070704_100108796 | 3300005549 | Bacteria | 2105 |
| 133 | Ga0070704_100133850 | 3300005549 | Bacteria | 1926 |
| 134 | Ga0070704_100181978 | 3300005549 | Bacteria | 1682 |
| 135 | Ga0070704_100220945 | 3300005549 | Bacteria | 1540 |
| 136 | Ga0068855_100265469 | 3300005563 | Bacteria | 1911 |
| 137 | Ga0070664_100100782 | 3300005564 | Bacteria | 2511 |
| 138 | Ga0070664_100318482 | 3300005564 | Bacteria | 1409 |
| 139 | Ga0068854_100000686 | 3300005578 | Bacteria | 20183 |
| 140 | Ga0068856_100012832 | 3300005614 | Bacteria | 8108 |
| 141 | Ga0070702_100022974 | 3300005615 | Bacteria | 3307 |
| 142 | Ga0068859_100076108 | 3300005617 | Bacteria | 3397 |
| 143 | Ga0068864_100007049 | 3300005618 | Bacteria | 9227 |
| 144 | Ga0068866_10000113 | 3300005718 | Bacteria | 35053 |
| 145 | Ga0068870_10013916 | 3300005840 | Bacteria | 3789 |
| 146 | Ga0068863_100138215 | 3300005841 | Bacteria | 2328 |
| 147 | Ga0081455_10003760 | 3300005937 | Bacteria | 17328 |
| 148 | Ga0081455_10007369 | 3300005937 | Bacteria | 11598 |
| 149 | Ga0081455_10013131 | 3300005937 | Bacteria | 8210 |
| 150 | Ga0081455_10018635 | 3300005937 | Bacteria | 6597 |
| 151 | Ga0081455_10024581 | 3300005937 | Bacteria | 5576 |
| 152 | Ga0081455_10044037 | 3300005937 | Bacteria | 3898 |
| 153 | Ga0081455_10151809 | 3300005937 | Bacteria | 1785 |
| 154 | Ga0081538_10000100 | 3300005981 | Bacteria | 83917 |
| 155 | Ga0081538_10000254 | 3300005981 | Bacteria | 60558 |
| 156 | Ga0081538_10000820 | 3300005981 | Bacteria | 33705 |
| 157 | Ga0081538_10003447 | 3300005981 | Bacteria | 14936 |
| 158 | Ga0081538_10028155 | 3300005981 | Bacteria | 3873 |
| 159 | Ga0081538_10047517 | 3300005981 | Bacteria | 2631 |
| 160 | Ga0081538_10097149 | 3300005981 | Bacteria | 1498 |
| 161 | Ga0081540_1019241 | 3300005983 | Bacteria | 4159 |
| 162 | Ga0070717_10038539 | 3300006028 | Bacteria | 3886 |
| 163 | Ga0075365_10055827 | 3300006038 | Bacteria | 2623 |
| 164 | Ga0075364_10035294 | 3300006051 | Bacteria | 3231 |
| 165 | Ga0070716_100011363 | 3300006173 | Bacteria | 4483 |
| 166 | Ga0070712_100411933 | 3300006175 | Bacteria | 1118 |
| 167 | Ga0075362_10055711 | 3300006177 | Bacteria | 1778 |
| 168 | Ga0075427_10002923 | 3300006194 | Bacteria | 2324 |
| 169 | Ga0097621_100008373 | 3300006237 | Bacteria | 7444 |
| 170 | Ga0075428_100000665 | 3300006844 | Bacteria | 35332 |
| 171 | Ga0075428_100017303 | 3300006844 | Bacteria | 7967 |
| 172 | Ga0075428_100105438 | 3300006844 | Bacteria | 3074 |
| 173 | Ga0075430_100129038 | 3300006846 | Bacteria | 2107 |
| 174 | Ga0075431_100029774 | 3300006847 | Bacteria | 5621 |
| 175 | Ga0075433_10000706 | 3300006852 | Bacteria | 22781 |
| 176 | Ga0075433_10012217 | 3300006852 | Bacteria | 6925 |
| 177 | Ga0075433_10014932 | 3300006852 | Bacteria | 6356 |
| 178 | Ga0075433_10022900 | 3300006852 | Bacteria | 5250 |
| 179 | Ga0075434_100000347 | 3300006871 | Bacteria | 33417 |
| 180 | Ga0075434_100019038 | 3300006871 | Bacteria | 6636 |
| 181 | Ga0075434_100035095 | 3300006871 | Bacteria | 4957 |
| 182 | Ga0075434_100042360 | 3300006871 | Bacteria | 4513 |
| 183 | Ga0075434_100225684 | 3300006871 | Bacteria | 1893 |
| 184 | Ga0075429_100124802 | 3300006880 | Bacteria | 2251 |
| 185 | Ga0068865_100010352 | 3300006881 | Bacteria | 5802 |
| 186 | Ga0075436_100001806 | 3300006914 | Bacteria | 14669 |
| 187 | Ga0075436_100005939 | 3300006914 | Bacteria | 8388 |
| 188 | Ga0075436_100041760 | 3300006914 | Bacteria | 3164 |
| 189 | Ga0075436_100058573 | 3300006914 | Bacteria | 2660 |
| 190 | Ga0075436_100082911 | 3300006914 | Bacteria | 2224 |
| 191 | Ga0075436_100194269 | 3300006914 | Bacteria | 1436 |
| 192 | Ga0097620_100076106 | 3300006931 | Bacteria | 3397 |
| 193 | Ga0075435_100000602 | 3300007076 | Bacteria | 21989 |
| 194 | Ga0075435_100014992 | 3300007076 | Bacteria | 5815 |
| 195 | Ga0075435_100130234 | 3300007076 | Bacteria | 2105 |
| 196 | Ga0075435_100209426 | 3300007076 | Bacteria | 1653 |
| 197 | Ga0075435_100212056 | 3300007076 | Bacteria | 1643 |
| 198 | Ga0075435_100334957 | 3300007076 | Bacteria | 1296 |
| 199 | Ga0099794_10000323 | 3300007265 | Bacteria | 16423 |
| 200 | Ga0105240_10011885 | 3300009093 | Bacteria | 12079 |
| 201 | Ga0111539_10110770 | 3300009094 | Bacteria | 3221 |
| 202 | Ga0111539_10372183 | 3300009094 | Bacteria | 1663 |
| 203 | Ga0111539_10439859 | 3300009094 | Bacteria | 1518 |
| 204 | Ga0105245_10052342 | 3300009098 | Bacteria | 3662 |
| 205 | Ga0105245_10066779 | 3300009098 | Bacteria | 3256 |
| 206 | Ga0114129_10000136 | 3300009147 | Bacteria | 76070 |
| 207 | Ga0114129_10006218 | 3300009147 | Bacteria | 16932 |
| 208 | Ga0114129_10027635 | 3300009147 | Bacteria | 8034 |
| 209 | Ga0114129_10097432 | 3300009147 | Bacteria | 4072 |
| 210 | Ga0114129_10099546 | 3300009147 | Bacteria | 4024 |
| 211 | Ga0114129_10195879 | 3300009147 | Bacteria | 2740 |
| 212 | Ga0114129_10338893 | 3300009147 | Bacteria | 1995 |
| 213 | Ga0114129_10367375 | 3300009147 | Bacteria | 1903 |
| 214 | Ga0114129_10432492 | 3300009147 | Bacteria | 1729 |
| 215 | Ga0114129_10811870 | 3300009147 | Bacteria | 1192 |
| 216 | Ga0105243_10001173 | 3300009148 | Bacteria | 23730 |
| 217 | Ga0105241_10055921 | 3300009174 | Bacteria | 3024 |
| 218 | Ga0105242_10001800 | 3300009176 | Bacteria | 16892 |
| 219 | Ga0105248_10012592 | 3300009177 | Bacteria | 9332 |
| 220 | Ga0105248_10029555 | 3300009177 | Bacteria | 6114 |
| 221 | Ga0105248_10072482 | 3300009177 | Bacteria | 3871 |
| 222 | Ga0105248_10649819 | 3300009177 | Bacteria | 1190 |
| 223 | Ga0105239_10009754 | 3300010375 | Bacteria | 10796 |
| 224 | Ga0105239_10036624 | 3300010375 | Bacteria | 5386 |
| 225 | Ga0105239_10051254 | 3300010375 | Bacteria | 4525 |
| 226 | Ga0157378_10047119 | 3300013297 | Bacteria | 3831 |
| 227 | Ga0163162_10022311 | 3300013306 | Bacteria | 6240 |
| 228 | Ga0163162_10025193 | 3300013306 | Bacteria | 5879 |
| 229 | Ga0157372_10297395 | 3300013307 | Bacteria | 1878 |
| 230 | Ga0157375_10095936 | 3300013308 | Bacteria | 3037 |
| 231 | Ga0157375_10113592 | 3300013308 | Bacteria | 2809 |
| 232 | Ga0163163_10218507 | 3300014325 | Bacteria | 1954 |
| 233 | Ga0157380_10245160 | 3300014326 | Bacteria | 1618 |
| 234 | Ga0157377_10108340 | 3300014745 | Bacteria | 1666 |
| 235 | Ga0157379_10271073 | 3300014968 | Bacteria | 1543 |
| 236 | Ga0207653_10000041 | 3300025885 | Bacteria | 96988 |
| 237 | Ga0207653_10013179 | 3300025885 | Bacteria | 2588 |
| 238 | Ga0207642_10004609 | 3300025899 | Bacteria | 4452 |
| 239 | Ga0207642_10156259 | 3300025899 | Bacteria | 1220 |
| 240 | Ga0207688_10012123 | 3300025901 | Bacteria | 4691 |
| 241 | Ga0207699_10272775 | 3300025906 | Bacteria | 1173 |
| 242 | Ga0207699_10275546 | 3300025906 | Bacteria | 1167 |
| 243 | Ga0207645_10001077 | 3300025907 | Bacteria | 22572 |
| 244 | Ga0207684_10000793 | 3300025910 | Bacteria | 36573 |
| 245 | Ga0207684_10013502 | 3300025910 | Bacteria | 7064 |
| 246 | Ga0207684_10024753 | 3300025910 | Bacteria | 5117 |
| 247 | Ga0207684_10026482 | 3300025910 | Bacteria | 4943 |
| 248 | Ga0207684_10126537 | 3300025910 | Bacteria | 2193 |
| 249 | Ga0207684_10212088 | 3300025910 | Bacteria | 1670 |
| 250 | Ga0207654_10034656 | 3300025911 | Bacteria | 2806 |
| 251 | Ga0207707_10001068 | 3300025912 | Bacteria | 26271 |
| 252 | Ga0207693_10045631 | 3300025915 | Bacteria | 3444 |
| 253 | Ga0207663_10000062 | 3300025916 | Bacteria | 53663 |
| 254 | Ga0207660_10027461 | 3300025917 | Bacteria | 3885 |
| 255 | Ga0207660_10135014 | 3300025917 | Bacteria | 1881 |
| 256 | Ga0207660_10226774 | 3300025917 | Bacteria | 1468 |
| 257 | Ga0207646_10002716 | 3300025922 | Bacteria | 20737 |
| 258 | Ga0207646_10002961 | 3300025922 | Bacteria | 19662 |
| 259 | Ga0207646_10031201 | 3300025922 | Bacteria | 4826 |
| 260 | Ga0207646_10073382 | 3300025922 | Bacteria | 3057 |
| 261 | Ga0207646_10091588 | 3300025922 | Bacteria | 2721 |
| 262 | Ga0207646_10173063 | 3300025922 | Bacteria | 1950 |
| 263 | Ga0207646_10340957 | 3300025922 | Bacteria | 1354 |
| 264 | Ga0207681_10038703 | 3300025923 | Bacteria | 3162 |
| 265 | Ga0207659_10244669 | 3300025926 | Bacteria | 1453 |
| 266 | Ga0207687_10017397 | 3300025927 | Bacteria | 4733 |
| 267 | Ga0207664_10062044 | 3300025929 | Bacteria | 2984 |
| 268 | Ga0207664_10463899 | 3300025929 | Bacteria | 1131 |
| 269 | Ga0207706_10000005 | 3300025933 | Bacteria | 224460 |
| 270 | Ga0207686_10000296 | 3300025934 | Bacteria | 36674 |
| 271 | Ga0207709_10003132 | 3300025935 | Bacteria | 9948 |
| 272 | Ga0207669_10006045 | 3300025937 | Bacteria | 5494 |
| 273 | Ga0207704_10010560 | 3300025938 | Bacteria | 4510 |
| 274 | Ga0207665_10018812 | 3300025939 | Bacteria | 4540 |
| 275 | Ga0207691_10057397 | 3300025940 | Bacteria | 3543 |
| 276 | Ga0207691_10084205 | 3300025940 | Bacteria | 2855 |
| 277 | Ga0207711_10003456 | 3300025941 | Bacteria | 13673 |
| 278 | Ga0207711_10012735 | 3300025941 | Bacteria | 6986 |
| 279 | Ga0207711_10120852 | 3300025941 | Bacteria | 2338 |
| 280 | Ga0207711_10265340 | 3300025941 | Bacteria | 1579 |
| 281 | Ga0207689_10029021 | 3300025942 | Bacteria | 4624 |
| 282 | Ga0207661_10273817 | 3300025944 | Bacteria | 1507 |
| 283 | Ga0207679_10008283 | 3300025945 | Bacteria | 6620 |
| 284 | Ga0207679_10108141 | 3300025945 | Bacteria | 2189 |
| 285 | Ga0207651_10137382 | 3300025960 | Bacteria | 1882 |
| 286 | Ga0207712_10073260 | 3300025961 | Bacteria | 2470 |
| 287 | Ga0207668_10085963 | 3300025972 | Bacteria | 2296 |
| 288 | Ga0207640_10001479 | 3300025981 | Bacteria | 12675 |
| 289 | Ga0207708_10036561 | 3300026075 | Bacteria | 3739 |
| 290 | Ga0207708_10076207 | 3300026075 | Bacteria | 2572 |
| 291 | Ga0207708_10146532 | 3300026075 | Bacteria | 1856 |
| 292 | Ga0207702_10032515 | 3300026078 | Bacteria | 4353 |
| 293 | Ga0207648_10000008 | 3300026089 | Bacteria | 208822 |
| 294 | Ga0207648_10431234 | 3300026089 | Bacteria | 1198 |
| 295 | Ga0207676_10010332 | 3300026095 | Bacteria | 6645 |
| 296 | Ga0207676_10029864 | 3300026095 | Bacteria | 4085 |
| 297 | Ga0207676_10167452 | 3300026095 | Bacteria | 1911 |
| 298 | Ga0207675_100059853 | 3300026118 | Bacteria | 3555 |
| 299 | Ga0207683_10004563 | 3300026121 | Bacteria | 11929 |
| 300 | Ga0207683_10025614 | 3300026121 | Bacteria | 5089 |
| 301 | Ga0209588_1000268 | 3300027671 | Bacteria | 13787 |
| 302 | Ga0209588_1001267 | 3300027671 | Bacteria | 6543 |
| 303 | Ga0209974_10025617 | 3300027876 | Bacteria | 1953 |
| 304 | Ga0268265_10149737 | 3300028380 | Bacteria | 1967 |
| 305 | Ga0268264_10108687 | 3300028381 | Bacteria | 2425 |
| 306 | Ga0265319_1016205 | 3300028563 | Bacteria | 2861 |
| 307 | Ga0265334_10010862 | 3300028573 | Bacteria | 3844 |
| 308 | Ga0265318_10007401 | 3300028577 | Bacteria | 4967 |
| 309 | Ga0265318_10018073 | 3300028577 | Bacteria | 2884 |
| 310 | Ga0265338_10023596 | 3300028800 | Bacteria | 6318 |
| 311 | Ga0265338_10032585 | 3300028800 | Bacteria | 5076 |
| 312 | Ga0265338_10089742 | 3300028800 | Bacteria | 2546 |
| 313 | Ga0265338_10112616 | 3300028800 | Bacteria | 2187 |
| 314 | Ga0265330_10071737 | 3300031235 | Bacteria | 1498 |
| 315 | Ga0265332_10030414 | 3300031238 | Bacteria | 2359 |
| 316 | Ga0265320_10059499 | 3300031240 | Bacteria | 1826 |
| 317 | Ga0265325_10015719 | 3300031241 | Bacteria | 4248 |
| 318 | Ga0265325_10018834 | 3300031241 | Bacteria | 3826 |
| 319 | Ga0265339_10028296 | 3300031249 | Bacteria | 3188 |
| 320 | Ga0265331_10078640 | 3300031250 | Bacteria | 1535 |
| 321 | Ga0265316_10020319 | 3300031344 | Bacteria | 5656 |
| 322 | Ga0265316_10069709 | 3300031344 | Bacteria | 2713 |
| 323 | Ga0307408_100016355 | 3300031548 | Bacteria | 4950 |
| 324 | Ga0307408_100018440 | 3300031548 | Bacteria | 4685 |
| 325 | Ga0307408_100156041 | 3300031548 | Bacteria | 1807 |
| 326 | Ga0265313_10016232 | 3300031595 | Bacteria | 4290 |
| 327 | Ga0265314_10003427 | 3300031711 | Bacteria | 15325 |
| 328 | Ga0265314_10005023 | 3300031711 | Bacteria | 12056 |
| 329 | Ga0265342_10094937 | 3300031712 | Bacteria | 1705 |
| 330 | Ga0307405_10007690 | 3300031731 | Bacteria | 5415 |
| 331 | Ga0307405_10039216 | 3300031731 | Bacteria | 2861 |
| 332 | Ga0307405_10100001 | 3300031731 | Bacteria | 1942 |
| 333 | Ga0307405_10436902 | 3300031731 | Bacteria | 1034 |
| 334 | Ga0307413_10015828 | 3300031824 | Bacteria | 3876 |
| 335 | Ga0307413_10035103 | 3300031824 | Bacteria | 2873 |
| 336 | Ga0307413_10041247 | 3300031824 | Bacteria | 2701 |
| 337 | Ga0307413_10069269 | 3300031824 | Bacteria | 2213 |
| 338 | Ga0307413_10094898 | 3300031824 | Bacteria | 1954 |
| 339 | Ga0307413_10250429 | 3300031824 | Bacteria | 1314 |
| 340 | Ga0307410_10007011 | 3300031852 | Bacteria | 6133 |
| 341 | Ga0307410_10007617 | 3300031852 | Bacteria | 5940 |
| 342 | Ga0307410_10013448 | 3300031852 | Bacteria | 4776 |
| 343 | Ga0307410_10031649 | 3300031852 | Bacteria | 3398 |
| 344 | Ga0307410_10088699 | 3300031852 | Bacteria | 2190 |
| 345 | Ga0307410_10110452 | 3300031852 | Bacteria | 1989 |
| 346 | Ga0307410_10163937 | 3300031852 | Bacteria | 1668 |
| 347 | Ga0307410_10190103 | 3300031852 | Bacteria | 1561 |
| 348 | Ga0307410_10252913 | 3300031852 | Bacteria | 1370 |
| 349 | Ga0307406_10022882 | 3300031901 | Bacteria | 3712 |
| 350 | Ga0307406_10035430 | 3300031901 | Bacteria | 3069 |
| 351 | Ga0307406_10157951 | 3300031901 | Bacteria | 1626 |
| 352 | Ga0307407_10007755 | 3300031903 | Bacteria | 4882 |
| 353 | Ga0307407_10026801 | 3300031903 | Bacteria | 3057 |
| 354 | Ga0307407_10094016 | 3300031903 | Bacteria | 1844 |
| 355 | Ga0307407_10151633 | 3300031903 | Bacteria | 1507 |
| 356 | Ga0307412_10210619 | 3300031911 | Bacteria | 1483 |
| 357 | Ga0307412_10362911 | 3300031911 | Bacteria | 1167 |
| 358 | Ga0307409_100004334 | 3300031995 | Bacteria | 7950 |
| 359 | Ga0307409_100009550 | 3300031995 | Bacteria | 5969 |
| 360 | Ga0307409_100031270 | 3300031995 | Bacteria | 3839 |
| 361 | Ga0307409_100087698 | 3300031995 | Bacteria | 2537 |
| 362 | Ga0307409_100182486 | 3300031995 | Bacteria | 1859 |
| 363 | Ga0307416_100002674 | 3300032002 | Bacteria | 10315 |
| 364 | Ga0307416_100025550 | 3300032002 | Bacteria | 4331 |
| 365 | Ga0307416_100033095 | 3300032002 | Bacteria | 3915 |
| 366 | Ga0307416_100034472 | 3300032002 | Bacteria | 3852 |
| 367 | Ga0307416_100044149 | 3300032002 | Bacteria | 3496 |
| 368 | Ga0307416_100085498 | 3300032002 | Bacteria | 2685 |
| 369 | Ga0307416_100111500 | 3300032002 | Bacteria | 2412 |
| 370 | Ga0307416_100175913 | 3300032002 | Bacteria | 1999 |
| 371 | Ga0307414_10013612 | 3300032004 | Bacteria | 4849 |
| 372 | Ga0307411_10000165 | 3300032005 | Bacteria | 21279 |
| 373 | Ga0307411_10019490 | 3300032005 | Bacteria | 3919 |
| 374 | Ga0307411_10022105 | 3300032005 | Bacteria | 3738 |
| 375 | Ga0307411_10050621 | 3300032005 | Bacteria | 2706 |
| 376 | Ga0307411_10067047 | 3300032005 | Bacteria | 2413 |
| 377 | Ga0307411_10101767 | 3300032005 | Bacteria | 2034 |
| 378 | Ga0307415_100052153 | 3300032126 | Bacteria | 2780 |
| 379 | Ga0307415_100063121 | 3300032126 | Bacteria | 2573 |
| 380 | Ga0307415_100066282 | 3300032126 | Bacteria | 2519 |
| 381 | Ga0307415_100109660 | 3300032126 | Bacteria | 2045 |
| 382 | Ga0307415_100110883 | 3300032126 | Bacteria | 2035 |
| 383 | Ga0307415_100179108 | 3300032126 | Bacteria | 1661 |
| 384 | Ga0373929_0004520 | 3300035085 | Bacteria | 2491 |
| 385 | Ga0373929_0013107 | 3300035085 | Bacteria | 1585 |
| 386 | Ga0373944_0060966 | 3300035089 | Bacteria | 1210 |
| 387 | Ga0373943_0097795 | 3300035170 | Bacteria | 1530 |
| 388 | Ga0373942_0024581 | 3300035207 | Bacteria | 1546 |
| 389 | Ga0373931_0011780 | 3300035691 | Bacteria | 4228 |
| 390 | Ga0373931_0042199 | 3300035691 | Bacteria | 2398 |
| 391 | Ga0395899_0002355 | 3300037312 | Bacteria | 15381 |
| 392 | Ga0395899_0002472 | 3300037312 | Bacteria | 15001 |
| 393 | Ga0395899_0003130 | 3300037312 | Bacteria | 13165 |
| 394 | Ga0395899_0017971 | 3300037312 | Bacteria | 5381 |
| 395 | Ga0395899_0033324 | 3300037312 | Bacteria | 3868 |
| 396 | Ga0395899_0046431 | 3300037312 | Bacteria | 3235 |
| 397 | Ga0395899_0104152 | 3300037312 | Bacteria | 2045 |
| 398 | Ga0395900_0001207 | 3300037418 | Bacteria | 31970 |
| 399 | Ga0395900_0005728 | 3300037418 | Bacteria | 12986 |
| 400 | Ga0395900_0008323 | 3300037418 | Bacteria | 10679 |
| 401 | Ga0395900_0008866 | 3300037418 | Bacteria | 10326 |
| 402 | Ga0395900_0014115 | 3300037418 | Bacteria | 8156 |
| 403 | Ga0395900_0019538 | 3300037418 | Bacteria | 6907 |
| 404 | Ga0395900_0091480 | 3300037418 | Bacteria | 3126 |
| 405 | Ga0395900_0288436 | 3300037418 | Bacteria | 1631 |
| 406 | Ga0395898_0001088 | 3300037466 | Bacteria | 41937 |
| 407 | Ga0395898_0002790 | 3300037466 | Bacteria | 20063 |
| 408 | Ga0395898_0030677 | 3300037466 | Bacteria | 5378 |
| 409 | Ga0395898_0059624 | 3300037466 | Bacteria | 3711 |
| 410 | Ga0395898_0089295 | 3300037466 | Bacteria | 2966 |
| 411 | Ga0395898_0177530 | 3300037466 | Bacteria | 2035 |
| 412 | Ga0395898_0326498 | 3300037466 | Bacteria | 1463 |
| 413 | Ga0395898_0346201 | 3300037466 | Bacteria | 1417 |
| 414 | Ga0395905_0001822 | 3300037471 | Bacteria | 24643 |
| 415 | Ga0395905_0006196 | 3300037471 | Bacteria | 12067 |
| 416 | Ga0395905_0006969 | 3300037471 | Bacteria | 11299 |
| 417 | Ga0395905_0029039 | 3300037471 | Bacteria | 5212 |
| 418 | Ga0395905_0050644 | 3300037471 | Bacteria | 3890 |
| 419 | Ga0395905_0059109 | 3300037471 | Bacteria | 3584 |
| 420 | Ga0395905_0078430 | 3300037471 | Bacteria | 3095 |
| 421 | Ga0395905_0107477 | 3300037471 | Bacteria | 2619 |
| 422 | Ga0395901_0002069 | 3300038443 | Bacteria | 20589 |
| 423 | Ga0395901_0002285 | 3300038443 | Bacteria | 19538 |
| 424 | Ga0395901_0002719 | 3300038443 | Bacteria | 17817 |
| 425 | Ga0395901_0003479 | 3300038443 | Bacteria | 15862 |
| 426 | Ga0395901_0003728 | 3300038443 | Bacteria | 15354 |
| 427 | Ga0395901_0005005 | 3300038443 | Bacteria | 13379 |
| 428 | Ga0395901_0014839 | 3300038443 | Bacteria | 7915 |
| 429 | Ga0395901_0058399 | 3300038443 | Bacteria | 4012 |
| 430 | Ga0395901_0175559 | 3300038443 | Bacteria | 2247 |
| 431 | Ga0395901_0207187 | 3300038443 | Bacteria | 2053 |
| 432 | Ga0242419_001705 | 3300038698 | Bacteria | 1381 |
| 433 | Ga0439439_0000896 | 3300041406 | Bacteria | 5502 |
| 434 | Ga0439439_0021565 | 3300041406 | Bacteria | 1606 |
| 435 | Ga0439465_0014429 | 3300041413 | Bacteria | 2462 |
| 436 | Ga0450915_000083 | 3300042119 | Bacteria | 2117 |
| 437 | Ga0439446_0026004 | 3300042156 | Bacteria | 1675 |
| 438 | Ga0439459_0031404 | 3300042438 | Bacteria | 1083 |
| 439 | Ga0439464_0061228 | 3300042439 | Bacteria | 1102 |
| 440 | Ga0439460_0067100 | 3300042461 | Bacteria | 1105 |
| 441 | Ga0451577_0003860 | 3300042876 | Bacteria | 16272 |
| 442 | Ga0451577_0060419 | 3300042876 | Bacteria | 3379 |
| 443 | Ga0453683_0030814 | 3300044673 | Bacteria | 3390 |
| 444 | Ga0453683_0076642 | 3300044673 | Bacteria | 2094 |
| 445 | Ga0453683_0088722 | 3300044673 | Bacteria | 1938 |
| 446 | Ga0453683_0093276 | 3300044673 | Bacteria | 1888 |
| 447 | Ga0453683_0171395 | 3300044673 | Bacteria | 1375 |
| 448 | Ga0453683_0235695 | 3300044673 | Bacteria | 1165 |
| 449 | Ga0466960_0101269 | 3300044901 | Bacteria | 1483 |
| 450 | Ga0451576_0003678 | 3300045051 | Bacteria | 20806 |
| 451 | Ga0451576_0072884 | 3300045051 | Bacteria | 3573 |
| 452 | Ga0451576_0119268 | 3300045051 | Bacteria | 2746 |
| 453 | Ga0451576_0631939 | 3300045051 | Bacteria | 1125 |
| 454 | Ga0495603_0101779 | 3300046455 | Bacteria | 1677 |
| 455 | Ga0495603_0299927 | 3300046455 | Bacteria | 923 |
| 456 | Ga0495641_0065865 | 3300046461 | Bacteria | 1630 |
| 457 | Ga0495653_0020848 | 3300046463 | Bacteria | 5311 |
| 458 | Ga0495580_0073505 | 3300046472 | Bacteria | 2387 |
| 459 | Ga0495580_0085505 | 3300046472 | Bacteria | 2197 |
| 460 | Ga0495580_0121205 | 3300046472 | Bacteria | 1816 |
| 461 | Ga0495582_0193722 | 3300046473 | Bacteria | 1160 |
| 462 | Ga0495582_0208948 | 3300046473 | Bacteria | 1115 |
| 463 | Ga0495664_0006645 | 3300046477 | Bacteria | 6394 |
| 464 | Ga0495664_0232983 | 3300046477 | Bacteria | 1114 |
| 465 | Ga0495594_0003060 | 3300046499 | Bacteria | 8668 |
| 466 | Ga0495594_0072165 | 3300046499 | Bacteria | 1920 |
| 467 | Ga0495618_0097660 | 3300046514 | Bacteria | 1879 |
| 468 | Ga0495663_0051593 | 3300046525 | Bacteria | 1275 |
| 469 | Ga0495642_0059764 | 3300046528 | Bacteria | 1580 |
| 470 | Ga0495586_0017256 | 3300046535 | Bacteria | 3837 |
| 471 | Ga0495609_0072691 | 3300046538 | Bacteria | 1510 |
| 472 | Ga0495667_0063199 | 3300046559 | Bacteria | 2424 |
| 473 | Ga0495667_0169027 | 3300046559 | Bacteria | 1405 |
| 474 | Ga0495656_0034550 | 3300046615 | Bacteria | 2071 |
| 475 | Ga0495656_0037957 | 3300046615 | Bacteria | 1993 |
| 476 | Ga0495634_0102558 | 3300046642 | Bacteria | 1848 |
| 477 | Ga0495635_0058923 | 3300046663 | Bacteria | 2641 |
| 478 | Ga0495588_0081524 | 3300046674 | Bacteria | 1689 |
| 479 | Ga0495647_0064385 | 3300046681 | Bacteria | 1454 |
| 480 | Ga0495658_0076016 | 3300046683 | Bacteria | 1962 |
| 481 | Ga0495658_0131014 | 3300046683 | Bacteria | 1526 |
| 482 | Ga0495624_0055018 | 3300046690 | Bacteria | 2508 |
| 483 | Ga0495624_0061727 | 3300046690 | Bacteria | 2347 |
| 484 | Ga0495670_0078913 | 3300046691 | Bacteria | 1675 |
| 485 | Ga0495581_0000299 | 3300047315 | Bacteria | 24150 |
| 486 | Ga0495581_0122015 | 3300047315 | Bacteria | 1517 |
| 487 | Ga0495636_0073089 | 3300047318 | Bacteria | 1467 |
| 488 | Ga0495636_0109473 | 3300047318 | Bacteria | 1215 |
| 489 | Ga0495676_0011923 | 3300047321 | Bacteria | 7842 |
| 490 | Ga0495676_0221676 | 3300047321 | Bacteria | 1303 |
| 491 | Ga0495676_0243184 | 3300047321 | Bacteria | 1231 |
| 492 | Ga0495680_0233616 | 3300047322 | Bacteria | 1308 |
| 493 | Ga0495685_041749 | 3300047447 | Bacteria | 1567 |
| 494 | Ga0495684_0242992 | 3300047471 | Bacteria | 1312 |
| 495 | Ga0496101_0022092 | 3300048904 | Bacteria | 4377 |
| 496 | Ga0496102_0005303 | 3300048905 | Bacteria | 10943 |
| 497 | Ga0496102_0015658 | 3300048905 | Bacteria | 6606 |
| 498 | Ga0496102_0070689 | 3300048905 | Bacteria | 3205 |
| 499 | Ga0496102_0156245 | 3300048905 | Bacteria | 2144 |
| 500 | Ga0496102_0321315 | 3300048905 | Bacteria | 1458 |
| 501 | Ga0496103_0031853 | 3300048906 | Bacteria | 3216 |
| 502 | Ga0496104_0018315 | 3300048907 | Bacteria | 6390 |
| 503 | Ga0496104_0037877 | 3300048907 | Bacteria | 4509 |
| 504 | Ga0496104_0153724 | 3300048907 | Bacteria | 2208 |
| 505 | Ga0496105_0048054 | 3300048908 | Bacteria | 3522 |
| 506 | Ga0496105_0053528 | 3300048908 | Bacteria | 3333 |
| 507 | Ga0496106_0007347 | 3300048909 | Bacteria | 8143 |
| 508 | Ga0496106_0266606 | 3300048909 | Bacteria | 1371 |
| 509 | Ga0496106_0373708 | 3300048909 | Bacteria | 1145 |
| 510 | Ga0496107_0074872 | 3300048910 | Bacteria | 2464 |
| 511 | Ga0496107_0102102 | 3300048910 | Bacteria | 2103 |
| 512 | Ga0496108_0001426 | 3300048911 | Bacteria | 18860 |
| 513 | Ga0496108_0002438 | 3300048911 | Bacteria | 14862 |
| 514 | Ga0496108_0003364 | 3300048911 | Bacteria | 12837 |
| 515 | Ga0496108_0005508 | 3300048911 | Bacteria | 10242 |
| 516 | Ga0496109_0003563 | 3300048912 | Bacteria | 13001 |
| 517 | Ga0496109_0006064 | 3300048912 | Bacteria | 10155 |
| 518 | Ga0496109_0016240 | 3300048912 | Bacteria | 6508 |
| 519 | Ga0496109_0042299 | 3300048912 | Bacteria | 4126 |
| 520 | Ga0496109_0067910 | 3300048912 | Bacteria | 3266 |
| 521 | Ga0496110_0005979 | 3300048913 | Bacteria | 9580 |
| 522 | Ga0496110_0110902 | 3300048913 | Bacteria | 2465 |
| 523 | Ga0496110_0114347 | 3300048913 | Bacteria | 2428 |
| 524 | Ga0496111_0006601 | 3300048914 | Bacteria | 7547 |
| 525 | Ga0496111_0016618 | 3300048914 | Bacteria | 5074 |
| 526 | Ga0496111_0092204 | 3300048914 | Bacteria | 2220 |
| 527 | Ga0496112_0013660 | 3300048915 | Bacteria | 7503 |
| 528 | Ga0496112_0017069 | 3300048915 | Bacteria | 6814 |
| 529 | Ga0496112_0045781 | 3300048915 | Bacteria | 4288 |
| 530 | Ga0496112_0084935 | 3300048915 | Bacteria | 3131 |
| 531 | Ga0496112_0088840 | 3300048915 | Bacteria | 3058 |
| 532 | Ga0496112_0205694 | 3300048915 | Bacteria | 1927 |
| 533 | Ga0496112_0232224 | 3300048915 | Bacteria | 1799 |
| 534 | Ga0496112_0261684 | 3300048915 | Bacteria | 1679 |
| 535 | Ga0496112_0273883 | 3300048915 | Bacteria | 1636 |
| 536 | Ga0496113_0009464 | 3300048916 | Bacteria | 6391 |
| 537 | Ga0496113_0085240 | 3300048916 | Bacteria | 2426 |
| 538 | Ga0496115_0118719 | 3300048918 | Bacteria | 2175 |
| 539 | Ga0496115_0374128 | 3300048918 | Bacteria | 1159 |
| 540 | Ga0501033_0000939 | 3300049570 | Bacteria | 26506 |
| 541 | Ga0501034_0007407 | 3300049571 | Bacteria | 11682 |
| 542 | Ga0501034_0315291 | 3300049571 | Bacteria | 1497 |
| 543 | Ga0501036_0034112 | 3300049572 | Bacteria | 4304 |
| 544 | Ga0501036_0321296 | 3300049572 | Bacteria | 1293 |
| 545 | Ga0501036_0418257 | 3300049572 | Bacteria | 1118 |
| 546 | Ga0501037_0002891 | 3300049573 | Bacteria | 12458 |
| 547 | Ga0501037_0217015 | 3300049573 | Bacteria | 1347 |
| 548 | Ga0501038_0025744 | 3300049574 | Bacteria | 5242 |
| 549 | Ga0501038_0222040 | 3300049574 | Bacteria | 1507 |
| 550 | Ga0501039_0075270 | 3300049575 | Bacteria | 2624 |
| 551 | Ga0501040_0025993 | 3300049576 | Bacteria | 3938 |
| 552 | Ga0501040_0039174 | 3300049576 | Bacteria | 3223 |
| 553 | Ga0501040_0071967 | 3300049576 | Bacteria | 2387 |
| 554 | Ga0501040_0267471 | 3300049576 | Bacteria | 1220 |
| 555 | Ga0501041_0013881 | 3300049577 | Bacteria | 4776 |
| 556 | Ga0501041_0014347 | 3300049577 | Bacteria | 4704 |
| 557 | Ga0501041_0172890 | 3300049577 | Bacteria | 1352 |
| 558 | Ga0501042_0090920 | 3300049578 | Bacteria | 2190 |
| 559 | Ga0501042_0298674 | 3300049578 | Bacteria | 1163 |
| 560 | Ga0501043_0006223 | 3300049579 | Bacteria | 9587 |
| 561 | Ga0501046_0006055 | 3300049580 | Bacteria | 10759 |
| 562 | Ga0501046_0047153 | 3300049580 | Bacteria | 3417 |
| 563 | Ga0501048_0003885 | 3300049582 | Bacteria | 11368 |
| 564 | Ga0501048_0020618 | 3300049582 | Bacteria | 4831 |
| 565 | Ga0501067_0005972 | 3300049583 | Bacteria | 6751 |
| 566 | Ga0501067_0015410 | 3300049583 | Bacteria | 4232 |
| 567 | Ga0501067_0018508 | 3300049583 | Bacteria | 3858 |
| 568 | Ga0501068_0018705 | 3300049584 | Bacteria | 4013 |
| 569 | Ga0501069_0000689 | 3300049585 | Bacteria | 15765 |
| 570 | Ga0501069_0011109 | 3300049585 | Bacteria | 4777 |
| 571 | Ga0501069_0027211 | 3300049585 | Bacteria | 3134 |
| 572 | Ga0501069_0126094 | 3300049585 | Bacteria | 1464 |
| 573 | Ga0501070_0025563 | 3300049586 | Bacteria | 4952 |
| 574 | Ga0501070_0080847 | 3300049586 | Bacteria | 2688 |
| 575 | Ga0501070_0180229 | 3300049586 | Bacteria | 1739 |
| 576 | Ga0501071_0014896 | 3300049587 | Bacteria | 5327 |
| 577 | Ga0501071_0016584 | 3300049587 | Bacteria | 5067 |
| 578 | Ga0501071_0102099 | 3300049587 | Bacteria | 2115 |
| 579 | Ga0501072_0014314 | 3300049588 | Bacteria | 6080 |
| 580 | Ga0501073_0009788 | 3300049589 | Bacteria | 7056 |
| 581 | Ga0501074_0011723 | 3300049590 | Bacteria | 6371 |
| 582 | Ga0501074_0051417 | 3300049590 | Bacteria | 2974 |
| 583 | Ga0501074_0115330 | 3300049590 | Bacteria | 1922 |
| 584 | Ga0501075_0020752 | 3300049591 | Bacteria | 4781 |
| 585 | Ga0501075_0061267 | 3300049591 | Bacteria | 2835 |
| 586 | Ga0501075_0168989 | 3300049591 | Bacteria | 1668 |
| 587 | Ga0501076_0048031 | 3300049592 | Bacteria | 3374 |
| 588 | Ga0501076_0210914 | 3300049592 | Bacteria | 1587 |
| 589 | Ga0501076_0497247 | 3300049592 | Bacteria | 1005 |
| 590 | Ga0501077_0002040 | 3300049593 | Bacteria | 12182 |
| 591 | Ga0501077_0042832 | 3300049593 | Bacteria | 2877 |
| 592 | Ga0501249_000958 | 3300049679 | Bacteria | 6301 |
| 593 | Ga0501225_0021050 | 3300049705 | Bacteria | 1802 |
| 594 | Ga0501079_0001685 | 3300049741 | Bacteria | 15715 |
| 595 | Ga0501079_0281262 | 3300049741 | Bacteria | 1301 |
| 596 | Ga0501080_0005592 | 3300049742 | Bacteria | 11234 |
| 597 | Ga0501080_0055403 | 3300049742 | Bacteria | 3693 |
| 598 | Ga0501080_0066839 | 3300049742 | Bacteria | 3343 |
| 599 | Ga0501080_0096824 | 3300049742 | Bacteria | 2740 |
| 600 | Ga0501080_0409709 | 3300049742 | Bacteria | 1219 |
| 601 | Ga0501081_0003218 | 3300049743 | Bacteria | 10383 |
| 602 | Ga0501081_0039977 | 3300049743 | Bacteria | 3211 |
| 603 | Ga0501081_0049877 | 3300049743 | Bacteria | 2883 |
| 604 | Ga0501081_0059008 | 3300049743 | Bacteria | 2656 |
| 605 | Ga0501081_0253745 | 3300049743 | Bacteria | 1284 |
| 606 | Ga0501083_0028432 | 3300049744 | Bacteria | 3852 |
| 607 | Ga0501272_000438 | 3300049769 | Bacteria | 3631 |
| 608 | Ga0501279_010501 | 3300049775 | Bacteria | 1246 |
| 609 | Ga0501045_0007510 | 3300049824 | Bacteria | 7575 |
| 610 | Ga0501045_0022179 | 3300049824 | Bacteria | 4544 |
| 611 | Ga0501045_0096168 | 3300049824 | Bacteria | 2191 |
| 612 | nmdc:mga00v17_41663_c1 | 3300050491 | Bacteria | 2759 |
| 613 | nmdc:mga0k408_119938_c1 | 3300050493 | Bacteria | 1557 |
| 614 | nmdc:mga05p37_153165_c1 | 3300050507 | Bacteria | 2819 |
| 615 | nmdc:mga05p37_234274_c1 | 3300050507 | Bacteria | 2211 |
| 616 | nmdc:mga05p37_290208_c1 | 3300050507 | Bacteria | 1947 |
| 617 | nmdc:mga05p37_346_c1 | 3300050507 | Bacteria | 49689 |
| 618 | nmdc:mga09592_128973_c1 | 3300050508 | Bacteria | 2175 |
| 619 | nmdc:mga06r32_186783_c1 | 3300050510 | Bacteria | 2059 |
| 620 | nmdc:mga06r32_29280_c1 | 3300050510 | Bacteria | 5159 |
| 621 | nmdc:mga06r32_35029_c1 | 3300050510 | Bacteria | 4736 |
| 622 | nmdc:mga06r32_39210_c1 | 3300050510 | Bacteria | 4494 |
| 623 | nmdc:mga06r32_438408_c1 | 3300050510 | Bacteria | 1286 |
| 624 | nmdc:mga06r32_99960_c1 | 3300050510 | Bacteria | 2846 |
| 625 | nmdc:mga08y16_226181_c1 | 3300050511 | Bacteria | 1936 |
| 626 | nmdc:mga08y16_263625_c1 | 3300050511 | Bacteria | 1779 |
| 627 | nmdc:mga0n895_209700_c1 | 3300050512 | Bacteria | 1979 |
| 628 | nmdc:mga0n895_21069_c1 | 3300050512 | Bacteria | 6092 |
| 629 | nmdc:mga0n895_41530_c1 | 3300050512 | Bacteria | 4473 |
| 630 | nmdc:mga0n895_63514_c1 | 3300050512 | Bacteria | 3652 |
| 631 | nmdc:mga0n895_89912_c1 | 3300050512 | Bacteria | 3072 |
| 632 | nmdc:mga0rr50_116754_c1 | 3300050513 | Bacteria | 2119 |
| 633 | nmdc:mga0rr50_150296_c1 | 3300050513 | Bacteria | 1881 |
| 634 | nmdc:mga0rr50_25993_c1 | 3300050513 | Bacteria | 4078 |
| 635 | nmdc:mga0rr50_39515_c1 | 3300050513 | Bacteria | 3423 |
| 636 | nmdc:mga0rr50_51724_c1 | 3300050513 | Bacteria | 3050 |
| 637 | nmdc:mga0rr50_82695_c1 | 3300050513 | Bacteria | 2481 |
| 638 | nmdc:mga08x19_110862_c1 | 3300050514 | Bacteria | 1830 |
| 639 | nmdc:mga08x19_11207_c1 | 3300050514 | Bacteria | 5396 |
| 640 | nmdc:mga08x19_13590_c1 | 3300050514 | Bacteria | 4924 |
| 641 | nmdc:mga08x19_28733_c1 | 3300050514 | Bacteria | 3485 |
| 642 | nmdc:mga08x19_39131_c1 | 3300050514 | Bacteria | 3014 |
| 643 | nmdc:mga08x19_62328_c1 | 3300050514 | Bacteria | 2418 |
| 644 | nmdc:mga08x19_953_c1 | 3300050514 | Bacteria | 18175 |
| 645 | nmdc:mga0a205_212896_c1 | 3300050515 | Bacteria | 1820 |
| 646 | nmdc:mga0a205_21501_c1 | 3300050515 | Bacteria | 6101 |
| 647 | nmdc:mga0a205_28025_c1 | 3300050515 | Bacteria | 5382 |
| 648 | nmdc:mga0a205_28643_c1 | 3300050515 | Bacteria | 5326 |
| 649 | nmdc:mga0a205_364453_c1 | 3300050515 | Unclassified | 1311 |
| 650 | nmdc:mga0a205_5392_c1 | 3300050515 | Bacteria | 11536 |
| 651 | nmdc:mga0a205_62498_c1 | 3300050515 | Bacteria | 3598 |
| 652 | nmdc:mga0a205_68387_c1 | 3300050515 | Bacteria | 3430 |
| 653 | Ga0495619_0030605 | 3300053085 | Bacteria | 3484 |
| 654 | Ga0501084_0006395 | 3300054114 | Bacteria | 9682 |
| 655 | Ga0501084_0013453 | 3300054114 | Bacteria | 6773 |
| 656 | Ga0501084_0040850 | 3300054114 | Bacteria | 3881 |
| 657 | Ga0501084_0078552 | 3300054114 | Bacteria | 2766 |
| 658 | Ga0590071_003167 | 3300059421 | Bacteria | 4065 |
| 659 | Ga0590071_007530 | 3300059421 | Bacteria | 2577 |
| 660 | Ga0590075_008578 | 3300059424 | Bacteria | 2442 |
| 661 | Ga0501082_0016430 | 3300060353 | Bacteria | 6370 |
| 662 | Ga0501082_0129817 | 3300060353 | Bacteria | 2186 |
| 663 | Ga0530510_0062767 | 3300061734 | Bacteria | 2689 |
| 664 | Ga0530510_0090337 | 3300061734 | Bacteria | 2234 |
| 665 | Ga0530510_0123106 | 3300061734 | Bacteria | 1905 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006847 | Ga0075431_100029774 | Ga0075431_1000297742 | 262 |
| 2 | 3300050510 | nmdc:mga06r32_39210_c1 | nmdc:mga06r32_39210_c1_2841_3797 | 262 |
| 3 | 3300005436 | Ga0070713_100079611 | Ga0070713_1000796113 | 265 |
| 4 | 3300005467 | Ga0070706_100032312 | Ga0070706_1000323121 | 265 |
| 5 | 3300005467 | Ga0070706_100059484 | Ga0070706_1000594841 | 265 |
| 6 | 3300005468 | Ga0070707_100324351 | Ga0070707_1003243512 | 265 |
| 7 | 3300005471 | Ga0070698_100001523 | Ga0070698_10000152313 | 265 |
| 8 | 3300005536 | Ga0070697_100086726 | Ga0070697_1000867262 | 265 |
| 9 | 3300025885 | Ga0207653_10013179 | Ga0207653_100131791 | 265 |
| 10 | 3300025922 | Ga0207646_10091588 | Ga0207646_100915882 | 265 |
| 11 | 3300025922 | Ga0207646_10340957 | Ga0207646_103409572 | 265 |
| 12 | 3300050514 | nmdc:mga08x19_110862_c1 | nmdc:mga08x19_110862_c1_314_1273 | 265 |
| 13 | 3300005440 | Ga0070705_100027588 | Ga0070705_1000275882 | 266 |
| 14 | 3300005545 | Ga0070695_100195405 | Ga0070695_1001954052 | 266 |
| 15 | 3300005445 | Ga0070708_100018920 | Ga0070708_1000189204 | 268 |
| 16 | 3300005467 | Ga0070706_100040632 | Ga0070706_1000406322 | 268 |
| 17 | 3300005471 | Ga0070698_100128214 | Ga0070698_1001282142 | 268 |
| 18 | 3300005518 | Ga0070699_100045776 | Ga0070699_1000457762 | 268 |
| 19 | 3300005546 | Ga0070696_100013566 | Ga0070696_1000135662 | 268 |
| 20 | 3300005549 | Ga0070704_100079161 | Ga0070704_1000791611 | 268 |
| 21 | 3300006173 | Ga0070716_100011363 | Ga0070716_1000113633 | 268 |
| 22 | 3300006871 | Ga0075434_100042360 | Ga0075434_1000423603 | 268 |
| 23 | 3300006914 | Ga0075436_100194269 | Ga0075436_1001942692 | 268 |
| 24 | 3300025910 | Ga0207684_10024753 | Ga0207684_100247534 | 268 |
| 25 | 3300025922 | Ga0207646_10002961 | Ga0207646_100029617 | 268 |
| 26 | 3300025939 | Ga0207665_10018812 | Ga0207665_100188122 | 268 |
| 27 | 3300050512 | nmdc:mga0n895_21069_c1 | nmdc:mga0n895_21069_c1_1199_2158 | 268 |
| 28 | 3300005445 | Ga0070708_100011209 | Ga0070708_1000112094 | 269 |
| 29 | 3300005445 | Ga0070708_100386147 | Ga0070708_1003861472 | 269 |
| 30 | 3300005467 | Ga0070706_100068002 | Ga0070706_1000680022 | 269 |
| 31 | 3300005468 | Ga0070707_100006175 | Ga0070707_1000061756 | 269 |
| 32 | 3300005468 | Ga0070707_100101197 | Ga0070707_1001011972 | 269 |
| 33 | 3300005536 | Ga0070697_100351840 | Ga0070697_1003518402 | 269 |
| 34 | 3300005546 | Ga0070696_100272462 | Ga0070696_1002724621 | 269 |
| 35 | 3300005549 | Ga0070704_100133850 | Ga0070704_1001338501 | 269 |
| 36 | 3300006844 | Ga0075428_100105438 | Ga0075428_1001054382 | 269 |
| 37 | 3300006852 | Ga0075433_10012217 | Ga0075433_100122172 | 269 |
| 38 | 3300006871 | Ga0075434_100019038 | Ga0075434_1000190384 | 269 |
| 39 | 3300007076 | Ga0075435_100014992 | Ga0075435_1000149923 | 269 |
| 40 | 3300009147 | Ga0114129_10000136 | Ga0114129_1000013669 | 269 |
| 41 | 3300009147 | Ga0114129_10027635 | Ga0114129_100276352 | 269 |
| 42 | 3300009147 | Ga0114129_10367375 | Ga0114129_103673752 | 269 |
| 43 | 3300025910 | Ga0207684_10000793 | Ga0207684_100007937 | 269 |
| 44 | 3300025922 | Ga0207646_10002716 | Ga0207646_1000271612 | 269 |
| 45 | 3300025922 | Ga0207646_10173063 | Ga0207646_101730632 | 269 |
| 46 | 3300048909 | Ga0496106_0266606 | Ga0496106_0266606_240_1202 | 269 |
| 47 | 3300050507 | nmdc:mga05p37_153165_c1 | nmdc:mga05p37_153165_c1_461_1420 | 269 |
| 48 | 3300050508 | nmdc:mga09592_128973_c1 | nmdc:mga09592_128973_c1_855_1817 | 269 |
| 49 | 3300050512 | nmdc:mga0n895_63514_c1 | nmdc:mga0n895_63514_c1_1356_2315 | 269 |
| 50 | 3300050513 | nmdc:mga0rr50_51724_c1 | nmdc:mga0rr50_51724_c1_2023_2982 | 269 |
| 51 | 3300050515 | nmdc:mga0a205_28025_c1 | nmdc:mga0a205_28025_c1_75_1034 | 269 |
| 52 | 3300005518 | Ga0070699_100083473 | Ga0070699_1000834731 | 270 |
| 53 | 3300006914 | Ga0075436_100058573 | Ga0075436_1000585732 | 270 |
| 54 | 3300048905 | Ga0496102_0156245 | Ga0496102_0156245_1077_2039 | 270 |
| 55 | 3300050514 | nmdc:mga08x19_13590_c1 | nmdc:mga08x19_13590_c1_191_1150 | 270 |
| 56 | 3300025941 | Ga0207711_10265340 | Ga0207711_102653401 | 272 |
| 57 | 3300006852 | Ga0075433_10000706 | Ga0075433_1000070611 | 274 |
| 58 | 3300006871 | Ga0075434_100000347 | Ga0075434_10000034720 | 274 |
| 59 | 3300009147 | Ga0114129_10432492 | Ga0114129_104324923 | 274 |
| 60 | 3300048915 | Ga0496112_0232224 | Ga0496112_0232224_493_1320 | 274 |
| 61 | 3300050512 | nmdc:mga0n895_41530_c1 | nmdc:mga0n895_41530_c1_280_1230 | 274 |
| 62 | 3300050513 | nmdc:mga0rr50_39515_c1 | nmdc:mga0rr50_39515_c1_1465_2415 | 274 |
| 63 | 3300050515 | nmdc:mga0a205_5392_c1 | nmdc:mga0a205_5392_c1_2674_3624 | 274 |
| 64 | 3300005471 | Ga0070698_100372187 | Ga0070698_1003721872 | 276 |
| 65 | 3300009147 | Ga0114129_10195879 | Ga0114129_101958792 | 276 |
| 66 | 3300028800 | Ga0265338_10023596 | Ga0265338_100235962 | 277 |
| 67 | 3300028800 | Ga0265338_10032585 | Ga0265338_100325854 | 277 |
| 68 | 3300042461 | Ga0439460_0067100 | Ga0439460_0067100_12_854 | 280 |
| 69 | 3300046455 | Ga0495603_0299927 | Ga0495603_0299927_13_882 | 282 |
| 70 | 3300047322 | Ga0495680_0233616 | Ga0495680_0233616_414_1283 | 282 |
| 71 | 3300035170 | Ga0373943_0097795 | Ga0373943_0097795_127_1068 | 284 |
| 72 | 3300047321 | Ga0495676_0221676 | Ga0495676_0221676_69_1010 | 284 |
| 73 | 3300050510 | nmdc:mga06r32_438408_c1 | nmdc:mga06r32_438408_c1_185_1138 | 284 |
| 74 | 3300005445 | Ga0070708_100008655 | Ga0070708_1000086555 | 286 |
| 75 | 3300005467 | Ga0070706_100001803 | Ga0070706_1000018035 | 286 |
| 76 | 3300005468 | Ga0070707_100001254 | Ga0070707_10000125416 | 286 |
| 77 | 3300005518 | Ga0070699_100070881 | Ga0070699_1000708812 | 286 |
| 78 | 3300007265 | Ga0099794_10000323 | Ga0099794_100003232 | 286 |
| 79 | 3300025910 | Ga0207684_10026482 | Ga0207684_100264822 | 286 |
| 80 | 3300027671 | Ga0209588_1001267 | Ga0209588_10012672 | 286 |
| 81 | 3300005467 | Ga0070706_100331631 | Ga0070706_1003316312 | 287 |
| 82 | 3300005549 | Ga0070704_100181978 | Ga0070704_1001819782 | 287 |
| 83 | 3300006914 | Ga0075436_100001806 | Ga0075436_10000180611 | 287 |
| 84 | 3300050513 | nmdc:mga0rr50_150296_c1 | nmdc:mga0rr50_150296_c1_462_1418 | 287 |
| 85 | 3300050514 | nmdc:mga08x19_953_c1 | nmdc:mga08x19_953_c1_6644_7600 | 287 |
| 86 | 3300005439 | Ga0070711_100000044 | Ga0070711_10000004421 | 288 |
| 87 | 3300005444 | Ga0070694_100000349 | Ga0070694_1000003496 | 288 |
| 88 | 3300005545 | Ga0070695_100002934 | Ga0070695_1000029343 | 288 |
| 89 | 3300025916 | Ga0207663_10000062 | Ga0207663_100000628 | 288 |
| 90 | 3300031548 | Ga0307408_100016355 | Ga0307408_1000163553 | 288 |
| 91 | 3300031731 | Ga0307405_10007690 | Ga0307405_100076902 | 288 |
| 92 | 3300031852 | Ga0307410_10163937 | Ga0307410_101639372 | 288 |
| 93 | 3300031852 | Ga0307410_10252913 | Ga0307410_102529131 | 288 |
| 94 | 3300031901 | Ga0307406_10022882 | Ga0307406_100228822 | 288 |
| 95 | 3300031903 | Ga0307407_10094016 | Ga0307407_100940162 | 288 |
| 96 | 3300032005 | Ga0307411_10019490 | Ga0307411_100194902 | 288 |
| 97 | 3300009177 | Ga0105248_10649819 | Ga0105248_106498191 | 290 |
| 98 | 3300005336 | Ga0070680_100026714 | Ga0070680_1000267143 | 291 |
| 99 | 3300005347 | Ga0070668_100018405 | Ga0070668_1000184052 | 291 |
| 100 | 3300005364 | Ga0070673_100060821 | Ga0070673_1000608212 | 291 |
| 101 | 3300005458 | Ga0070681_10355426 | Ga0070681_103554262 | 291 |
| 102 | 3300005543 | Ga0070672_100045871 | Ga0070672_1000458712 | 291 |
| 103 | 3300005841 | Ga0068863_100138215 | Ga0068863_1001382152 | 291 |
| 104 | 3300009177 | Ga0105248_10029555 | Ga0105248_100295556 | 291 |
| 105 | 3300009177 | Ga0105248_10072482 | Ga0105248_100724822 | 291 |
| 106 | 3300013308 | Ga0157375_10095936 | Ga0157375_100959362 | 291 |
| 107 | 3300025912 | Ga0207707_10001068 | Ga0207707_1000106831 | 291 |
| 108 | 3300025940 | Ga0207691_10057397 | Ga0207691_100573973 | 291 |
| 109 | 3300025941 | Ga0207711_10012735 | Ga0207711_100127354 | 291 |
| 110 | 3300025941 | Ga0207711_10120852 | Ga0207711_101208522 | 291 |
| 111 | 3300025960 | Ga0207651_10137382 | Ga0207651_101373822 | 291 |
| 112 | 3300028381 | Ga0268264_10108687 | Ga0268264_101086872 | 291 |
| 113 | 3300046691 | Ga0495670_0078913 | Ga0495670_0078913_412_1377 | 291 |
| 114 | 3300037312 | Ga0395899_0046431 | Ga0395899_0046431_1611_2552 | 293 |
| 115 | 3300037471 | Ga0395905_0006196 | Ga0395905_0006196_10931_11872 | 293 |
| 116 | 3300038443 | Ga0395901_0207187 | Ga0395901_0207187_1045_1986 | 293 |
| 117 | 3300046455 | Ga0495603_0101779 | Ga0495603_0101779_202_1134 | 293 |
| 118 | 3300046461 | Ga0495641_0065865 | Ga0495641_0065865_286_1218 | 293 |
| 119 | 3300046615 | Ga0495656_0037957 | Ga0495656_0037957_950_1906 | 293 |
| 120 | 3300005293 | Ga0065715_10094516 | Ga0065715_100945162 | 294 |
| 121 | 3300005345 | Ga0070692_10013875 | Ga0070692_100138751 | 294 |
| 122 | 3300005440 | Ga0070705_100017079 | Ga0070705_1000170792 | 294 |
| 123 | 3300005441 | Ga0070700_100036797 | Ga0070700_1000367973 | 294 |
| 124 | 3300005444 | Ga0070694_100046819 | Ga0070694_1000468192 | 294 |
| 125 | 3300005457 | Ga0070662_100112474 | Ga0070662_1001124742 | 294 |
| 126 | 3300005518 | Ga0070699_100108274 | Ga0070699_1001082741 | 294 |
| 127 | 3300005544 | Ga0070686_100016210 | Ga0070686_1000162102 | 294 |
| 128 | 3300005545 | Ga0070695_100083256 | Ga0070695_1000832562 | 294 |
| 129 | 3300005546 | Ga0070696_100028190 | Ga0070696_1000281902 | 294 |
| 130 | 3300005549 | Ga0070704_100007802 | Ga0070704_1000078023 | 294 |
| 131 | 3300005617 | Ga0068859_100076108 | Ga0068859_1000761083 | 294 |
| 132 | 3300006871 | Ga0075434_100225684 | Ga0075434_1002256841 | 294 |
| 133 | 3300006931 | Ga0097620_100076106 | Ga0097620_1000761063 | 294 |
| 134 | 3300007076 | Ga0075435_100130234 | Ga0075435_1001302342 | 294 |
| 135 | 3300009147 | Ga0114129_10811870 | Ga0114129_108118702 | 294 |
| 136 | 3300010375 | Ga0105239_10009754 | Ga0105239_1000975410 | 294 |
| 137 | 3300026075 | Ga0207708_10076207 | Ga0207708_100762073 | 294 |
| 138 | 3300031852 | Ga0307410_10088699 | Ga0307410_100886992 | 294 |
| 139 | 3300031903 | Ga0307407_10007755 | Ga0307407_100077552 | 294 |
| 140 | 3300035691 | Ga0373931_0042199 | Ga0373931_0042199_1088_2050 | 294 |
| 141 | 3300041406 | Ga0439439_0021565 | Ga0439439_0021565_259_1227 | 294 |
| 142 | 3300042156 | Ga0439446_0026004 | Ga0439446_0026004_585_1553 | 294 |
| 143 | 3300046477 | Ga0495664_0232983 | Ga0495664_0232983_144_1076 | 294 |
| 144 | 3300046514 | Ga0495618_0097660 | Ga0495618_0097660_871_1803 | 294 |
| 145 | 3300046559 | Ga0495667_0063199 | Ga0495667_0063199_1334_2266 | 294 |
| 146 | 3300046663 | Ga0495635_0058923 | Ga0495635_0058923_1010_1942 | 294 |
| 147 | 3300046690 | Ga0495624_0055018 | Ga0495624_0055018_1489_2421 | 294 |
| 148 | 3300047471 | Ga0495684_0242992 | Ga0495684_0242992_246_1178 | 294 |
| 149 | 3300048904 | Ga0496101_0022092 | Ga0496101_0022092_1820_2782 | 294 |
| 150 | 3300048905 | Ga0496102_0005303 | Ga0496102_0005303_8386_9348 | 294 |
| 151 | 3300048906 | Ga0496103_0031853 | Ga0496103_0031853_464_1426 | 294 |
| 152 | 3300048907 | Ga0496104_0018315 | Ga0496104_0018315_4543_5505 | 294 |
| 153 | 3300048909 | Ga0496106_0007347 | Ga0496106_0007347_2236_3198 | 294 |
| 154 | 3300048910 | Ga0496107_0102102 | Ga0496107_0102102_947_1909 | 294 |
| 155 | 3300048911 | Ga0496108_0003364 | Ga0496108_0003364_722_1684 | 294 |
| 156 | 3300048912 | Ga0496109_0006064 | Ga0496109_0006064_6996_7958 | 294 |
| 157 | 3300048913 | Ga0496110_0110902 | Ga0496110_0110902_726_1688 | 294 |
| 158 | 3300048914 | Ga0496111_0016618 | Ga0496111_0016618_592_1554 | 294 |
| 159 | 3300048915 | Ga0496112_0017069 | Ga0496112_0017069_1562_2524 | 294 |
| 160 | 3300048918 | Ga0496115_0118719 | Ga0496115_0118719_652_1614 | 294 |
| 161 | 3300049585 | Ga0501069_0027211 | Ga0501069_0027211_1707_2672 | 294 |
| 162 | 3300005518 | Ga0070699_100113085 | Ga0070699_1001130852 | 295 |
| 163 | 3300031852 | Ga0307410_10031649 | Ga0307410_100316492 | 295 |
| 164 | 3300032002 | Ga0307416_100175913 | Ga0307416_1001759132 | 295 |
| 165 | 3300044673 | Ga0453683_0093276 | Ga0453683_0093276_716_1678 | 295 |
| 166 | 3300046472 | Ga0495580_0073505 | Ga0495580_0073505_196_1158 | 295 |
| 167 | 3300046674 | Ga0495588_0081524 | Ga0495588_0081524_318_1280 | 295 |
| 168 | 3300005536 | Ga0070697_100038923 | Ga0070697_1000389231 | 297 |
| 169 | 3300005614 | Ga0068856_100012832 | Ga0068856_1000128323 | 297 |
| 170 | 3300026078 | Ga0207702_10032515 | Ga0207702_100325153 | 297 |
| 171 | 3300046463 | Ga0495653_0020848 | Ga0495653_0020848_4248_5183 | 297 |
| 172 | 3300046525 | Ga0495663_0051593 | Ga0495663_0051593_234_1175 | 297 |
| 173 | 3300046559 | Ga0495667_0169027 | Ga0495667_0169027_306_1241 | 297 |
| 174 | 3300047447 | Ga0495685_041749 | Ga0495685_041749_571_1512 | 297 |
| 175 | 3300053085 | Ga0495619_0030605 | Ga0495619_0030605_1278_2213 | 297 |
| 176 | 3300005546 | Ga0070696_100235141 | Ga0070696_1002351412 | 298 |
| 177 | 3300009094 | Ga0111539_10372183 | Ga0111539_103721832 | 298 |
| 178 | 3300014325 | Ga0163163_10218507 | Ga0163163_102185072 | 298 |
| 179 | 3300025899 | Ga0207642_10156259 | Ga0207642_101562592 | 298 |
| 180 | 3300026095 | Ga0207676_10029864 | Ga0207676_100298643 | 298 |
| 181 | 3300035691 | Ga0373931_0011780 | Ga0373931_0011780_2157_3119 | 298 |
| 182 | 3300048907 | Ga0496104_0153724 | Ga0496104_0153724_957_1919 | 298 |
| 183 | 3300048911 | Ga0496108_0001426 | Ga0496108_0001426_16742_17704 | 298 |
| 184 | 3300048912 | Ga0496109_0016240 | Ga0496109_0016240_5489_6451 | 298 |
| 185 | 3300048912 | Ga0496109_0042299 | Ga0496109_0042299_1215_2177 | 298 |
| 186 | 3300048913 | Ga0496110_0114347 | Ga0496110_0114347_975_1937 | 298 |
| 187 | 3300048914 | Ga0496111_0092204 | Ga0496111_0092204_773_1735 | 298 |
| 188 | 3300048915 | Ga0496112_0045781 | Ga0496112_0045781_3272_4234 | 298 |
| 189 | 3300048915 | Ga0496112_0084935 | Ga0496112_0084935_936_1898 | 298 |
| 190 | 3300048916 | Ga0496113_0085240 | Ga0496113_0085240_304_1266 | 298 |
| 191 | 3300050511 | nmdc:mga08y16_263625_c1 | nmdc:mga08y16_263625_c1_131_1093 | 298 |
| 192 | 3300050515 | nmdc:mga0a205_364453_c1 | nmdc:mga0a205_364453_c1_271_1212 | 298 |
| 193 | 3300005444 | Ga0070694_100006398 | Ga0070694_1000063985 | 299 |
| 194 | 3300005545 | Ga0070695_100046469 | Ga0070695_1000464693 | 299 |
| 195 | 3300035085 | Ga0373929_0013107 | Ga0373929_0013107_609_1574 | 299 |
| 196 | 3300035207 | Ga0373942_0024581 | Ga0373942_0024581_189_1154 | 299 |
| 197 | 3300048905 | Ga0496102_0015658 | Ga0496102_0015658_3527_4492 | 299 |
| 198 | 3300006844 | Ga0075428_100017303 | Ga0075428_1000173035 | 300 |
| 199 | 3300044673 | Ga0453683_0030814 | Ga0453683_0030814_934_1896 | 301 |
| 200 | 3300048915 | Ga0496112_0205694 | Ga0496112_0205694_604_1515 | 301 |
| 201 | 3300005445 | Ga0070708_100443364 | Ga0070708_1004433642 | 302 |
| 202 | 3300005467 | Ga0070706_100007748 | Ga0070706_1000077486 | 302 |
| 203 | 3300005471 | Ga0070698_100000588 | Ga0070698_10000058827 | 302 |
| 204 | 3300005471 | Ga0070698_100062050 | Ga0070698_1000620503 | 302 |
| 205 | 3300005471 | Ga0070698_100257753 | Ga0070698_1002577531 | 302 |
| 206 | 3300006914 | Ga0075436_100005939 | Ga0075436_1000059399 | 302 |
| 207 | 3300007076 | Ga0075435_100209426 | Ga0075435_1002094262 | 302 |
| 208 | 3300028563 | Ga0265319_1016205 | Ga0265319_10162054 | 302 |
| 209 | 3300028573 | Ga0265334_10010862 | Ga0265334_100108622 | 302 |
| 210 | 3300028577 | Ga0265318_10007401 | Ga0265318_100074013 | 302 |
| 211 | 3300028800 | Ga0265338_10089742 | Ga0265338_100897422 | 302 |
| 212 | 3300031240 | Ga0265320_10059499 | Ga0265320_100594992 | 302 |
| 213 | 3300031250 | Ga0265331_10078640 | Ga0265331_100786402 | 302 |
| 214 | 3300031344 | Ga0265316_10020319 | Ga0265316_100203193 | 302 |
| 215 | 3300031711 | Ga0265314_10003427 | Ga0265314_1000342719 | 302 |
| 216 | 3300037312 | Ga0395899_0033324 | Ga0395899_0033324_2469_3401 | 302 |
| 217 | 3300037418 | Ga0395900_0001207 | Ga0395900_0001207_3298_4230 | 302 |
| 218 | 3300037418 | Ga0395900_0005728 | Ga0395900_0005728_9646_10578 | 302 |
| 219 | 3300037466 | Ga0395898_0002790 | Ga0395898_0002790_6988_7920 | 302 |
| 220 | 3300037466 | Ga0395898_0346201 | Ga0395898_0346201_434_1366 | 302 |
| 221 | 3300037471 | Ga0395905_0001822 | Ga0395905_0001822_18699_19631 | 302 |
| 222 | 3300037471 | Ga0395905_0059109 | Ga0395905_0059109_83_1015 | 302 |
| 223 | 3300038443 | Ga0395901_0003479 | Ga0395901_0003479_9531_10463 | 302 |
| 224 | 3300038443 | Ga0395901_0003728 | Ga0395901_0003728_1129_2061 | 302 |
| 225 | 3300044673 | Ga0453683_0088722 | Ga0453683_0088722_872_1819 | 302 |
| 226 | 3300044673 | Ga0453683_0171395 | Ga0453683_0171395_277_1224 | 302 |
| 227 | 3300045051 | Ga0451576_0003678 | Ga0451576_0003678_13705_14652 | 302 |
| 228 | 3300046472 | Ga0495580_0121205 | Ga0495580_0121205_792_1739 | 302 |
| 229 | 3300046642 | Ga0495634_0102558 | Ga0495634_0102558_761_1696 | 302 |
| 230 | 3300050513 | nmdc:mga0rr50_116754_c1 | nmdc:mga0rr50_116754_c1_10_957 | 302 |
| 231 | 3300005329 | Ga0070683_100374438 | Ga0070683_1003744381 | 303 |
| 232 | 3300005341 | Ga0070691_10010514 | Ga0070691_100105143 | 303 |
| 233 | 3300005441 | Ga0070700_100418527 | Ga0070700_1004185271 | 303 |
| 234 | 3300005458 | Ga0070681_10067510 | Ga0070681_100675104 | 303 |
| 235 | 3300005535 | Ga0070684_100424545 | Ga0070684_1004245451 | 303 |
| 236 | 3300005547 | Ga0070693_100019750 | Ga0070693_1000197502 | 303 |
| 237 | 3300005937 | Ga0081455_10018635 | Ga0081455_100186355 | 303 |
| 238 | 3300025944 | Ga0207661_10273817 | Ga0207661_102738171 | 303 |
| 239 | 3300026121 | Ga0207683_10025614 | Ga0207683_100256146 | 303 |
| 240 | 3300037312 | Ga0395899_0002472 | Ga0395899_0002472_3310_4251 | 303 |
| 241 | 3300037312 | Ga0395899_0104152 | Ga0395899_0104152_712_1656 | 303 |
| 242 | 3300037418 | Ga0395900_0008323 | Ga0395900_0008323_3908_4849 | 303 |
| 243 | 3300037466 | Ga0395898_0001088 | Ga0395898_0001088_39769_40710 | 303 |
| 244 | 3300037471 | Ga0395905_0050644 | Ga0395905_0050644_1100_2041 | 303 |
| 245 | 3300038443 | Ga0395901_0002285 | Ga0395901_0002285_4363_5304 | 303 |
| 246 | 3300038443 | Ga0395901_0005005 | Ga0395901_0005005_11608_12552 | 303 |
| 247 | 3300048905 | Ga0496102_0070689 | Ga0496102_0070689_1839_2780 | 303 |
| 248 | 3300048908 | Ga0496105_0048054 | Ga0496105_0048054_2523_3464 | 303 |
| 249 | 3300048910 | Ga0496107_0074872 | Ga0496107_0074872_61_1002 | 303 |
| 250 | 3300048911 | Ga0496108_0002438 | Ga0496108_0002438_3884_4825 | 303 |
| 251 | 3300048912 | Ga0496109_0067910 | Ga0496109_0067910_580_1521 | 303 |
| 252 | 3300048915 | Ga0496112_0088840 | Ga0496112_0088840_115_1056 | 303 |
| 253 | 3300048916 | Ga0496113_0009464 | Ga0496113_0009464_14_955 | 303 |
| 254 | 3300049571 | Ga0501034_0315291 | Ga0501034_0315291_486_1424 | 303 |
| 255 | 3300049583 | Ga0501067_0005972 | Ga0501067_0005972_4411_5352 | 303 |
| 256 | 3300049586 | Ga0501070_0180229 | Ga0501070_0180229_70_1011 | 303 |
| 257 | 3300061734 | Ga0530510_0062767 | Ga0530510_0062767_1652_2593 | 303 |
| 258 | 3300005435 | Ga0070714_100103320 | Ga0070714_1001033203 | 304 |
| 259 | 3300006028 | Ga0070717_10038539 | Ga0070717_100385392 | 304 |
| 260 | 3300025929 | Ga0207664_10463899 | Ga0207664_104638991 | 304 |
| 261 | 3300032002 | Ga0307416_100033095 | Ga0307416_1000330955 | 304 |
| 262 | 3300038698 | Ga0242419_001705 | Ga0242419_001705_186_1136 | 304 |
| 263 | iso_pu_bacteria | 2512564013 | 2512639459 | 304 |
| 264 | iso_pu_bacteria | 2857460504 | 2857460689 | 304 |
| 265 | iso_pu_bacteria | 2857465823 | 2857465905 | 304 |
| 266 | iso_pu_bacteria | 2857591370 | 2857593925 | 304 |
| 267 | iso_pu_bacteria | 2915597211 | 2915599916 | 304 |
| 268 | iso_pu_bacteria | 2929183550 | 2929185095 | 304 |
| 269 | 3300005406 | Ga0070703_10000141 | Ga0070703_100001414 | 305 |
| 270 | 3300005440 | Ga0070705_100007260 | Ga0070705_1000072604 | 305 |
| 271 | 3300005444 | Ga0070694_100012643 | Ga0070694_1000126434 | 305 |
| 272 | 3300005444 | Ga0070694_100077997 | Ga0070694_1000779972 | 305 |
| 273 | 3300005445 | Ga0070708_100109329 | Ga0070708_1001093292 | 305 |
| 274 | 3300005467 | Ga0070706_100020867 | Ga0070706_1000208673 | 305 |
| 275 | 3300005467 | Ga0070706_100119847 | Ga0070706_1001198472 | 305 |
| 276 | 3300005467 | Ga0070706_100141561 | Ga0070706_1001415612 | 305 |
| 277 | 3300005468 | Ga0070707_100019542 | Ga0070707_1000195423 | 305 |
| 278 | 3300005468 | Ga0070707_100070945 | Ga0070707_1000709452 | 305 |
| 279 | 3300005468 | Ga0070707_100132928 | Ga0070707_1001329282 | 305 |
| 280 | 3300005471 | Ga0070698_100022851 | Ga0070698_1000228511 | 305 |
| 281 | 3300005518 | Ga0070699_100023516 | Ga0070699_1000235162 | 305 |
| 282 | 3300005518 | Ga0070699_100075978 | Ga0070699_1000759783 | 305 |
| 283 | 3300005518 | Ga0070699_100149521 | Ga0070699_1001495212 | 305 |
| 284 | 3300005536 | Ga0070697_100006687 | Ga0070697_1000066875 | 305 |
| 285 | 3300005536 | Ga0070697_100031584 | Ga0070697_1000315843 | 305 |
| 286 | 3300005545 | Ga0070695_100017718 | Ga0070695_1000177182 | 305 |
| 287 | 3300005545 | Ga0070695_100083524 | Ga0070695_1000835242 | 305 |
| 288 | 3300005546 | Ga0070696_100000972 | Ga0070696_1000009722 | 305 |
| 289 | 3300005546 | Ga0070696_100001632 | Ga0070696_1000016325 | 305 |
| 290 | 3300005546 | Ga0070696_100004068 | Ga0070696_1000040686 | 305 |
| 291 | 3300005549 | Ga0070704_100003237 | Ga0070704_1000032377 | 305 |
| 292 | 3300005549 | Ga0070704_100006805 | Ga0070704_1000068054 | 305 |
| 293 | 3300005549 | Ga0070704_100220945 | Ga0070704_1002209452 | 305 |
| 294 | 3300005937 | Ga0081455_10013131 | Ga0081455_100131316 | 305 |
| 295 | 3300005983 | Ga0081540_1019241 | Ga0081540_10192411 | 305 |
| 296 | 3300006852 | Ga0075433_10014932 | Ga0075433_100149322 | 305 |
| 297 | 3300006852 | Ga0075433_10022900 | Ga0075433_100229004 | 305 |
| 298 | 3300006914 | Ga0075436_100041760 | Ga0075436_1000417603 | 305 |
| 299 | 3300006914 | Ga0075436_100082911 | Ga0075436_1000829113 | 305 |
| 300 | 3300007076 | Ga0075435_100000602 | Ga0075435_1000006022 | 305 |
| 301 | 3300007076 | Ga0075435_100212056 | Ga0075435_1002120562 | 305 |
| 302 | 3300007076 | Ga0075435_100334957 | Ga0075435_1003349571 | 305 |
| 303 | 3300025885 | Ga0207653_10000041 | Ga0207653_1000004189 | 305 |
| 304 | 3300025910 | Ga0207684_10013502 | Ga0207684_100135023 | 305 |
| 305 | 3300025910 | Ga0207684_10212088 | Ga0207684_102120881 | 305 |
| 306 | 3300025917 | Ga0207660_10027461 | Ga0207660_100274612 | 305 |
| 307 | 3300025922 | Ga0207646_10031201 | Ga0207646_100312013 | 305 |
| 308 | 3300025922 | Ga0207646_10073382 | Ga0207646_100733822 | 305 |
| 309 | 3300027671 | Ga0209588_1000268 | Ga0209588_10002687 | 305 |
| 310 | 3300031731 | Ga0307405_10436902 | Ga0307405_104369021 | 305 |
| 311 | 3300031824 | Ga0307413_10035103 | Ga0307413_100351032 | 305 |
| 312 | 3300031852 | Ga0307410_10013448 | Ga0307410_100134482 | 305 |
| 313 | 3300031995 | Ga0307409_100087698 | Ga0307409_1000876982 | 305 |
| 314 | 3300031995 | Ga0307409_100182486 | Ga0307409_1001824862 | 305 |
| 315 | 3300032005 | Ga0307411_10000165 | Ga0307411_100001652 | 305 |
| 316 | 3300032126 | Ga0307415_100063121 | Ga0307415_1000631212 | 305 |
| 317 | 3300037312 | Ga0395899_0017971 | Ga0395899_0017971_4383_5324 | 305 |
| 318 | 3300037418 | Ga0395900_0008866 | Ga0395900_0008866_18_959 | 305 |
| 319 | 3300037466 | Ga0395898_0177530 | Ga0395898_0177530_127_1068 | 305 |
| 320 | 3300037471 | Ga0395905_0006969 | Ga0395905_0006969_3555_4496 | 305 |
| 321 | 3300038443 | Ga0395901_0002719 | Ga0395901_0002719_11270_12211 | 305 |
| 322 | 3300038443 | Ga0395901_0014839 | Ga0395901_0014839_6958_7899 | 305 |
| 323 | 3300041406 | Ga0439439_0000896 | Ga0439439_0000896_863_1822 | 305 |
| 324 | 3300042438 | Ga0439459_0031404 | Ga0439459_0031404_26_970 | 305 |
| 325 | 3300044673 | Ga0453683_0076642 | Ga0453683_0076642_139_1095 | 305 |
| 326 | 3300045051 | Ga0451576_0119268 | Ga0451576_0119268_1417_2373 | 305 |
| 327 | 3300045051 | Ga0451576_0631939 | Ga0451576_0631939_21_977 | 305 |
| 328 | 3300046528 | Ga0495642_0059764 | Ga0495642_0059764_350_1306 | 305 |
| 329 | 3300046538 | Ga0495609_0072691 | Ga0495609_0072691_89_1045 | 305 |
| 330 | 3300047318 | Ga0495636_0073089 | Ga0495636_0073089_417_1373 | 305 |
| 331 | 3300047318 | Ga0495636_0109473 | Ga0495636_0109473_130_1086 | 305 |
| 332 | 3300050507 | nmdc:mga05p37_234274_c1 | nmdc:mga05p37_234274_c1_192_1148 | 305 |
| 333 | 3300050510 | nmdc:mga06r32_186783_c1 | nmdc:mga06r32_186783_c1_992_1948 | 305 |
| 334 | 3300050512 | nmdc:mga0n895_209700_c1 | nmdc:mga0n895_209700_c1_611_1567 | 305 |
| 335 | 3300050512 | nmdc:mga0n895_89912_c1 | nmdc:mga0n895_89912_c1_1706_2662 | 305 |
| 336 | 3300050513 | nmdc:mga0rr50_25993_c1 | nmdc:mga0rr50_25993_c1_554_1510 | 305 |
| 337 | 3300050513 | nmdc:mga0rr50_82695_c1 | nmdc:mga0rr50_82695_c1_962_1918 | 305 |
| 338 | 3300050514 | nmdc:mga08x19_11207_c1 | nmdc:mga08x19_11207_c1_832_1788 | 305 |
| 339 | 3300050514 | nmdc:mga08x19_28733_c1 | nmdc:mga08x19_28733_c1_2067_3023 | 305 |
| 340 | 3300050514 | nmdc:mga08x19_39131_c1 | nmdc:mga08x19_39131_c1_814_1770 | 305 |
| 341 | 3300050514 | nmdc:mga08x19_62328_c1 | nmdc:mga08x19_62328_c1_269_1225 | 305 |
| 342 | 3300050515 | nmdc:mga0a205_28643_c1 | nmdc:mga0a205_28643_c1_4273_5229 | 305 |
| 343 | 3300050515 | nmdc:mga0a205_62498_c1 | nmdc:mga0a205_62498_c1_494_1450 | 305 |
| 344 | 3300005328 | Ga0070676_10014751 | Ga0070676_100147512 | 306 |
| 345 | 3300005333 | Ga0070677_10020873 | Ga0070677_100208732 | 306 |
| 346 | 3300005334 | Ga0068869_100002403 | Ga0068869_1000024039 | 306 |
| 347 | 3300005341 | Ga0070691_10030710 | Ga0070691_100307102 | 306 |
| 348 | 3300005347 | Ga0070668_100083964 | Ga0070668_1000839642 | 306 |
| 349 | 3300005356 | Ga0070674_100000417 | Ga0070674_10000041717 | 306 |
| 350 | 3300005367 | Ga0070667_100032929 | Ga0070667_1000329292 | 306 |
| 351 | 3300005439 | Ga0070711_100004065 | Ga0070711_1000040656 | 306 |
| 352 | 3300005439 | Ga0070711_100130012 | Ga0070711_1001300121 | 306 |
| 353 | 3300005440 | Ga0070705_100043698 | Ga0070705_1000436982 | 306 |
| 354 | 3300005441 | Ga0070700_100091987 | Ga0070700_1000919871 | 306 |
| 355 | 3300005444 | Ga0070694_100045824 | Ga0070694_1000458242 | 306 |
| 356 | 3300005456 | Ga0070678_100000172 | Ga0070678_1000001722 | 306 |
| 357 | 3300005457 | Ga0070662_100000235 | Ga0070662_1000002359 | 306 |
| 358 | 3300005458 | Ga0070681_10023981 | Ga0070681_100239813 | 306 |
| 359 | 3300005459 | Ga0068867_100000212 | Ga0068867_10000021237 | 306 |
| 360 | 3300005467 | Ga0070706_100211976 | Ga0070706_1002119762 | 306 |
| 361 | 3300005471 | Ga0070698_100034305 | Ga0070698_1000343053 | 306 |
| 362 | 3300005518 | Ga0070699_100003805 | Ga0070699_1000038053 | 306 |
| 363 | 3300005518 | Ga0070699_100040468 | Ga0070699_1000404682 | 306 |
| 364 | 3300005518 | Ga0070699_100119611 | Ga0070699_1001196112 | 306 |
| 365 | 3300005536 | Ga0070697_100020132 | Ga0070697_1000201322 | 306 |
| 366 | 3300005539 | Ga0068853_100131889 | Ga0068853_1001318892 | 306 |
| 367 | 3300005543 | Ga0070672_100305864 | Ga0070672_1003058642 | 306 |
| 368 | 3300005544 | Ga0070686_100071516 | Ga0070686_1000715162 | 306 |
| 369 | 3300005545 | Ga0070695_100000600 | Ga0070695_10000060017 | 306 |
| 370 | 3300005545 | Ga0070695_100027419 | Ga0070695_1000274192 | 306 |
| 371 | 3300005546 | Ga0070696_100005183 | Ga0070696_1000051832 | 306 |
| 372 | 3300005546 | Ga0070696_100006176 | Ga0070696_1000061762 | 306 |
| 373 | 3300005546 | Ga0070696_100044069 | Ga0070696_1000440692 | 306 |
| 374 | 3300005547 | Ga0070693_100180452 | Ga0070693_1001804521 | 306 |
| 375 | 3300005549 | Ga0070704_100108796 | Ga0070704_1001087962 | 306 |
| 376 | 3300005564 | Ga0070664_100100782 | Ga0070664_1001007822 | 306 |
| 377 | 3300005564 | Ga0070664_100318482 | Ga0070664_1003184821 | 306 |
| 378 | 3300005578 | Ga0068854_100000686 | Ga0068854_10000068616 | 306 |
| 379 | 3300005615 | Ga0070702_100022974 | Ga0070702_1000229742 | 306 |
| 380 | 3300005618 | Ga0068864_100007049 | Ga0068864_1000070495 | 306 |
| 381 | 3300005718 | Ga0068866_10000113 | Ga0068866_100001134 | 306 |
| 382 | 3300005840 | Ga0068870_10013916 | Ga0068870_100139162 | 306 |
| 383 | 3300005937 | Ga0081455_10151809 | Ga0081455_101518092 | 306 |
| 384 | 3300005981 | Ga0081538_10028155 | Ga0081538_100281552 | 306 |
| 385 | 3300006237 | Ga0097621_100008373 | Ga0097621_1000083732 | 306 |
| 386 | 3300006844 | Ga0075428_100000665 | Ga0075428_10000066529 | 306 |
| 387 | 3300006881 | Ga0068865_100010352 | Ga0068865_1000103523 | 306 |
| 388 | 3300009093 | Ga0105240_10011885 | Ga0105240_100118859 | 306 |
| 389 | 3300009094 | Ga0111539_10110770 | Ga0111539_101107702 | 306 |
| 390 | 3300009098 | Ga0105245_10066779 | Ga0105245_100667793 | 306 |
| 391 | 3300009147 | Ga0114129_10006218 | Ga0114129_1000621816 | 306 |
| 392 | 3300009147 | Ga0114129_10097432 | Ga0114129_100974322 | 306 |
| 393 | 3300009147 | Ga0114129_10338893 | Ga0114129_103388931 | 306 |
| 394 | 3300009148 | Ga0105243_10001173 | Ga0105243_1000117323 | 306 |
| 395 | 3300009174 | Ga0105241_10055921 | Ga0105241_100559212 | 306 |
| 396 | 3300009176 | Ga0105242_10001800 | Ga0105242_100018002 | 306 |
| 397 | 3300009177 | Ga0105248_10012592 | Ga0105248_100125922 | 306 |
| 398 | 3300010375 | Ga0105239_10051254 | Ga0105239_100512542 | 306 |
| 399 | 3300013297 | Ga0157378_10047119 | Ga0157378_100471192 | 306 |
| 400 | 3300013306 | Ga0163162_10022311 | Ga0163162_100223113 | 306 |
| 401 | 3300013306 | Ga0163162_10025193 | Ga0163162_100251936 | 306 |
| 402 | 3300013307 | Ga0157372_10297395 | Ga0157372_102973952 | 306 |
| 403 | 3300013308 | Ga0157375_10113592 | Ga0157375_101135922 | 306 |
| 404 | 3300014326 | Ga0157380_10245160 | Ga0157380_102451602 | 306 |
| 405 | 3300014968 | Ga0157379_10271073 | Ga0157379_102710732 | 306 |
| 406 | 3300025899 | Ga0207642_10004609 | Ga0207642_100046094 | 306 |
| 407 | 3300025906 | Ga0207699_10272775 | Ga0207699_102727752 | 306 |
| 408 | 3300025906 | Ga0207699_10275546 | Ga0207699_102755462 | 306 |
| 409 | 3300025907 | Ga0207645_10001077 | Ga0207645_1000107716 | 306 |
| 410 | 3300025910 | Ga0207684_10126537 | Ga0207684_101265372 | 306 |
| 411 | 3300025911 | Ga0207654_10034656 | Ga0207654_100346562 | 306 |
| 412 | 3300025917 | Ga0207660_10135014 | Ga0207660_101350142 | 306 |
| 413 | 3300025917 | Ga0207660_10226774 | Ga0207660_102267742 | 306 |
| 414 | 3300025923 | Ga0207681_10038703 | Ga0207681_100387032 | 306 |
| 415 | 3300025927 | Ga0207687_10017397 | Ga0207687_100173972 | 306 |
| 416 | 3300025933 | Ga0207706_10000005 | Ga0207706_10000005106 | 306 |
| 417 | 3300025934 | Ga0207686_10000296 | Ga0207686_1000029618 | 306 |
| 418 | 3300025935 | Ga0207709_10003132 | Ga0207709_100031325 | 306 |
| 419 | 3300025937 | Ga0207669_10006045 | Ga0207669_100060453 | 306 |
| 420 | 3300025938 | Ga0207704_10010560 | Ga0207704_100105602 | 306 |
| 421 | 3300025940 | Ga0207691_10084205 | Ga0207691_100842052 | 306 |
| 422 | 3300025941 | Ga0207711_10003456 | Ga0207711_100034562 | 306 |
| 423 | 3300025942 | Ga0207689_10029021 | Ga0207689_100290212 | 306 |
| 424 | 3300025945 | Ga0207679_10008283 | Ga0207679_100082834 | 306 |
| 425 | 3300025945 | Ga0207679_10108141 | Ga0207679_101081412 | 306 |
| 426 | 3300025961 | Ga0207712_10073260 | Ga0207712_100732603 | 306 |
| 427 | 3300025972 | Ga0207668_10085963 | Ga0207668_100859633 | 306 |
| 428 | 3300025981 | Ga0207640_10001479 | Ga0207640_100014792 | 306 |
| 429 | 3300026075 | Ga0207708_10036561 | Ga0207708_100365613 | 306 |
| 430 | 3300026089 | Ga0207648_10000008 | Ga0207648_10000008174 | 306 |
| 431 | 3300026095 | Ga0207676_10010332 | Ga0207676_100103323 | 306 |
| 432 | 3300026095 | Ga0207676_10167452 | Ga0207676_101674522 | 306 |
| 433 | 3300026118 | Ga0207675_100059853 | Ga0207675_1000598532 | 306 |
| 434 | 3300026121 | Ga0207683_10004563 | Ga0207683_100045632 | 306 |
| 435 | 3300027876 | Ga0209974_10025617 | Ga0209974_100256172 | 306 |
| 436 | 3300028380 | Ga0268265_10149737 | Ga0268265_101497372 | 306 |
| 437 | 3300031548 | Ga0307408_100018440 | Ga0307408_1000184402 | 306 |
| 438 | 3300031548 | Ga0307408_100156041 | Ga0307408_1001560412 | 306 |
| 439 | 3300031731 | Ga0307405_10039216 | Ga0307405_100392163 | 306 |
| 440 | 3300031731 | Ga0307405_10100001 | Ga0307405_101000012 | 306 |
| 441 | 3300031824 | Ga0307413_10015828 | Ga0307413_100158282 | 306 |
| 442 | 3300031824 | Ga0307413_10041247 | Ga0307413_100412472 | 306 |
| 443 | 3300031824 | Ga0307413_10069269 | Ga0307413_100692692 | 306 |
| 444 | 3300031824 | Ga0307413_10094898 | Ga0307413_100948982 | 306 |
| 445 | 3300031824 | Ga0307413_10250429 | Ga0307413_102504291 | 306 |
| 446 | 3300031852 | Ga0307410_10007011 | Ga0307410_100070113 | 306 |
| 447 | 3300031852 | Ga0307410_10007617 | Ga0307410_100076172 | 306 |
| 448 | 3300031852 | Ga0307410_10110452 | Ga0307410_101104521 | 306 |
| 449 | 3300031852 | Ga0307410_10190103 | Ga0307410_101901032 | 306 |
| 450 | 3300031901 | Ga0307406_10035430 | Ga0307406_100354302 | 306 |
| 451 | 3300031901 | Ga0307406_10157951 | Ga0307406_101579512 | 306 |
| 452 | 3300031903 | Ga0307407_10026801 | Ga0307407_100268012 | 306 |
| 453 | 3300031903 | Ga0307407_10151633 | Ga0307407_101516332 | 306 |
| 454 | 3300031911 | Ga0307412_10210619 | Ga0307412_102106192 | 306 |
| 455 | 3300031911 | Ga0307412_10362911 | Ga0307412_103629112 | 306 |
| 456 | 3300031995 | Ga0307409_100004334 | Ga0307409_1000043342 | 306 |
| 457 | 3300031995 | Ga0307409_100009550 | Ga0307409_1000095506 | 306 |
| 458 | 3300031995 | Ga0307409_100031270 | Ga0307409_1000312702 | 306 |
| 459 | 3300032002 | Ga0307416_100002674 | Ga0307416_1000026749 | 306 |
| 460 | 3300032002 | Ga0307416_100025550 | Ga0307416_1000255502 | 306 |
| 461 | 3300032002 | Ga0307416_100034472 | Ga0307416_1000344722 | 306 |
| 462 | 3300032002 | Ga0307416_100044149 | Ga0307416_1000441492 | 306 |
| 463 | 3300032002 | Ga0307416_100085498 | Ga0307416_1000854982 | 306 |
| 464 | 3300032002 | Ga0307416_100111500 | Ga0307416_1001115002 | 306 |
| 465 | 3300032004 | Ga0307414_10013612 | Ga0307414_100136122 | 306 |
| 466 | 3300032005 | Ga0307411_10022105 | Ga0307411_100221052 | 306 |
| 467 | 3300032005 | Ga0307411_10050621 | Ga0307411_100506212 | 306 |
| 468 | 3300032005 | Ga0307411_10067047 | Ga0307411_100670473 | 306 |
| 469 | 3300032005 | Ga0307411_10101767 | Ga0307411_101017672 | 306 |
| 470 | 3300032126 | Ga0307415_100052153 | Ga0307415_1000521532 | 306 |
| 471 | 3300032126 | Ga0307415_100066282 | Ga0307415_1000662823 | 306 |
| 472 | 3300032126 | Ga0307415_100109660 | Ga0307415_1001096602 | 306 |
| 473 | 3300032126 | Ga0307415_100110883 | Ga0307415_1001108832 | 306 |
| 474 | 3300032126 | Ga0307415_100179108 | Ga0307415_1001791082 | 306 |
| 475 | 3300035085 | Ga0373929_0004520 | Ga0373929_0004520_599_1561 | 306 |
| 476 | 3300035089 | Ga0373944_0060966 | Ga0373944_0060966_165_1127 | 306 |
| 477 | 3300042876 | Ga0451577_0003860 | Ga0451577_0003860_14015_14980 | 306 |
| 478 | 3300042876 | Ga0451577_0060419 | Ga0451577_0060419_784_1746 | 306 |
| 479 | 3300044673 | Ga0453683_0235695 | Ga0453683_0235695_162_1124 | 306 |
| 480 | 3300044901 | Ga0466960_0101269 | Ga0466960_0101269_228_1190 | 306 |
| 481 | 3300045051 | Ga0451576_0072884 | Ga0451576_0072884_438_1400 | 306 |
| 482 | 3300046472 | Ga0495580_0085505 | Ga0495580_0085505_413_1375 | 306 |
| 483 | 3300046477 | Ga0495664_0006645 | Ga0495664_0006645_4379_5341 | 306 |
| 484 | 3300046499 | Ga0495594_0003060 | Ga0495594_0003060_5709_6671 | 306 |
| 485 | 3300046499 | Ga0495594_0072165 | Ga0495594_0072165_752_1714 | 306 |
| 486 | 3300046535 | Ga0495586_0017256 | Ga0495586_0017256_1053_2015 | 306 |
| 487 | 3300046683 | Ga0495658_0131014 | Ga0495658_0131014_66_1028 | 306 |
| 488 | 3300047315 | Ga0495581_0122015 | Ga0495581_0122015_458_1420 | 306 |
| 489 | 3300047321 | Ga0495676_0243184 | Ga0495676_0243184_238_1200 | 306 |
| 490 | 3300048905 | Ga0496102_0321315 | Ga0496102_0321315_279_1241 | 306 |
| 491 | 3300048908 | Ga0496105_0053528 | Ga0496105_0053528_1466_2428 | 306 |
| 492 | 3300048909 | Ga0496106_0373708 | Ga0496106_0373708_147_1109 | 306 |
| 493 | 3300048911 | Ga0496108_0005508 | Ga0496108_0005508_1856_2818 | 306 |
| 494 | 3300048912 | Ga0496109_0003563 | Ga0496109_0003563_8962_9924 | 306 |
| 495 | 3300048913 | Ga0496110_0005979 | Ga0496110_0005979_6234_7196 | 306 |
| 496 | 3300048914 | Ga0496111_0006601 | Ga0496111_0006601_4857_5819 | 306 |
| 497 | 3300048915 | Ga0496112_0013660 | Ga0496112_0013660_4903_5865 | 306 |
| 498 | 3300048915 | Ga0496112_0261684 | Ga0496112_0261684_412_1374 | 306 |
| 499 | 3300049571 | Ga0501034_0007407 | Ga0501034_0007407_2808_3773 | 306 |
| 500 | 3300049572 | Ga0501036_0034112 | Ga0501036_0034112_1023_1994 | 306 |
| 501 | 3300049572 | Ga0501036_0321296 | Ga0501036_0321296_74_1045 | 306 |
| 502 | 3300049572 | Ga0501036_0418257 | Ga0501036_0418257_106_1077 | 306 |
| 503 | 3300049573 | Ga0501037_0217015 | Ga0501037_0217015_127_1098 | 306 |
| 504 | 3300049574 | Ga0501038_0025744 | Ga0501038_0025744_3062_4033 | 306 |
| 505 | 3300049574 | Ga0501038_0222040 | Ga0501038_0222040_497_1468 | 306 |
| 506 | 3300049575 | Ga0501039_0075270 | Ga0501039_0075270_1394_2365 | 306 |
| 507 | 3300049576 | Ga0501040_0039174 | Ga0501040_0039174_938_1909 | 306 |
| 508 | 3300049576 | Ga0501040_0071967 | Ga0501040_0071967_751_1722 | 306 |
| 509 | 3300049576 | Ga0501040_0267471 | Ga0501040_0267471_64_1035 | 306 |
| 510 | 3300049577 | Ga0501041_0013881 | Ga0501041_0013881_1051_2022 | 306 |
| 511 | 3300049577 | Ga0501041_0172890 | Ga0501041_0172890_312_1274 | 306 |
| 512 | 3300049578 | Ga0501042_0298674 | Ga0501042_0298674_52_1014 | 306 |
| 513 | 3300049580 | Ga0501046_0047153 | Ga0501046_0047153_458_1429 | 306 |
| 514 | 3300049582 | Ga0501048_0020618 | Ga0501048_0020618_589_1560 | 306 |
| 515 | 3300049583 | Ga0501067_0015410 | Ga0501067_0015410_2986_3948 | 306 |
| 516 | 3300049583 | Ga0501067_0018508 | Ga0501067_0018508_917_1879 | 306 |
| 517 | 3300049585 | Ga0501069_0000689 | Ga0501069_0000689_586_1551 | 306 |
| 518 | 3300049585 | Ga0501069_0126094 | Ga0501069_0126094_388_1350 | 306 |
| 519 | 3300049586 | Ga0501070_0025563 | Ga0501070_0025563_86_1051 | 306 |
| 520 | 3300049587 | Ga0501071_0014896 | Ga0501071_0014896_3369_4340 | 306 |
| 521 | 3300049587 | Ga0501071_0016584 | Ga0501071_0016584_75_1040 | 306 |
| 522 | 3300049587 | Ga0501071_0102099 | Ga0501071_0102099_475_1437 | 306 |
| 523 | 3300049588 | Ga0501072_0014314 | Ga0501072_0014314_1154_2125 | 306 |
| 524 | 3300049590 | Ga0501074_0051417 | Ga0501074_0051417_1667_2638 | 306 |
| 525 | 3300049590 | Ga0501074_0115330 | Ga0501074_0115330_399_1361 | 306 |
| 526 | 3300049591 | Ga0501075_0061267 | Ga0501075_0061267_573_1544 | 306 |
| 527 | 3300049591 | Ga0501075_0168989 | Ga0501075_0168989_362_1333 | 306 |
| 528 | 3300049592 | Ga0501076_0048031 | Ga0501076_0048031_1679_2641 | 306 |
| 529 | 3300049592 | Ga0501076_0210914 | Ga0501076_0210914_519_1490 | 306 |
| 530 | 3300049592 | Ga0501076_0497247 | Ga0501076_0497247_16_978 | 306 |
| 531 | 3300049593 | Ga0501077_0002040 | Ga0501077_0002040_10022_10993 | 306 |
| 532 | 3300049593 | Ga0501077_0042832 | Ga0501077_0042832_1073_2035 | 306 |
| 533 | 3300049679 | Ga0501249_000958 | Ga0501249_000958_2233_3195 | 306 |
| 534 | 3300049705 | Ga0501225_0021050 | Ga0501225_0021050_654_1625 | 306 |
| 535 | 3300049741 | Ga0501079_0001685 | Ga0501079_0001685_2167_3138 | 306 |
| 536 | 3300049742 | Ga0501080_0005592 | Ga0501080_0005592_3724_4689 | 306 |
| 537 | 3300049742 | Ga0501080_0055403 | Ga0501080_0055403_1818_2780 | 306 |
| 538 | 3300049742 | Ga0501080_0096824 | Ga0501080_0096824_1061_2032 | 306 |
| 539 | 3300049742 | Ga0501080_0409709 | Ga0501080_0409709_20_982 | 306 |
| 540 | 3300049743 | Ga0501081_0003218 | Ga0501081_0003218_6568_7539 | 306 |
| 541 | 3300049743 | Ga0501081_0039977 | Ga0501081_0039977_2008_2970 | 306 |
| 542 | 3300049743 | Ga0501081_0049877 | Ga0501081_0049877_428_1390 | 306 |
| 543 | 3300049743 | Ga0501081_0253745 | Ga0501081_0253745_25_987 | 306 |
| 544 | 3300049744 | Ga0501083_0028432 | Ga0501083_0028432_2809_3774 | 306 |
| 545 | 3300049769 | Ga0501272_000438 | Ga0501272_000438_378_1340 | 306 |
| 546 | 3300049775 | Ga0501279_010501 | Ga0501279_010501_173_1144 | 306 |
| 547 | 3300049824 | Ga0501045_0007510 | Ga0501045_0007510_2235_3206 | 306 |
| 548 | 3300049824 | Ga0501045_0022179 | Ga0501045_0022179_598_1569 | 306 |
| 549 | 3300049824 | Ga0501045_0096168 | Ga0501045_0096168_995_1957 | 306 |
| 550 | 3300050507 | nmdc:mga05p37_346_c1 | nmdc:mga05p37_346_c1_1712_2656 | 306 |
| 551 | 3300050510 | nmdc:mga06r32_29280_c1 | nmdc:mga06r32_29280_c1_3805_4767 | 306 |
| 552 | 3300050510 | nmdc:mga06r32_35029_c1 | nmdc:mga06r32_35029_c1_2727_3671 | 306 |
| 553 | 3300050515 | nmdc:mga0a205_21501_c1 | nmdc:mga0a205_21501_c1_406_1368 | 306 |
| 554 | 3300054114 | Ga0501084_0006395 | Ga0501084_0006395_36_1001 | 306 |
| 555 | 3300054114 | Ga0501084_0013453 | Ga0501084_0013453_321_1292 | 306 |
| 556 | 3300054114 | Ga0501084_0040850 | Ga0501084_0040850_2168_3130 | 306 |
| 557 | 3300054114 | Ga0501084_0078552 | Ga0501084_0078552_949_1920 | 306 |
| 558 | 3300059421 | Ga0590071_003167 | Ga0590071_003167_1027_1998 | 306 |
| 559 | 3300059421 | Ga0590071_007530 | Ga0590071_007530_968_1939 | 306 |
| 560 | 3300059424 | Ga0590075_008578 | Ga0590075_008578_758_1729 | 306 |
| 561 | 3300060353 | Ga0501082_0016430 | Ga0501082_0016430_4804_5775 | 306 |
| 562 | 3300060353 | Ga0501082_0129817 | Ga0501082_0129817_385_1356 | 306 |
| 563 | 3300061734 | Ga0530510_0090337 | Ga0530510_0090337_567_1529 | 306 |
| 564 | 3300005337 | Ga0070682_100009960 | Ga0070682_1000099603 | 307 |
| 565 | 3300005435 | Ga0070714_100057012 | Ga0070714_1000570122 | 307 |
| 566 | 3300005436 | Ga0070713_100105297 | Ga0070713_1001052973 | 307 |
| 567 | 3300005439 | Ga0070711_100033054 | Ga0070711_1000330542 | 307 |
| 568 | 3300006175 | Ga0070712_100411933 | Ga0070712_1004119331 | 307 |
| 569 | 3300006871 | Ga0075434_100035095 | Ga0075434_1000350954 | 307 |
| 570 | 3300025915 | Ga0207693_10045631 | Ga0207693_100456312 | 307 |
| 571 | 3300025929 | Ga0207664_10062044 | Ga0207664_100620443 | 307 |
| 572 | 3300028577 | Ga0265318_10018073 | Ga0265318_100180732 | 307 |
| 573 | 3300028800 | Ga0265338_10112616 | Ga0265338_101126162 | 307 |
| 574 | 3300031235 | Ga0265330_10071737 | Ga0265330_100717372 | 307 |
| 575 | 3300031238 | Ga0265332_10030414 | Ga0265332_100304142 | 307 |
| 576 | 3300031241 | Ga0265325_10015719 | Ga0265325_100157195 | 307 |
| 577 | 3300031241 | Ga0265325_10018834 | Ga0265325_100188341 | 307 |
| 578 | 3300031249 | Ga0265339_10028296 | Ga0265339_100282962 | 307 |
| 579 | 3300031344 | Ga0265316_10069709 | Ga0265316_100697092 | 307 |
| 580 | 3300031595 | Ga0265313_10016232 | Ga0265313_100162323 | 307 |
| 581 | 3300031711 | Ga0265314_10005023 | Ga0265314_100050233 | 307 |
| 582 | 3300031712 | Ga0265342_10094937 | Ga0265342_100949372 | 307 |
| 583 | 3300048915 | Ga0496112_0273883 | Ga0496112_0273883_528_1472 | 307 |
| 584 | 3300048918 | Ga0496115_0374128 | Ga0496115_0374128_115_1059 | 307 |
| 585 | 3300061734 | Ga0530510_0123106 | Ga0530510_0123106_181_1146 | 307 |
| 586 | 3300006038 | Ga0075365_10055827 | Ga0075365_100558273 | 308 |
| 587 | 3300048907 | Ga0496104_0037877 | Ga0496104_0037877_2910_3842 | 308 |
| 588 | 3300005458 | Ga0070681_10084845 | Ga0070681_100848452 | 309 |
| 589 | 3300005536 | Ga0070697_100142924 | Ga0070697_1001429242 | 309 |
| 590 | 3300005563 | Ga0068855_100265469 | Ga0068855_1002654691 | 309 |
| 591 | 3300041413 | Ga0439465_0014429 | Ga0439465_0014429_1235_2167 | 309 |
| 592 | 3300042439 | Ga0439464_0061228 | Ga0439464_0061228_31_1023 | 311 |
| 593 | 3300006051 | Ga0075364_10035294 | Ga0075364_100352943 | 312 |
| 594 | 3300006177 | Ga0075362_10055711 | Ga0075362_100557112 | 312 |
| 595 | 3300006194 | Ga0075427_10002923 | Ga0075427_100029232 | 312 |
| 596 | 3300006846 | Ga0075430_100129038 | Ga0075430_1001290382 | 312 |
| 597 | 3300006880 | Ga0075429_100124802 | Ga0075429_1001248022 | 312 |
| 598 | 3300009147 | Ga0114129_10099546 | Ga0114129_100995464 | 313 |
| 599 | 3300050507 | nmdc:mga05p37_290208_c1 | nmdc:mga05p37_290208_c1_923_1870 | 313 |
| 600 | 3300050515 | nmdc:mga0a205_68387_c1 | nmdc:mga0a205_68387_c1_1873_2820 | 313 |
| 601 | 3300005347 | Ga0070668_100120331 | Ga0070668_1001203312 | 315 |
| 602 | 3300005354 | Ga0070675_100238574 | Ga0070675_1002385742 | 315 |
| 603 | 3300005459 | Ga0068867_100061882 | Ga0068867_1000618823 | 315 |
| 604 | 3300005535 | Ga0070684_100031078 | Ga0070684_1000310782 | 315 |
| 605 | 3300005543 | Ga0070672_100068055 | Ga0070672_1000680553 | 315 |
| 606 | 3300009098 | Ga0105245_10052342 | Ga0105245_100523421 | 315 |
| 607 | 3300010375 | Ga0105239_10036624 | Ga0105239_100366243 | 315 |
| 608 | 3300014745 | Ga0157377_10108340 | Ga0157377_101083402 | 315 |
| 609 | 3300025901 | Ga0207688_10012123 | Ga0207688_100121234 | 315 |
| 610 | 3300025926 | Ga0207659_10244669 | Ga0207659_102446692 | 315 |
| 611 | 3300026075 | Ga0207708_10146532 | Ga0207708_101465322 | 315 |
| 612 | 3300026089 | Ga0207648_10431234 | Ga0207648_104312342 | 315 |
| 613 | 3300037418 | Ga0395900_0091480 | Ga0395900_0091480_1918_2889 | 316 |
| 614 | 3300037418 | Ga0395900_0288436 | Ga0395900_0288436_189_1157 | 316 |
| 615 | 3300037466 | Ga0395898_0030677 | Ga0395898_0030677_2056_3027 | 316 |
| 616 | 3300037471 | Ga0395905_0029039 | Ga0395905_0029039_2628_3599 | 316 |
| 617 | 3300046473 | Ga0495582_0193722 | Ga0495582_0193722_112_1083 | 316 |
| 618 | 3300046473 | Ga0495582_0208948 | Ga0495582_0208948_131_1102 | 316 |
| 619 | 3300046615 | Ga0495656_0034550 | Ga0495656_0034550_615_1586 | 316 |
| 620 | 3300046681 | Ga0495647_0064385 | Ga0495647_0064385_101_1072 | 316 |
| 621 | 3300046683 | Ga0495658_0076016 | Ga0495658_0076016_870_1841 | 316 |
| 622 | 3300046690 | Ga0495624_0061727 | Ga0495624_0061727_278_1249 | 316 |
| 623 | 3300047315 | Ga0495581_0000299 | Ga0495581_0000299_5586_6557 | 316 |
| 624 | 3300047321 | Ga0495676_0011923 | Ga0495676_0011923_40_1011 | 316 |
| 625 | 3300005937 | Ga0081455_10044037 | Ga0081455_100440373 | 317 |
| 626 | 3300005981 | Ga0081538_10047517 | Ga0081538_100475173 | 318 |
| 627 | 3300050511 | nmdc:mga08y16_226181_c1 | nmdc:mga08y16_226181_c1_699_1700 | 318 |
| 628 | 3300050515 | nmdc:mga0a205_212896_c1 | nmdc:mga0a205_212896_c1_481_1482 | 318 |
| 629 | 3300005981 | Ga0081538_10097149 | Ga0081538_100971492 | 319 |
| 630 | 3300037466 | Ga0395898_0326498 | Ga0395898_0326498_340_1311 | 319 |
| 631 | 3300003373 | JGI25407J50210_10000027 | JGI25407J50210_1000002716 | 320 |
| 632 | 3300005937 | Ga0081455_10003760 | Ga0081455_1000376013 | 320 |
| 633 | 3300005937 | Ga0081455_10007369 | Ga0081455_100073692 | 320 |
| 634 | 3300005937 | Ga0081455_10024581 | Ga0081455_100245813 | 320 |
| 635 | 3300005981 | Ga0081538_10000100 | Ga0081538_100001004 | 320 |
| 636 | 3300005981 | Ga0081538_10000254 | Ga0081538_1000025466 | 320 |
| 637 | 3300005981 | Ga0081538_10000820 | Ga0081538_1000082010 | 320 |
| 638 | 3300005981 | Ga0081538_10003447 | Ga0081538_1000344713 | 320 |
| 639 | 3300009094 | Ga0111539_10439859 | Ga0111539_104398592 | 320 |
| 640 | 3300037312 | Ga0395899_0002355 | Ga0395899_0002355_6928_7908 | 320 |
| 641 | 3300037312 | Ga0395899_0003130 | Ga0395899_0003130_3628_4608 | 320 |
| 642 | 3300037418 | Ga0395900_0014115 | Ga0395900_0014115_41_1021 | 320 |
| 643 | 3300037418 | Ga0395900_0019538 | Ga0395900_0019538_5025_5999 | 320 |
| 644 | 3300037466 | Ga0395898_0059624 | Ga0395898_0059624_1014_1994 | 320 |
| 645 | 3300037466 | Ga0395898_0089295 | Ga0395898_0089295_30_1004 | 320 |
| 646 | 3300037471 | Ga0395905_0078430 | Ga0395905_0078430_398_1378 | 320 |
| 647 | 3300037471 | Ga0395905_0107477 | Ga0395905_0107477_603_1583 | 320 |
| 648 | 3300038443 | Ga0395901_0002069 | Ga0395901_0002069_10977_11957 | 320 |
| 649 | 3300038443 | Ga0395901_0058399 | Ga0395901_0058399_2335_3315 | 320 |
| 650 | 3300038443 | Ga0395901_0175559 | Ga0395901_0175559_829_1803 | 320 |
| 651 | 3300042119 | Ga0450915_000083 | Ga0450915_000083_64_1053 | 320 |
| 652 | 3300049570 | Ga0501033_0000939 | Ga0501033_0000939_972_1961 | 320 |
| 653 | 3300049573 | Ga0501037_0002891 | Ga0501037_0002891_11049_12038 | 320 |
| 654 | 3300049576 | Ga0501040_0025993 | Ga0501040_0025993_2529_3518 | 320 |
| 655 | 3300049577 | Ga0501041_0014347 | Ga0501041_0014347_1298_2287 | 320 |
| 656 | 3300049578 | Ga0501042_0090920 | Ga0501042_0090920_243_1232 | 320 |
| 657 | 3300049579 | Ga0501043_0006223 | Ga0501043_0006223_8327_9316 | 320 |
| 658 | 3300049580 | Ga0501046_0006055 | Ga0501046_0006055_4632_5621 | 320 |
| 659 | 3300049582 | Ga0501048_0003885 | Ga0501048_0003885_1511_2500 | 320 |
| 660 | 3300049584 | Ga0501068_0018705 | Ga0501068_0018705_1421_2410 | 320 |
| 661 | 3300049585 | Ga0501069_0011109 | Ga0501069_0011109_1149_2138 | 320 |
| 662 | 3300049586 | Ga0501070_0080847 | Ga0501070_0080847_1330_2319 | 320 |
| 663 | 3300049589 | Ga0501073_0009788 | Ga0501073_0009788_4177_5166 | 320 |
| 664 | 3300049590 | Ga0501074_0011723 | Ga0501074_0011723_4760_5749 | 320 |
| 665 | 3300049591 | Ga0501075_0020752 | Ga0501075_0020752_420_1409 | 320 |
| 666 | 3300049741 | Ga0501079_0281262 | Ga0501079_0281262_176_1156 | 320 |
| 667 | 3300049742 | Ga0501080_0066839 | Ga0501080_0066839_1604_2593 | 320 |
| 668 | 3300049743 | Ga0501081_0059008 | Ga0501081_0059008_195_1175 | 320 |
| 669 | 3300050491 | nmdc:mga00v17_41663_c1 | nmdc:mga00v17_41663_c1_1141_2130 | 320 |
| 670 | 3300050493 | nmdc:mga0k408_119938_c1 | nmdc:mga0k408_119938_c1_337_1326 | 320 |
| 671 | 3300050510 | nmdc:mga06r32_99960_c1 | nmdc:mga06r32_99960_c1_1190_2179 | 320 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f9y-assembly1.cif.gz_A-2 | the crystal structure of the carboxyltransferase subunit of acc from escherichia coli | 0.9201 | 34 | 307 |
| 2f9i-assembly1.cif.gz_A | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9023 | 30 | 308 |
| 2f9i-assembly1.cif.gz_C | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9019 | 30 | 308 |
| 5kdr-assembly1.cif.gz_A-2 | the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. | 0.856 | 7 | 308 |
| 2f9i-assembly1.cif.gz_C | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.8379 | 30 | 308 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQH9_238_492_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9071 | 49 | 307 | 3.90.226.10 |
| af_P9WQH9_238_492_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8904 | 49 | 307 | 3.90.226.10 |
| af_Q2FXM7_1_314_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8318 | 7 | 308 | 3.90.226.10 |
| af_Q2FXM7_1_314_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7985 | 7 | 308 | 3.90.226.10 |
| 4l6wA02 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7739 | 37 | 284 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N8GSY0-F1-model_v4 | deleted | 0.9641 | 92 | 186 |
|
| AF-A0A0P9DLY9-F1-model_v4 | acetyl-CoA carboxytransferase (EC 2.1.3.15) | 0.9628 | 50 | 155 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A0A1G3JA39-F1-model_v4 | acetyl-CoA carboxytransferase (EC 2.1.3.15) | 0.9607 | 49 | 278 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A0A3C1LYA3-F1-model_v4 | acetyl-CoA carboxytransferase (EC 2.1.3.15) | 0.9606 | 50 | 190 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A0A1S9CM11-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) | 0.9596 | 49 | 310 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar