F474145

General Info

Members Datasets Scaffolds Average Seq Length
671 273 665 312

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10044037|Ga0081455_100440373
Length 334
Sequence MSPACSASSIVPSSNNSEAELRLRERLSRLRRLRLLGGARLSGELERLQKQIDRITTEEPSDEEIWRSVEAARNEDRPYVLDYAERMLDEFVELHGDRARAEDPALIAGLGRFRGRTVGFMGTQKGRDIKERTKRNFGMTHPEGYRKAMRVMEIAERHRFPVISLIDTPGAYPGVAAEQHGQGGAIARSQALMARLSVPIVACVIGEGSSGGAVAIGLADRVLMQENAIYVVISPEGCAAILWRDAGEREKAAAAFRPDAVHCLELGIIDAIVPEPEGGAHTDYDAAAQLLATSLEASLSELEGVAGADLRRRRRDRYRALGVFADVVAEPQRA

Samples

Sample ID Description Type Environment
1 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
2 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
3 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
4 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
5 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
6 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
174 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
177 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
178 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
179 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
180 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
250 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
256 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0.15
Rhizoplane 6.71
Rhizosphere 91.8
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000027 3300003373 Bacteria 15777
2 Ga0065715_10094516 3300005293 Bacteria 4316
3 Ga0070676_10014751 3300005328 Bacteria 4298
4 Ga0070683_100374438 3300005329 Bacteria 1357
5 Ga0070677_10020873 3300005333 Bacteria 2394
6 Ga0068869_100002403 3300005334 Bacteria 11278
7 Ga0070680_100026714 3300005336 Bacteria 4617
8 Ga0070682_100009960 3300005337 Bacteria 5384
9 Ga0070691_10010514 3300005341 Bacteria 4224
10 Ga0070691_10030710 3300005341 Bacteria 2517
11 Ga0070692_10013875 3300005345 Bacteria 3766
12 Ga0070668_100018405 3300005347 Bacteria 5244
13 Ga0070668_100083964 3300005347 Bacteria 2501
14 Ga0070668_100120331 3300005347 Bacteria 2098
15 Ga0070675_100238574 3300005354 Bacteria 1588
16 Ga0070674_100000417 3300005356 Bacteria 21451
17 Ga0070673_100060821 3300005364 Bacteria 2994
18 Ga0070667_100032929 3300005367 Bacteria 4326
19 Ga0070703_10000141 3300005406 Bacteria 37278
20 Ga0070714_100057012 3300005435 Bacteria 3342
21 Ga0070714_100103320 3300005435 Bacteria 2514
22 Ga0070713_100079611 3300005436 Bacteria 2792
23 Ga0070713_100105297 3300005436 Bacteria 2450
24 Ga0070711_100000044 3300005439 Bacteria 83348
25 Ga0070711_100004065 3300005439 Bacteria 8600
26 Ga0070711_100033054 3300005439 Bacteria 3443
27 Ga0070711_100130012 3300005439 Bacteria 1874
28 Ga0070705_100007260 3300005440 Bacteria 5450
29 Ga0070705_100017079 3300005440 Bacteria 3782
30 Ga0070705_100027588 3300005440 Bacteria 3102
31 Ga0070705_100043698 3300005440 Bacteria 2570
32 Ga0070700_100036797 3300005441 Bacteria 2971
33 Ga0070700_100091987 3300005441 Bacteria 1981
34 Ga0070700_100418527 3300005441 Bacteria 1012
35 Ga0070694_100000349 3300005444 Bacteria 24772
36 Ga0070694_100006398 3300005444 Bacteria 7144
37 Ga0070694_100012643 3300005444 Bacteria 5255
38 Ga0070694_100045824 3300005444 Bacteria 2933
39 Ga0070694_100046819 3300005444 Bacteria 2906
40 Ga0070694_100077997 3300005444 Bacteria 2296
41 Ga0070708_100008655 3300005445 Bacteria 8177
42 Ga0070708_100011209 3300005445 Bacteria 7290
43 Ga0070708_100018920 3300005445 Bacteria 5772
44 Ga0070708_100109329 3300005445 Bacteria 2540
45 Ga0070708_100386147 3300005445 Bacteria 1320
46 Ga0070708_100443364 3300005445 Bacteria 1225
47 Ga0070678_100000172 3300005456 Bacteria 27651
48 Ga0070662_100000235 3300005457 Bacteria 32681
49 Ga0070662_100112474 3300005457 Bacteria 2076
50 Ga0070681_10023981 3300005458 Bacteria 6142
51 Ga0070681_10067510 3300005458 Bacteria 3544
52 Ga0070681_10084845 3300005458 Bacteria 3119
53 Ga0070681_10355426 3300005458 Bacteria 1375
54 Ga0068867_100000212 3300005459 Bacteria 38648
55 Ga0068867_100061882 3300005459 Bacteria 2780
56 Ga0070706_100001803 3300005467 Bacteria 22182
57 Ga0070706_100007748 3300005467 Bacteria 10040
58 Ga0070706_100020867 3300005467 Bacteria 6031
59 Ga0070706_100032312 3300005467 Bacteria 4827
60 Ga0070706_100040632 3300005467 Bacteria 4293
61 Ga0070706_100059484 3300005467 Bacteria 3526
62 Ga0070706_100068002 3300005467 Bacteria 3294
63 Ga0070706_100119847 3300005467 Bacteria 2452
64 Ga0070706_100141561 3300005467 Bacteria 2245
65 Ga0070706_100211976 3300005467 Bacteria 1809
66 Ga0070706_100331631 3300005467 Bacteria 1419
67 Ga0070707_100001254 3300005468 Bacteria 24951
68 Ga0070707_100006175 3300005468 Bacteria 11160
69 Ga0070707_100019542 3300005468 Bacteria 6382
70 Ga0070707_100070945 3300005468 Bacteria 3356
71 Ga0070707_100101197 3300005468 Bacteria 2792
72 Ga0070707_100132928 3300005468 Bacteria 2420
73 Ga0070707_100324351 3300005468 Bacteria 1496
74 Ga0070698_100000588 3300005471 Bacteria 39030
75 Ga0070698_100001523 3300005471 Bacteria 25707
76 Ga0070698_100022851 3300005471 Bacteria 6538
77 Ga0070698_100034305 3300005471 Bacteria 5254
78 Ga0070698_100062050 3300005471 Bacteria 3771
79 Ga0070698_100128214 3300005471 Bacteria 2494
80 Ga0070698_100257753 3300005471 Bacteria 1676
81 Ga0070698_100372187 3300005471 Bacteria 1361
82 Ga0070699_100003805 3300005518 Bacteria 13339
83 Ga0070699_100023516 3300005518 Bacteria 5309
84 Ga0070699_100040468 3300005518 Bacteria 4036
85 Ga0070699_100045776 3300005518 Bacteria 3786
86 Ga0070699_100070881 3300005518 Bacteria 3030
87 Ga0070699_100075978 3300005518 Bacteria 2924
88 Ga0070699_100083473 3300005518 Bacteria 2787
89 Ga0070699_100108274 3300005518 Bacteria 2439
90 Ga0070699_100113085 3300005518 Bacteria 2385
91 Ga0070699_100119611 3300005518 Bacteria 2315
92 Ga0070699_100149521 3300005518 Bacteria 2065
93 Ga0070684_100031078 3300005535 Bacteria 4543
94 Ga0070684_100424545 3300005535 Bacteria 1227
95 Ga0070697_100006687 3300005536 Bacteria 8946
96 Ga0070697_100020132 3300005536 Bacteria 5274
97 Ga0070697_100031584 3300005536 Bacteria 4261
98 Ga0070697_100038923 3300005536 Bacteria 3843
99 Ga0070697_100086726 3300005536 Bacteria 2584
100 Ga0070697_100142924 3300005536 Bacteria 2013
101 Ga0070697_100351840 3300005536 Bacteria 1272
102 Ga0068853_100131889 3300005539 Bacteria 2237
103 Ga0070672_100045871 3300005543 Bacteria 3384
104 Ga0070672_100068055 3300005543 Bacteria 2824
105 Ga0070672_100305864 3300005543 Bacteria 1349
106 Ga0070686_100016210 3300005544 Bacteria 4332
107 Ga0070686_100071516 3300005544 Bacteria 2271
108 Ga0070695_100000600 3300005545 Bacteria 19071
109 Ga0070695_100002934 3300005545 Bacteria 9933
110 Ga0070695_100017718 3300005545 Bacteria 4321
111 Ga0070695_100027419 3300005545 Bacteria 3528
112 Ga0070695_100046469 3300005545 Bacteria 2770
113 Ga0070695_100083256 3300005545 Bacteria 2119
114 Ga0070695_100083524 3300005545 Bacteria 2116
115 Ga0070695_100195405 3300005545 Bacteria 1442
116 Ga0070696_100000972 3300005546 Bacteria 18569
117 Ga0070696_100001632 3300005546 Bacteria 14723
118 Ga0070696_100004068 3300005546 Bacteria 9753
119 Ga0070696_100005183 3300005546 Bacteria 8712
120 Ga0070696_100006176 3300005546 Bacteria 8006
121 Ga0070696_100013566 3300005546 Bacteria 5469
122 Ga0070696_100028190 3300005546 Bacteria 3831
123 Ga0070696_100044069 3300005546 Bacteria 3089
124 Ga0070696_100235141 3300005546 Bacteria 1380
125 Ga0070696_100272462 3300005546 Bacteria 1287
126 Ga0070693_100019750 3300005547 Bacteria 3540
127 Ga0070693_100180452 3300005547 Bacteria 1359
128 Ga0070704_100003237 3300005549 Bacteria 9305
129 Ga0070704_100006805 3300005549 Bacteria 6768
130 Ga0070704_100007802 3300005549 Bacteria 6381
131 Ga0070704_100079161 3300005549 Bacteria 2413
132 Ga0070704_100108796 3300005549 Bacteria 2105
133 Ga0070704_100133850 3300005549 Bacteria 1926
134 Ga0070704_100181978 3300005549 Bacteria 1682
135 Ga0070704_100220945 3300005549 Bacteria 1540
136 Ga0068855_100265469 3300005563 Bacteria 1911
137 Ga0070664_100100782 3300005564 Bacteria 2511
138 Ga0070664_100318482 3300005564 Bacteria 1409
139 Ga0068854_100000686 3300005578 Bacteria 20183
140 Ga0068856_100012832 3300005614 Bacteria 8108
141 Ga0070702_100022974 3300005615 Bacteria 3307
142 Ga0068859_100076108 3300005617 Bacteria 3397
143 Ga0068864_100007049 3300005618 Bacteria 9227
144 Ga0068866_10000113 3300005718 Bacteria 35053
145 Ga0068870_10013916 3300005840 Bacteria 3789
146 Ga0068863_100138215 3300005841 Bacteria 2328
147 Ga0081455_10003760 3300005937 Bacteria 17328
148 Ga0081455_10007369 3300005937 Bacteria 11598
149 Ga0081455_10013131 3300005937 Bacteria 8210
150 Ga0081455_10018635 3300005937 Bacteria 6597
151 Ga0081455_10024581 3300005937 Bacteria 5576
152 Ga0081455_10044037 3300005937 Bacteria 3898
153 Ga0081455_10151809 3300005937 Bacteria 1785
154 Ga0081538_10000100 3300005981 Bacteria 83917
155 Ga0081538_10000254 3300005981 Bacteria 60558
156 Ga0081538_10000820 3300005981 Bacteria 33705
157 Ga0081538_10003447 3300005981 Bacteria 14936
158 Ga0081538_10028155 3300005981 Bacteria 3873
159 Ga0081538_10047517 3300005981 Bacteria 2631
160 Ga0081538_10097149 3300005981 Bacteria 1498
161 Ga0081540_1019241 3300005983 Bacteria 4159
162 Ga0070717_10038539 3300006028 Bacteria 3886
163 Ga0075365_10055827 3300006038 Bacteria 2623
164 Ga0075364_10035294 3300006051 Bacteria 3231
165 Ga0070716_100011363 3300006173 Bacteria 4483
166 Ga0070712_100411933 3300006175 Bacteria 1118
167 Ga0075362_10055711 3300006177 Bacteria 1778
168 Ga0075427_10002923 3300006194 Bacteria 2324
169 Ga0097621_100008373 3300006237 Bacteria 7444
170 Ga0075428_100000665 3300006844 Bacteria 35332
171 Ga0075428_100017303 3300006844 Bacteria 7967
172 Ga0075428_100105438 3300006844 Bacteria 3074
173 Ga0075430_100129038 3300006846 Bacteria 2107
174 Ga0075431_100029774 3300006847 Bacteria 5621
175 Ga0075433_10000706 3300006852 Bacteria 22781
176 Ga0075433_10012217 3300006852 Bacteria 6925
177 Ga0075433_10014932 3300006852 Bacteria 6356
178 Ga0075433_10022900 3300006852 Bacteria 5250
179 Ga0075434_100000347 3300006871 Bacteria 33417
180 Ga0075434_100019038 3300006871 Bacteria 6636
181 Ga0075434_100035095 3300006871 Bacteria 4957
182 Ga0075434_100042360 3300006871 Bacteria 4513
183 Ga0075434_100225684 3300006871 Bacteria 1893
184 Ga0075429_100124802 3300006880 Bacteria 2251
185 Ga0068865_100010352 3300006881 Bacteria 5802
186 Ga0075436_100001806 3300006914 Bacteria 14669
187 Ga0075436_100005939 3300006914 Bacteria 8388
188 Ga0075436_100041760 3300006914 Bacteria 3164
189 Ga0075436_100058573 3300006914 Bacteria 2660
190 Ga0075436_100082911 3300006914 Bacteria 2224
191 Ga0075436_100194269 3300006914 Bacteria 1436
192 Ga0097620_100076106 3300006931 Bacteria 3397
193 Ga0075435_100000602 3300007076 Bacteria 21989
194 Ga0075435_100014992 3300007076 Bacteria 5815
195 Ga0075435_100130234 3300007076 Bacteria 2105
196 Ga0075435_100209426 3300007076 Bacteria 1653
197 Ga0075435_100212056 3300007076 Bacteria 1643
198 Ga0075435_100334957 3300007076 Bacteria 1296
199 Ga0099794_10000323 3300007265 Bacteria 16423
200 Ga0105240_10011885 3300009093 Bacteria 12079
201 Ga0111539_10110770 3300009094 Bacteria 3221
202 Ga0111539_10372183 3300009094 Bacteria 1663
203 Ga0111539_10439859 3300009094 Bacteria 1518
204 Ga0105245_10052342 3300009098 Bacteria 3662
205 Ga0105245_10066779 3300009098 Bacteria 3256
206 Ga0114129_10000136 3300009147 Bacteria 76070
207 Ga0114129_10006218 3300009147 Bacteria 16932
208 Ga0114129_10027635 3300009147 Bacteria 8034
209 Ga0114129_10097432 3300009147 Bacteria 4072
210 Ga0114129_10099546 3300009147 Bacteria 4024
211 Ga0114129_10195879 3300009147 Bacteria 2740
212 Ga0114129_10338893 3300009147 Bacteria 1995
213 Ga0114129_10367375 3300009147 Bacteria 1903
214 Ga0114129_10432492 3300009147 Bacteria 1729
215 Ga0114129_10811870 3300009147 Bacteria 1192
216 Ga0105243_10001173 3300009148 Bacteria 23730
217 Ga0105241_10055921 3300009174 Bacteria 3024
218 Ga0105242_10001800 3300009176 Bacteria 16892
219 Ga0105248_10012592 3300009177 Bacteria 9332
220 Ga0105248_10029555 3300009177 Bacteria 6114
221 Ga0105248_10072482 3300009177 Bacteria 3871
222 Ga0105248_10649819 3300009177 Bacteria 1190
223 Ga0105239_10009754 3300010375 Bacteria 10796
224 Ga0105239_10036624 3300010375 Bacteria 5386
225 Ga0105239_10051254 3300010375 Bacteria 4525
226 Ga0157378_10047119 3300013297 Bacteria 3831
227 Ga0163162_10022311 3300013306 Bacteria 6240
228 Ga0163162_10025193 3300013306 Bacteria 5879
229 Ga0157372_10297395 3300013307 Bacteria 1878
230 Ga0157375_10095936 3300013308 Bacteria 3037
231 Ga0157375_10113592 3300013308 Bacteria 2809
232 Ga0163163_10218507 3300014325 Bacteria 1954
233 Ga0157380_10245160 3300014326 Bacteria 1618
234 Ga0157377_10108340 3300014745 Bacteria 1666
235 Ga0157379_10271073 3300014968 Bacteria 1543
236 Ga0207653_10000041 3300025885 Bacteria 96988
237 Ga0207653_10013179 3300025885 Bacteria 2588
238 Ga0207642_10004609 3300025899 Bacteria 4452
239 Ga0207642_10156259 3300025899 Bacteria 1220
240 Ga0207688_10012123 3300025901 Bacteria 4691
241 Ga0207699_10272775 3300025906 Bacteria 1173
242 Ga0207699_10275546 3300025906 Bacteria 1167
243 Ga0207645_10001077 3300025907 Bacteria 22572
244 Ga0207684_10000793 3300025910 Bacteria 36573
245 Ga0207684_10013502 3300025910 Bacteria 7064
246 Ga0207684_10024753 3300025910 Bacteria 5117
247 Ga0207684_10026482 3300025910 Bacteria 4943
248 Ga0207684_10126537 3300025910 Bacteria 2193
249 Ga0207684_10212088 3300025910 Bacteria 1670
250 Ga0207654_10034656 3300025911 Bacteria 2806
251 Ga0207707_10001068 3300025912 Bacteria 26271
252 Ga0207693_10045631 3300025915 Bacteria 3444
253 Ga0207663_10000062 3300025916 Bacteria 53663
254 Ga0207660_10027461 3300025917 Bacteria 3885
255 Ga0207660_10135014 3300025917 Bacteria 1881
256 Ga0207660_10226774 3300025917 Bacteria 1468
257 Ga0207646_10002716 3300025922 Bacteria 20737
258 Ga0207646_10002961 3300025922 Bacteria 19662
259 Ga0207646_10031201 3300025922 Bacteria 4826
260 Ga0207646_10073382 3300025922 Bacteria 3057
261 Ga0207646_10091588 3300025922 Bacteria 2721
262 Ga0207646_10173063 3300025922 Bacteria 1950
263 Ga0207646_10340957 3300025922 Bacteria 1354
264 Ga0207681_10038703 3300025923 Bacteria 3162
265 Ga0207659_10244669 3300025926 Bacteria 1453
266 Ga0207687_10017397 3300025927 Bacteria 4733
267 Ga0207664_10062044 3300025929 Bacteria 2984
268 Ga0207664_10463899 3300025929 Bacteria 1131
269 Ga0207706_10000005 3300025933 Bacteria 224460
270 Ga0207686_10000296 3300025934 Bacteria 36674
271 Ga0207709_10003132 3300025935 Bacteria 9948
272 Ga0207669_10006045 3300025937 Bacteria 5494
273 Ga0207704_10010560 3300025938 Bacteria 4510
274 Ga0207665_10018812 3300025939 Bacteria 4540
275 Ga0207691_10057397 3300025940 Bacteria 3543
276 Ga0207691_10084205 3300025940 Bacteria 2855
277 Ga0207711_10003456 3300025941 Bacteria 13673
278 Ga0207711_10012735 3300025941 Bacteria 6986
279 Ga0207711_10120852 3300025941 Bacteria 2338
280 Ga0207711_10265340 3300025941 Bacteria 1579
281 Ga0207689_10029021 3300025942 Bacteria 4624
282 Ga0207661_10273817 3300025944 Bacteria 1507
283 Ga0207679_10008283 3300025945 Bacteria 6620
284 Ga0207679_10108141 3300025945 Bacteria 2189
285 Ga0207651_10137382 3300025960 Bacteria 1882
286 Ga0207712_10073260 3300025961 Bacteria 2470
287 Ga0207668_10085963 3300025972 Bacteria 2296
288 Ga0207640_10001479 3300025981 Bacteria 12675
289 Ga0207708_10036561 3300026075 Bacteria 3739
290 Ga0207708_10076207 3300026075 Bacteria 2572
291 Ga0207708_10146532 3300026075 Bacteria 1856
292 Ga0207702_10032515 3300026078 Bacteria 4353
293 Ga0207648_10000008 3300026089 Bacteria 208822
294 Ga0207648_10431234 3300026089 Bacteria 1198
295 Ga0207676_10010332 3300026095 Bacteria 6645
296 Ga0207676_10029864 3300026095 Bacteria 4085
297 Ga0207676_10167452 3300026095 Bacteria 1911
298 Ga0207675_100059853 3300026118 Bacteria 3555
299 Ga0207683_10004563 3300026121 Bacteria 11929
300 Ga0207683_10025614 3300026121 Bacteria 5089
301 Ga0209588_1000268 3300027671 Bacteria 13787
302 Ga0209588_1001267 3300027671 Bacteria 6543
303 Ga0209974_10025617 3300027876 Bacteria 1953
304 Ga0268265_10149737 3300028380 Bacteria 1967
305 Ga0268264_10108687 3300028381 Bacteria 2425
306 Ga0265319_1016205 3300028563 Bacteria 2861
307 Ga0265334_10010862 3300028573 Bacteria 3844
308 Ga0265318_10007401 3300028577 Bacteria 4967
309 Ga0265318_10018073 3300028577 Bacteria 2884
310 Ga0265338_10023596 3300028800 Bacteria 6318
311 Ga0265338_10032585 3300028800 Bacteria 5076
312 Ga0265338_10089742 3300028800 Bacteria 2546
313 Ga0265338_10112616 3300028800 Bacteria 2187
314 Ga0265330_10071737 3300031235 Bacteria 1498
315 Ga0265332_10030414 3300031238 Bacteria 2359
316 Ga0265320_10059499 3300031240 Bacteria 1826
317 Ga0265325_10015719 3300031241 Bacteria 4248
318 Ga0265325_10018834 3300031241 Bacteria 3826
319 Ga0265339_10028296 3300031249 Bacteria 3188
320 Ga0265331_10078640 3300031250 Bacteria 1535
321 Ga0265316_10020319 3300031344 Bacteria 5656
322 Ga0265316_10069709 3300031344 Bacteria 2713
323 Ga0307408_100016355 3300031548 Bacteria 4950
324 Ga0307408_100018440 3300031548 Bacteria 4685
325 Ga0307408_100156041 3300031548 Bacteria 1807
326 Ga0265313_10016232 3300031595 Bacteria 4290
327 Ga0265314_10003427 3300031711 Bacteria 15325
328 Ga0265314_10005023 3300031711 Bacteria 12056
329 Ga0265342_10094937 3300031712 Bacteria 1705
330 Ga0307405_10007690 3300031731 Bacteria 5415
331 Ga0307405_10039216 3300031731 Bacteria 2861
332 Ga0307405_10100001 3300031731 Bacteria 1942
333 Ga0307405_10436902 3300031731 Bacteria 1034
334 Ga0307413_10015828 3300031824 Bacteria 3876
335 Ga0307413_10035103 3300031824 Bacteria 2873
336 Ga0307413_10041247 3300031824 Bacteria 2701
337 Ga0307413_10069269 3300031824 Bacteria 2213
338 Ga0307413_10094898 3300031824 Bacteria 1954
339 Ga0307413_10250429 3300031824 Bacteria 1314
340 Ga0307410_10007011 3300031852 Bacteria 6133
341 Ga0307410_10007617 3300031852 Bacteria 5940
342 Ga0307410_10013448 3300031852 Bacteria 4776
343 Ga0307410_10031649 3300031852 Bacteria 3398
344 Ga0307410_10088699 3300031852 Bacteria 2190
345 Ga0307410_10110452 3300031852 Bacteria 1989
346 Ga0307410_10163937 3300031852 Bacteria 1668
347 Ga0307410_10190103 3300031852 Bacteria 1561
348 Ga0307410_10252913 3300031852 Bacteria 1370
349 Ga0307406_10022882 3300031901 Bacteria 3712
350 Ga0307406_10035430 3300031901 Bacteria 3069
351 Ga0307406_10157951 3300031901 Bacteria 1626
352 Ga0307407_10007755 3300031903 Bacteria 4882
353 Ga0307407_10026801 3300031903 Bacteria 3057
354 Ga0307407_10094016 3300031903 Bacteria 1844
355 Ga0307407_10151633 3300031903 Bacteria 1507
356 Ga0307412_10210619 3300031911 Bacteria 1483
357 Ga0307412_10362911 3300031911 Bacteria 1167
358 Ga0307409_100004334 3300031995 Bacteria 7950
359 Ga0307409_100009550 3300031995 Bacteria 5969
360 Ga0307409_100031270 3300031995 Bacteria 3839
361 Ga0307409_100087698 3300031995 Bacteria 2537
362 Ga0307409_100182486 3300031995 Bacteria 1859
363 Ga0307416_100002674 3300032002 Bacteria 10315
364 Ga0307416_100025550 3300032002 Bacteria 4331
365 Ga0307416_100033095 3300032002 Bacteria 3915
366 Ga0307416_100034472 3300032002 Bacteria 3852
367 Ga0307416_100044149 3300032002 Bacteria 3496
368 Ga0307416_100085498 3300032002 Bacteria 2685
369 Ga0307416_100111500 3300032002 Bacteria 2412
370 Ga0307416_100175913 3300032002 Bacteria 1999
371 Ga0307414_10013612 3300032004 Bacteria 4849
372 Ga0307411_10000165 3300032005 Bacteria 21279
373 Ga0307411_10019490 3300032005 Bacteria 3919
374 Ga0307411_10022105 3300032005 Bacteria 3738
375 Ga0307411_10050621 3300032005 Bacteria 2706
376 Ga0307411_10067047 3300032005 Bacteria 2413
377 Ga0307411_10101767 3300032005 Bacteria 2034
378 Ga0307415_100052153 3300032126 Bacteria 2780
379 Ga0307415_100063121 3300032126 Bacteria 2573
380 Ga0307415_100066282 3300032126 Bacteria 2519
381 Ga0307415_100109660 3300032126 Bacteria 2045
382 Ga0307415_100110883 3300032126 Bacteria 2035
383 Ga0307415_100179108 3300032126 Bacteria 1661
384 Ga0373929_0004520 3300035085 Bacteria 2491
385 Ga0373929_0013107 3300035085 Bacteria 1585
386 Ga0373944_0060966 3300035089 Bacteria 1210
387 Ga0373943_0097795 3300035170 Bacteria 1530
388 Ga0373942_0024581 3300035207 Bacteria 1546
389 Ga0373931_0011780 3300035691 Bacteria 4228
390 Ga0373931_0042199 3300035691 Bacteria 2398
391 Ga0395899_0002355 3300037312 Bacteria 15381
392 Ga0395899_0002472 3300037312 Bacteria 15001
393 Ga0395899_0003130 3300037312 Bacteria 13165
394 Ga0395899_0017971 3300037312 Bacteria 5381
395 Ga0395899_0033324 3300037312 Bacteria 3868
396 Ga0395899_0046431 3300037312 Bacteria 3235
397 Ga0395899_0104152 3300037312 Bacteria 2045
398 Ga0395900_0001207 3300037418 Bacteria 31970
399 Ga0395900_0005728 3300037418 Bacteria 12986
400 Ga0395900_0008323 3300037418 Bacteria 10679
401 Ga0395900_0008866 3300037418 Bacteria 10326
402 Ga0395900_0014115 3300037418 Bacteria 8156
403 Ga0395900_0019538 3300037418 Bacteria 6907
404 Ga0395900_0091480 3300037418 Bacteria 3126
405 Ga0395900_0288436 3300037418 Bacteria 1631
406 Ga0395898_0001088 3300037466 Bacteria 41937
407 Ga0395898_0002790 3300037466 Bacteria 20063
408 Ga0395898_0030677 3300037466 Bacteria 5378
409 Ga0395898_0059624 3300037466 Bacteria 3711
410 Ga0395898_0089295 3300037466 Bacteria 2966
411 Ga0395898_0177530 3300037466 Bacteria 2035
412 Ga0395898_0326498 3300037466 Bacteria 1463
413 Ga0395898_0346201 3300037466 Bacteria 1417
414 Ga0395905_0001822 3300037471 Bacteria 24643
415 Ga0395905_0006196 3300037471 Bacteria 12067
416 Ga0395905_0006969 3300037471 Bacteria 11299
417 Ga0395905_0029039 3300037471 Bacteria 5212
418 Ga0395905_0050644 3300037471 Bacteria 3890
419 Ga0395905_0059109 3300037471 Bacteria 3584
420 Ga0395905_0078430 3300037471 Bacteria 3095
421 Ga0395905_0107477 3300037471 Bacteria 2619
422 Ga0395901_0002069 3300038443 Bacteria 20589
423 Ga0395901_0002285 3300038443 Bacteria 19538
424 Ga0395901_0002719 3300038443 Bacteria 17817
425 Ga0395901_0003479 3300038443 Bacteria 15862
426 Ga0395901_0003728 3300038443 Bacteria 15354
427 Ga0395901_0005005 3300038443 Bacteria 13379
428 Ga0395901_0014839 3300038443 Bacteria 7915
429 Ga0395901_0058399 3300038443 Bacteria 4012
430 Ga0395901_0175559 3300038443 Bacteria 2247
431 Ga0395901_0207187 3300038443 Bacteria 2053
432 Ga0242419_001705 3300038698 Bacteria 1381
433 Ga0439439_0000896 3300041406 Bacteria 5502
434 Ga0439439_0021565 3300041406 Bacteria 1606
435 Ga0439465_0014429 3300041413 Bacteria 2462
436 Ga0450915_000083 3300042119 Bacteria 2117
437 Ga0439446_0026004 3300042156 Bacteria 1675
438 Ga0439459_0031404 3300042438 Bacteria 1083
439 Ga0439464_0061228 3300042439 Bacteria 1102
440 Ga0439460_0067100 3300042461 Bacteria 1105
441 Ga0451577_0003860 3300042876 Bacteria 16272
442 Ga0451577_0060419 3300042876 Bacteria 3379
443 Ga0453683_0030814 3300044673 Bacteria 3390
444 Ga0453683_0076642 3300044673 Bacteria 2094
445 Ga0453683_0088722 3300044673 Bacteria 1938
446 Ga0453683_0093276 3300044673 Bacteria 1888
447 Ga0453683_0171395 3300044673 Bacteria 1375
448 Ga0453683_0235695 3300044673 Bacteria 1165
449 Ga0466960_0101269 3300044901 Bacteria 1483
450 Ga0451576_0003678 3300045051 Bacteria 20806
451 Ga0451576_0072884 3300045051 Bacteria 3573
452 Ga0451576_0119268 3300045051 Bacteria 2746
453 Ga0451576_0631939 3300045051 Bacteria 1125
454 Ga0495603_0101779 3300046455 Bacteria 1677
455 Ga0495603_0299927 3300046455 Bacteria 923
456 Ga0495641_0065865 3300046461 Bacteria 1630
457 Ga0495653_0020848 3300046463 Bacteria 5311
458 Ga0495580_0073505 3300046472 Bacteria 2387
459 Ga0495580_0085505 3300046472 Bacteria 2197
460 Ga0495580_0121205 3300046472 Bacteria 1816
461 Ga0495582_0193722 3300046473 Bacteria 1160
462 Ga0495582_0208948 3300046473 Bacteria 1115
463 Ga0495664_0006645 3300046477 Bacteria 6394
464 Ga0495664_0232983 3300046477 Bacteria 1114
465 Ga0495594_0003060 3300046499 Bacteria 8668
466 Ga0495594_0072165 3300046499 Bacteria 1920
467 Ga0495618_0097660 3300046514 Bacteria 1879
468 Ga0495663_0051593 3300046525 Bacteria 1275
469 Ga0495642_0059764 3300046528 Bacteria 1580
470 Ga0495586_0017256 3300046535 Bacteria 3837
471 Ga0495609_0072691 3300046538 Bacteria 1510
472 Ga0495667_0063199 3300046559 Bacteria 2424
473 Ga0495667_0169027 3300046559 Bacteria 1405
474 Ga0495656_0034550 3300046615 Bacteria 2071
475 Ga0495656_0037957 3300046615 Bacteria 1993
476 Ga0495634_0102558 3300046642 Bacteria 1848
477 Ga0495635_0058923 3300046663 Bacteria 2641
478 Ga0495588_0081524 3300046674 Bacteria 1689
479 Ga0495647_0064385 3300046681 Bacteria 1454
480 Ga0495658_0076016 3300046683 Bacteria 1962
481 Ga0495658_0131014 3300046683 Bacteria 1526
482 Ga0495624_0055018 3300046690 Bacteria 2508
483 Ga0495624_0061727 3300046690 Bacteria 2347
484 Ga0495670_0078913 3300046691 Bacteria 1675
485 Ga0495581_0000299 3300047315 Bacteria 24150
486 Ga0495581_0122015 3300047315 Bacteria 1517
487 Ga0495636_0073089 3300047318 Bacteria 1467
488 Ga0495636_0109473 3300047318 Bacteria 1215
489 Ga0495676_0011923 3300047321 Bacteria 7842
490 Ga0495676_0221676 3300047321 Bacteria 1303
491 Ga0495676_0243184 3300047321 Bacteria 1231
492 Ga0495680_0233616 3300047322 Bacteria 1308
493 Ga0495685_041749 3300047447 Bacteria 1567
494 Ga0495684_0242992 3300047471 Bacteria 1312
495 Ga0496101_0022092 3300048904 Bacteria 4377
496 Ga0496102_0005303 3300048905 Bacteria 10943
497 Ga0496102_0015658 3300048905 Bacteria 6606
498 Ga0496102_0070689 3300048905 Bacteria 3205
499 Ga0496102_0156245 3300048905 Bacteria 2144
500 Ga0496102_0321315 3300048905 Bacteria 1458
501 Ga0496103_0031853 3300048906 Bacteria 3216
502 Ga0496104_0018315 3300048907 Bacteria 6390
503 Ga0496104_0037877 3300048907 Bacteria 4509
504 Ga0496104_0153724 3300048907 Bacteria 2208
505 Ga0496105_0048054 3300048908 Bacteria 3522
506 Ga0496105_0053528 3300048908 Bacteria 3333
507 Ga0496106_0007347 3300048909 Bacteria 8143
508 Ga0496106_0266606 3300048909 Bacteria 1371
509 Ga0496106_0373708 3300048909 Bacteria 1145
510 Ga0496107_0074872 3300048910 Bacteria 2464
511 Ga0496107_0102102 3300048910 Bacteria 2103
512 Ga0496108_0001426 3300048911 Bacteria 18860
513 Ga0496108_0002438 3300048911 Bacteria 14862
514 Ga0496108_0003364 3300048911 Bacteria 12837
515 Ga0496108_0005508 3300048911 Bacteria 10242
516 Ga0496109_0003563 3300048912 Bacteria 13001
517 Ga0496109_0006064 3300048912 Bacteria 10155
518 Ga0496109_0016240 3300048912 Bacteria 6508
519 Ga0496109_0042299 3300048912 Bacteria 4126
520 Ga0496109_0067910 3300048912 Bacteria 3266
521 Ga0496110_0005979 3300048913 Bacteria 9580
522 Ga0496110_0110902 3300048913 Bacteria 2465
523 Ga0496110_0114347 3300048913 Bacteria 2428
524 Ga0496111_0006601 3300048914 Bacteria 7547
525 Ga0496111_0016618 3300048914 Bacteria 5074
526 Ga0496111_0092204 3300048914 Bacteria 2220
527 Ga0496112_0013660 3300048915 Bacteria 7503
528 Ga0496112_0017069 3300048915 Bacteria 6814
529 Ga0496112_0045781 3300048915 Bacteria 4288
530 Ga0496112_0084935 3300048915 Bacteria 3131
531 Ga0496112_0088840 3300048915 Bacteria 3058
532 Ga0496112_0205694 3300048915 Bacteria 1927
533 Ga0496112_0232224 3300048915 Bacteria 1799
534 Ga0496112_0261684 3300048915 Bacteria 1679
535 Ga0496112_0273883 3300048915 Bacteria 1636
536 Ga0496113_0009464 3300048916 Bacteria 6391
537 Ga0496113_0085240 3300048916 Bacteria 2426
538 Ga0496115_0118719 3300048918 Bacteria 2175
539 Ga0496115_0374128 3300048918 Bacteria 1159
540 Ga0501033_0000939 3300049570 Bacteria 26506
541 Ga0501034_0007407 3300049571 Bacteria 11682
542 Ga0501034_0315291 3300049571 Bacteria 1497
543 Ga0501036_0034112 3300049572 Bacteria 4304
544 Ga0501036_0321296 3300049572 Bacteria 1293
545 Ga0501036_0418257 3300049572 Bacteria 1118
546 Ga0501037_0002891 3300049573 Bacteria 12458
547 Ga0501037_0217015 3300049573 Bacteria 1347
548 Ga0501038_0025744 3300049574 Bacteria 5242
549 Ga0501038_0222040 3300049574 Bacteria 1507
550 Ga0501039_0075270 3300049575 Bacteria 2624
551 Ga0501040_0025993 3300049576 Bacteria 3938
552 Ga0501040_0039174 3300049576 Bacteria 3223
553 Ga0501040_0071967 3300049576 Bacteria 2387
554 Ga0501040_0267471 3300049576 Bacteria 1220
555 Ga0501041_0013881 3300049577 Bacteria 4776
556 Ga0501041_0014347 3300049577 Bacteria 4704
557 Ga0501041_0172890 3300049577 Bacteria 1352
558 Ga0501042_0090920 3300049578 Bacteria 2190
559 Ga0501042_0298674 3300049578 Bacteria 1163
560 Ga0501043_0006223 3300049579 Bacteria 9587
561 Ga0501046_0006055 3300049580 Bacteria 10759
562 Ga0501046_0047153 3300049580 Bacteria 3417
563 Ga0501048_0003885 3300049582 Bacteria 11368
564 Ga0501048_0020618 3300049582 Bacteria 4831
565 Ga0501067_0005972 3300049583 Bacteria 6751
566 Ga0501067_0015410 3300049583 Bacteria 4232
567 Ga0501067_0018508 3300049583 Bacteria 3858
568 Ga0501068_0018705 3300049584 Bacteria 4013
569 Ga0501069_0000689 3300049585 Bacteria 15765
570 Ga0501069_0011109 3300049585 Bacteria 4777
571 Ga0501069_0027211 3300049585 Bacteria 3134
572 Ga0501069_0126094 3300049585 Bacteria 1464
573 Ga0501070_0025563 3300049586 Bacteria 4952
574 Ga0501070_0080847 3300049586 Bacteria 2688
575 Ga0501070_0180229 3300049586 Bacteria 1739
576 Ga0501071_0014896 3300049587 Bacteria 5327
577 Ga0501071_0016584 3300049587 Bacteria 5067
578 Ga0501071_0102099 3300049587 Bacteria 2115
579 Ga0501072_0014314 3300049588 Bacteria 6080
580 Ga0501073_0009788 3300049589 Bacteria 7056
581 Ga0501074_0011723 3300049590 Bacteria 6371
582 Ga0501074_0051417 3300049590 Bacteria 2974
583 Ga0501074_0115330 3300049590 Bacteria 1922
584 Ga0501075_0020752 3300049591 Bacteria 4781
585 Ga0501075_0061267 3300049591 Bacteria 2835
586 Ga0501075_0168989 3300049591 Bacteria 1668
587 Ga0501076_0048031 3300049592 Bacteria 3374
588 Ga0501076_0210914 3300049592 Bacteria 1587
589 Ga0501076_0497247 3300049592 Bacteria 1005
590 Ga0501077_0002040 3300049593 Bacteria 12182
591 Ga0501077_0042832 3300049593 Bacteria 2877
592 Ga0501249_000958 3300049679 Bacteria 6301
593 Ga0501225_0021050 3300049705 Bacteria 1802
594 Ga0501079_0001685 3300049741 Bacteria 15715
595 Ga0501079_0281262 3300049741 Bacteria 1301
596 Ga0501080_0005592 3300049742 Bacteria 11234
597 Ga0501080_0055403 3300049742 Bacteria 3693
598 Ga0501080_0066839 3300049742 Bacteria 3343
599 Ga0501080_0096824 3300049742 Bacteria 2740
600 Ga0501080_0409709 3300049742 Bacteria 1219
601 Ga0501081_0003218 3300049743 Bacteria 10383
602 Ga0501081_0039977 3300049743 Bacteria 3211
603 Ga0501081_0049877 3300049743 Bacteria 2883
604 Ga0501081_0059008 3300049743 Bacteria 2656
605 Ga0501081_0253745 3300049743 Bacteria 1284
606 Ga0501083_0028432 3300049744 Bacteria 3852
607 Ga0501272_000438 3300049769 Bacteria 3631
608 Ga0501279_010501 3300049775 Bacteria 1246
609 Ga0501045_0007510 3300049824 Bacteria 7575
610 Ga0501045_0022179 3300049824 Bacteria 4544
611 Ga0501045_0096168 3300049824 Bacteria 2191
612 nmdc:mga00v17_41663_c1 3300050491 Bacteria 2759
613 nmdc:mga0k408_119938_c1 3300050493 Bacteria 1557
614 nmdc:mga05p37_153165_c1 3300050507 Bacteria 2819
615 nmdc:mga05p37_234274_c1 3300050507 Bacteria 2211
616 nmdc:mga05p37_290208_c1 3300050507 Bacteria 1947
617 nmdc:mga05p37_346_c1 3300050507 Bacteria 49689
618 nmdc:mga09592_128973_c1 3300050508 Bacteria 2175
619 nmdc:mga06r32_186783_c1 3300050510 Bacteria 2059
620 nmdc:mga06r32_29280_c1 3300050510 Bacteria 5159
621 nmdc:mga06r32_35029_c1 3300050510 Bacteria 4736
622 nmdc:mga06r32_39210_c1 3300050510 Bacteria 4494
623 nmdc:mga06r32_438408_c1 3300050510 Bacteria 1286
624 nmdc:mga06r32_99960_c1 3300050510 Bacteria 2846
625 nmdc:mga08y16_226181_c1 3300050511 Bacteria 1936
626 nmdc:mga08y16_263625_c1 3300050511 Bacteria 1779
627 nmdc:mga0n895_209700_c1 3300050512 Bacteria 1979
628 nmdc:mga0n895_21069_c1 3300050512 Bacteria 6092
629 nmdc:mga0n895_41530_c1 3300050512 Bacteria 4473
630 nmdc:mga0n895_63514_c1 3300050512 Bacteria 3652
631 nmdc:mga0n895_89912_c1 3300050512 Bacteria 3072
632 nmdc:mga0rr50_116754_c1 3300050513 Bacteria 2119
633 nmdc:mga0rr50_150296_c1 3300050513 Bacteria 1881
634 nmdc:mga0rr50_25993_c1 3300050513 Bacteria 4078
635 nmdc:mga0rr50_39515_c1 3300050513 Bacteria 3423
636 nmdc:mga0rr50_51724_c1 3300050513 Bacteria 3050
637 nmdc:mga0rr50_82695_c1 3300050513 Bacteria 2481
638 nmdc:mga08x19_110862_c1 3300050514 Bacteria 1830
639 nmdc:mga08x19_11207_c1 3300050514 Bacteria 5396
640 nmdc:mga08x19_13590_c1 3300050514 Bacteria 4924
641 nmdc:mga08x19_28733_c1 3300050514 Bacteria 3485
642 nmdc:mga08x19_39131_c1 3300050514 Bacteria 3014
643 nmdc:mga08x19_62328_c1 3300050514 Bacteria 2418
644 nmdc:mga08x19_953_c1 3300050514 Bacteria 18175
645 nmdc:mga0a205_212896_c1 3300050515 Bacteria 1820
646 nmdc:mga0a205_21501_c1 3300050515 Bacteria 6101
647 nmdc:mga0a205_28025_c1 3300050515 Bacteria 5382
648 nmdc:mga0a205_28643_c1 3300050515 Bacteria 5326
649 nmdc:mga0a205_364453_c1 3300050515 Unclassified 1311
650 nmdc:mga0a205_5392_c1 3300050515 Bacteria 11536
651 nmdc:mga0a205_62498_c1 3300050515 Bacteria 3598
652 nmdc:mga0a205_68387_c1 3300050515 Bacteria 3430
653 Ga0495619_0030605 3300053085 Bacteria 3484
654 Ga0501084_0006395 3300054114 Bacteria 9682
655 Ga0501084_0013453 3300054114 Bacteria 6773
656 Ga0501084_0040850 3300054114 Bacteria 3881
657 Ga0501084_0078552 3300054114 Bacteria 2766
658 Ga0590071_003167 3300059421 Bacteria 4065
659 Ga0590071_007530 3300059421 Bacteria 2577
660 Ga0590075_008578 3300059424 Bacteria 2442
661 Ga0501082_0016430 3300060353 Bacteria 6370
662 Ga0501082_0129817 3300060353 Bacteria 2186
663 Ga0530510_0062767 3300061734 Bacteria 2689
664 Ga0530510_0090337 3300061734 Bacteria 2234
665 Ga0530510_0123106 3300061734 Bacteria 1905

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100029774 Ga0075431_1000297742 262
2 3300050510 nmdc:mga06r32_39210_c1 nmdc:mga06r32_39210_c1_2841_3797 262
3 3300005436 Ga0070713_100079611 Ga0070713_1000796113 265
4 3300005467 Ga0070706_100032312 Ga0070706_1000323121 265
5 3300005467 Ga0070706_100059484 Ga0070706_1000594841 265
6 3300005468 Ga0070707_100324351 Ga0070707_1003243512 265
7 3300005471 Ga0070698_100001523 Ga0070698_10000152313 265
8 3300005536 Ga0070697_100086726 Ga0070697_1000867262 265
9 3300025885 Ga0207653_10013179 Ga0207653_100131791 265
10 3300025922 Ga0207646_10091588 Ga0207646_100915882 265
11 3300025922 Ga0207646_10340957 Ga0207646_103409572 265
12 3300050514 nmdc:mga08x19_110862_c1 nmdc:mga08x19_110862_c1_314_1273 265
13 3300005440 Ga0070705_100027588 Ga0070705_1000275882 266
14 3300005545 Ga0070695_100195405 Ga0070695_1001954052 266
15 3300005445 Ga0070708_100018920 Ga0070708_1000189204 268
16 3300005467 Ga0070706_100040632 Ga0070706_1000406322 268
17 3300005471 Ga0070698_100128214 Ga0070698_1001282142 268
18 3300005518 Ga0070699_100045776 Ga0070699_1000457762 268
19 3300005546 Ga0070696_100013566 Ga0070696_1000135662 268
20 3300005549 Ga0070704_100079161 Ga0070704_1000791611 268
21 3300006173 Ga0070716_100011363 Ga0070716_1000113633 268
22 3300006871 Ga0075434_100042360 Ga0075434_1000423603 268
23 3300006914 Ga0075436_100194269 Ga0075436_1001942692 268
24 3300025910 Ga0207684_10024753 Ga0207684_100247534 268
25 3300025922 Ga0207646_10002961 Ga0207646_100029617 268
26 3300025939 Ga0207665_10018812 Ga0207665_100188122 268
27 3300050512 nmdc:mga0n895_21069_c1 nmdc:mga0n895_21069_c1_1199_2158 268
28 3300005445 Ga0070708_100011209 Ga0070708_1000112094 269
29 3300005445 Ga0070708_100386147 Ga0070708_1003861472 269
30 3300005467 Ga0070706_100068002 Ga0070706_1000680022 269
31 3300005468 Ga0070707_100006175 Ga0070707_1000061756 269
32 3300005468 Ga0070707_100101197 Ga0070707_1001011972 269
33 3300005536 Ga0070697_100351840 Ga0070697_1003518402 269
34 3300005546 Ga0070696_100272462 Ga0070696_1002724621 269
35 3300005549 Ga0070704_100133850 Ga0070704_1001338501 269
36 3300006844 Ga0075428_100105438 Ga0075428_1001054382 269
37 3300006852 Ga0075433_10012217 Ga0075433_100122172 269
38 3300006871 Ga0075434_100019038 Ga0075434_1000190384 269
39 3300007076 Ga0075435_100014992 Ga0075435_1000149923 269
40 3300009147 Ga0114129_10000136 Ga0114129_1000013669 269
41 3300009147 Ga0114129_10027635 Ga0114129_100276352 269
42 3300009147 Ga0114129_10367375 Ga0114129_103673752 269
43 3300025910 Ga0207684_10000793 Ga0207684_100007937 269
44 3300025922 Ga0207646_10002716 Ga0207646_1000271612 269
45 3300025922 Ga0207646_10173063 Ga0207646_101730632 269
46 3300048909 Ga0496106_0266606 Ga0496106_0266606_240_1202 269
47 3300050507 nmdc:mga05p37_153165_c1 nmdc:mga05p37_153165_c1_461_1420 269
48 3300050508 nmdc:mga09592_128973_c1 nmdc:mga09592_128973_c1_855_1817 269
49 3300050512 nmdc:mga0n895_63514_c1 nmdc:mga0n895_63514_c1_1356_2315 269
50 3300050513 nmdc:mga0rr50_51724_c1 nmdc:mga0rr50_51724_c1_2023_2982 269
51 3300050515 nmdc:mga0a205_28025_c1 nmdc:mga0a205_28025_c1_75_1034 269
52 3300005518 Ga0070699_100083473 Ga0070699_1000834731 270
53 3300006914 Ga0075436_100058573 Ga0075436_1000585732 270
54 3300048905 Ga0496102_0156245 Ga0496102_0156245_1077_2039 270
55 3300050514 nmdc:mga08x19_13590_c1 nmdc:mga08x19_13590_c1_191_1150 270
56 3300025941 Ga0207711_10265340 Ga0207711_102653401 272
57 3300006852 Ga0075433_10000706 Ga0075433_1000070611 274
58 3300006871 Ga0075434_100000347 Ga0075434_10000034720 274
59 3300009147 Ga0114129_10432492 Ga0114129_104324923 274
60 3300048915 Ga0496112_0232224 Ga0496112_0232224_493_1320 274
61 3300050512 nmdc:mga0n895_41530_c1 nmdc:mga0n895_41530_c1_280_1230 274
62 3300050513 nmdc:mga0rr50_39515_c1 nmdc:mga0rr50_39515_c1_1465_2415 274
63 3300050515 nmdc:mga0a205_5392_c1 nmdc:mga0a205_5392_c1_2674_3624 274
64 3300005471 Ga0070698_100372187 Ga0070698_1003721872 276
65 3300009147 Ga0114129_10195879 Ga0114129_101958792 276
66 3300028800 Ga0265338_10023596 Ga0265338_100235962 277
67 3300028800 Ga0265338_10032585 Ga0265338_100325854 277
68 3300042461 Ga0439460_0067100 Ga0439460_0067100_12_854 280
69 3300046455 Ga0495603_0299927 Ga0495603_0299927_13_882 282
70 3300047322 Ga0495680_0233616 Ga0495680_0233616_414_1283 282
71 3300035170 Ga0373943_0097795 Ga0373943_0097795_127_1068 284
72 3300047321 Ga0495676_0221676 Ga0495676_0221676_69_1010 284
73 3300050510 nmdc:mga06r32_438408_c1 nmdc:mga06r32_438408_c1_185_1138 284
74 3300005445 Ga0070708_100008655 Ga0070708_1000086555 286
75 3300005467 Ga0070706_100001803 Ga0070706_1000018035 286
76 3300005468 Ga0070707_100001254 Ga0070707_10000125416 286
77 3300005518 Ga0070699_100070881 Ga0070699_1000708812 286
78 3300007265 Ga0099794_10000323 Ga0099794_100003232 286
79 3300025910 Ga0207684_10026482 Ga0207684_100264822 286
80 3300027671 Ga0209588_1001267 Ga0209588_10012672 286
81 3300005467 Ga0070706_100331631 Ga0070706_1003316312 287
82 3300005549 Ga0070704_100181978 Ga0070704_1001819782 287
83 3300006914 Ga0075436_100001806 Ga0075436_10000180611 287
84 3300050513 nmdc:mga0rr50_150296_c1 nmdc:mga0rr50_150296_c1_462_1418 287
85 3300050514 nmdc:mga08x19_953_c1 nmdc:mga08x19_953_c1_6644_7600 287
86 3300005439 Ga0070711_100000044 Ga0070711_10000004421 288
87 3300005444 Ga0070694_100000349 Ga0070694_1000003496 288
88 3300005545 Ga0070695_100002934 Ga0070695_1000029343 288
89 3300025916 Ga0207663_10000062 Ga0207663_100000628 288
90 3300031548 Ga0307408_100016355 Ga0307408_1000163553 288
91 3300031731 Ga0307405_10007690 Ga0307405_100076902 288
92 3300031852 Ga0307410_10163937 Ga0307410_101639372 288
93 3300031852 Ga0307410_10252913 Ga0307410_102529131 288
94 3300031901 Ga0307406_10022882 Ga0307406_100228822 288
95 3300031903 Ga0307407_10094016 Ga0307407_100940162 288
96 3300032005 Ga0307411_10019490 Ga0307411_100194902 288
97 3300009177 Ga0105248_10649819 Ga0105248_106498191 290
98 3300005336 Ga0070680_100026714 Ga0070680_1000267143 291
99 3300005347 Ga0070668_100018405 Ga0070668_1000184052 291
100 3300005364 Ga0070673_100060821 Ga0070673_1000608212 291
101 3300005458 Ga0070681_10355426 Ga0070681_103554262 291
102 3300005543 Ga0070672_100045871 Ga0070672_1000458712 291
103 3300005841 Ga0068863_100138215 Ga0068863_1001382152 291
104 3300009177 Ga0105248_10029555 Ga0105248_100295556 291
105 3300009177 Ga0105248_10072482 Ga0105248_100724822 291
106 3300013308 Ga0157375_10095936 Ga0157375_100959362 291
107 3300025912 Ga0207707_10001068 Ga0207707_1000106831 291
108 3300025940 Ga0207691_10057397 Ga0207691_100573973 291
109 3300025941 Ga0207711_10012735 Ga0207711_100127354 291
110 3300025941 Ga0207711_10120852 Ga0207711_101208522 291
111 3300025960 Ga0207651_10137382 Ga0207651_101373822 291
112 3300028381 Ga0268264_10108687 Ga0268264_101086872 291
113 3300046691 Ga0495670_0078913 Ga0495670_0078913_412_1377 291
114 3300037312 Ga0395899_0046431 Ga0395899_0046431_1611_2552 293
115 3300037471 Ga0395905_0006196 Ga0395905_0006196_10931_11872 293
116 3300038443 Ga0395901_0207187 Ga0395901_0207187_1045_1986 293
117 3300046455 Ga0495603_0101779 Ga0495603_0101779_202_1134 293
118 3300046461 Ga0495641_0065865 Ga0495641_0065865_286_1218 293
119 3300046615 Ga0495656_0037957 Ga0495656_0037957_950_1906 293
120 3300005293 Ga0065715_10094516 Ga0065715_100945162 294
121 3300005345 Ga0070692_10013875 Ga0070692_100138751 294
122 3300005440 Ga0070705_100017079 Ga0070705_1000170792 294
123 3300005441 Ga0070700_100036797 Ga0070700_1000367973 294
124 3300005444 Ga0070694_100046819 Ga0070694_1000468192 294
125 3300005457 Ga0070662_100112474 Ga0070662_1001124742 294
126 3300005518 Ga0070699_100108274 Ga0070699_1001082741 294
127 3300005544 Ga0070686_100016210 Ga0070686_1000162102 294
128 3300005545 Ga0070695_100083256 Ga0070695_1000832562 294
129 3300005546 Ga0070696_100028190 Ga0070696_1000281902 294
130 3300005549 Ga0070704_100007802 Ga0070704_1000078023 294
131 3300005617 Ga0068859_100076108 Ga0068859_1000761083 294
132 3300006871 Ga0075434_100225684 Ga0075434_1002256841 294
133 3300006931 Ga0097620_100076106 Ga0097620_1000761063 294
134 3300007076 Ga0075435_100130234 Ga0075435_1001302342 294
135 3300009147 Ga0114129_10811870 Ga0114129_108118702 294
136 3300010375 Ga0105239_10009754 Ga0105239_1000975410 294
137 3300026075 Ga0207708_10076207 Ga0207708_100762073 294
138 3300031852 Ga0307410_10088699 Ga0307410_100886992 294
139 3300031903 Ga0307407_10007755 Ga0307407_100077552 294
140 3300035691 Ga0373931_0042199 Ga0373931_0042199_1088_2050 294
141 3300041406 Ga0439439_0021565 Ga0439439_0021565_259_1227 294
142 3300042156 Ga0439446_0026004 Ga0439446_0026004_585_1553 294
143 3300046477 Ga0495664_0232983 Ga0495664_0232983_144_1076 294
144 3300046514 Ga0495618_0097660 Ga0495618_0097660_871_1803 294
145 3300046559 Ga0495667_0063199 Ga0495667_0063199_1334_2266 294
146 3300046663 Ga0495635_0058923 Ga0495635_0058923_1010_1942 294
147 3300046690 Ga0495624_0055018 Ga0495624_0055018_1489_2421 294
148 3300047471 Ga0495684_0242992 Ga0495684_0242992_246_1178 294
149 3300048904 Ga0496101_0022092 Ga0496101_0022092_1820_2782 294
150 3300048905 Ga0496102_0005303 Ga0496102_0005303_8386_9348 294
151 3300048906 Ga0496103_0031853 Ga0496103_0031853_464_1426 294
152 3300048907 Ga0496104_0018315 Ga0496104_0018315_4543_5505 294
153 3300048909 Ga0496106_0007347 Ga0496106_0007347_2236_3198 294
154 3300048910 Ga0496107_0102102 Ga0496107_0102102_947_1909 294
155 3300048911 Ga0496108_0003364 Ga0496108_0003364_722_1684 294
156 3300048912 Ga0496109_0006064 Ga0496109_0006064_6996_7958 294
157 3300048913 Ga0496110_0110902 Ga0496110_0110902_726_1688 294
158 3300048914 Ga0496111_0016618 Ga0496111_0016618_592_1554 294
159 3300048915 Ga0496112_0017069 Ga0496112_0017069_1562_2524 294
160 3300048918 Ga0496115_0118719 Ga0496115_0118719_652_1614 294
161 3300049585 Ga0501069_0027211 Ga0501069_0027211_1707_2672 294
162 3300005518 Ga0070699_100113085 Ga0070699_1001130852 295
163 3300031852 Ga0307410_10031649 Ga0307410_100316492 295
164 3300032002 Ga0307416_100175913 Ga0307416_1001759132 295
165 3300044673 Ga0453683_0093276 Ga0453683_0093276_716_1678 295
166 3300046472 Ga0495580_0073505 Ga0495580_0073505_196_1158 295
167 3300046674 Ga0495588_0081524 Ga0495588_0081524_318_1280 295
168 3300005536 Ga0070697_100038923 Ga0070697_1000389231 297
169 3300005614 Ga0068856_100012832 Ga0068856_1000128323 297
170 3300026078 Ga0207702_10032515 Ga0207702_100325153 297
171 3300046463 Ga0495653_0020848 Ga0495653_0020848_4248_5183 297
172 3300046525 Ga0495663_0051593 Ga0495663_0051593_234_1175 297
173 3300046559 Ga0495667_0169027 Ga0495667_0169027_306_1241 297
174 3300047447 Ga0495685_041749 Ga0495685_041749_571_1512 297
175 3300053085 Ga0495619_0030605 Ga0495619_0030605_1278_2213 297
176 3300005546 Ga0070696_100235141 Ga0070696_1002351412 298
177 3300009094 Ga0111539_10372183 Ga0111539_103721832 298
178 3300014325 Ga0163163_10218507 Ga0163163_102185072 298
179 3300025899 Ga0207642_10156259 Ga0207642_101562592 298
180 3300026095 Ga0207676_10029864 Ga0207676_100298643 298
181 3300035691 Ga0373931_0011780 Ga0373931_0011780_2157_3119 298
182 3300048907 Ga0496104_0153724 Ga0496104_0153724_957_1919 298
183 3300048911 Ga0496108_0001426 Ga0496108_0001426_16742_17704 298
184 3300048912 Ga0496109_0016240 Ga0496109_0016240_5489_6451 298
185 3300048912 Ga0496109_0042299 Ga0496109_0042299_1215_2177 298
186 3300048913 Ga0496110_0114347 Ga0496110_0114347_975_1937 298
187 3300048914 Ga0496111_0092204 Ga0496111_0092204_773_1735 298
188 3300048915 Ga0496112_0045781 Ga0496112_0045781_3272_4234 298
189 3300048915 Ga0496112_0084935 Ga0496112_0084935_936_1898 298
190 3300048916 Ga0496113_0085240 Ga0496113_0085240_304_1266 298
191 3300050511 nmdc:mga08y16_263625_c1 nmdc:mga08y16_263625_c1_131_1093 298
192 3300050515 nmdc:mga0a205_364453_c1 nmdc:mga0a205_364453_c1_271_1212 298
193 3300005444 Ga0070694_100006398 Ga0070694_1000063985 299
194 3300005545 Ga0070695_100046469 Ga0070695_1000464693 299
195 3300035085 Ga0373929_0013107 Ga0373929_0013107_609_1574 299
196 3300035207 Ga0373942_0024581 Ga0373942_0024581_189_1154 299
197 3300048905 Ga0496102_0015658 Ga0496102_0015658_3527_4492 299
198 3300006844 Ga0075428_100017303 Ga0075428_1000173035 300
199 3300044673 Ga0453683_0030814 Ga0453683_0030814_934_1896 301
200 3300048915 Ga0496112_0205694 Ga0496112_0205694_604_1515 301
201 3300005445 Ga0070708_100443364 Ga0070708_1004433642 302
202 3300005467 Ga0070706_100007748 Ga0070706_1000077486 302
203 3300005471 Ga0070698_100000588 Ga0070698_10000058827 302
204 3300005471 Ga0070698_100062050 Ga0070698_1000620503 302
205 3300005471 Ga0070698_100257753 Ga0070698_1002577531 302
206 3300006914 Ga0075436_100005939 Ga0075436_1000059399 302
207 3300007076 Ga0075435_100209426 Ga0075435_1002094262 302
208 3300028563 Ga0265319_1016205 Ga0265319_10162054 302
209 3300028573 Ga0265334_10010862 Ga0265334_100108622 302
210 3300028577 Ga0265318_10007401 Ga0265318_100074013 302
211 3300028800 Ga0265338_10089742 Ga0265338_100897422 302
212 3300031240 Ga0265320_10059499 Ga0265320_100594992 302
213 3300031250 Ga0265331_10078640 Ga0265331_100786402 302
214 3300031344 Ga0265316_10020319 Ga0265316_100203193 302
215 3300031711 Ga0265314_10003427 Ga0265314_1000342719 302
216 3300037312 Ga0395899_0033324 Ga0395899_0033324_2469_3401 302
217 3300037418 Ga0395900_0001207 Ga0395900_0001207_3298_4230 302
218 3300037418 Ga0395900_0005728 Ga0395900_0005728_9646_10578 302
219 3300037466 Ga0395898_0002790 Ga0395898_0002790_6988_7920 302
220 3300037466 Ga0395898_0346201 Ga0395898_0346201_434_1366 302
221 3300037471 Ga0395905_0001822 Ga0395905_0001822_18699_19631 302
222 3300037471 Ga0395905_0059109 Ga0395905_0059109_83_1015 302
223 3300038443 Ga0395901_0003479 Ga0395901_0003479_9531_10463 302
224 3300038443 Ga0395901_0003728 Ga0395901_0003728_1129_2061 302
225 3300044673 Ga0453683_0088722 Ga0453683_0088722_872_1819 302
226 3300044673 Ga0453683_0171395 Ga0453683_0171395_277_1224 302
227 3300045051 Ga0451576_0003678 Ga0451576_0003678_13705_14652 302
228 3300046472 Ga0495580_0121205 Ga0495580_0121205_792_1739 302
229 3300046642 Ga0495634_0102558 Ga0495634_0102558_761_1696 302
230 3300050513 nmdc:mga0rr50_116754_c1 nmdc:mga0rr50_116754_c1_10_957 302
231 3300005329 Ga0070683_100374438 Ga0070683_1003744381 303
232 3300005341 Ga0070691_10010514 Ga0070691_100105143 303
233 3300005441 Ga0070700_100418527 Ga0070700_1004185271 303
234 3300005458 Ga0070681_10067510 Ga0070681_100675104 303
235 3300005535 Ga0070684_100424545 Ga0070684_1004245451 303
236 3300005547 Ga0070693_100019750 Ga0070693_1000197502 303
237 3300005937 Ga0081455_10018635 Ga0081455_100186355 303
238 3300025944 Ga0207661_10273817 Ga0207661_102738171 303
239 3300026121 Ga0207683_10025614 Ga0207683_100256146 303
240 3300037312 Ga0395899_0002472 Ga0395899_0002472_3310_4251 303
241 3300037312 Ga0395899_0104152 Ga0395899_0104152_712_1656 303
242 3300037418 Ga0395900_0008323 Ga0395900_0008323_3908_4849 303
243 3300037466 Ga0395898_0001088 Ga0395898_0001088_39769_40710 303
244 3300037471 Ga0395905_0050644 Ga0395905_0050644_1100_2041 303
245 3300038443 Ga0395901_0002285 Ga0395901_0002285_4363_5304 303
246 3300038443 Ga0395901_0005005 Ga0395901_0005005_11608_12552 303
247 3300048905 Ga0496102_0070689 Ga0496102_0070689_1839_2780 303
248 3300048908 Ga0496105_0048054 Ga0496105_0048054_2523_3464 303
249 3300048910 Ga0496107_0074872 Ga0496107_0074872_61_1002 303
250 3300048911 Ga0496108_0002438 Ga0496108_0002438_3884_4825 303
251 3300048912 Ga0496109_0067910 Ga0496109_0067910_580_1521 303
252 3300048915 Ga0496112_0088840 Ga0496112_0088840_115_1056 303
253 3300048916 Ga0496113_0009464 Ga0496113_0009464_14_955 303
254 3300049571 Ga0501034_0315291 Ga0501034_0315291_486_1424 303
255 3300049583 Ga0501067_0005972 Ga0501067_0005972_4411_5352 303
256 3300049586 Ga0501070_0180229 Ga0501070_0180229_70_1011 303
257 3300061734 Ga0530510_0062767 Ga0530510_0062767_1652_2593 303
258 3300005435 Ga0070714_100103320 Ga0070714_1001033203 304
259 3300006028 Ga0070717_10038539 Ga0070717_100385392 304
260 3300025929 Ga0207664_10463899 Ga0207664_104638991 304
261 3300032002 Ga0307416_100033095 Ga0307416_1000330955 304
262 3300038698 Ga0242419_001705 Ga0242419_001705_186_1136 304
263 iso_pu_bacteria 2512564013 2512639459 304
264 iso_pu_bacteria 2857460504 2857460689 304
265 iso_pu_bacteria 2857465823 2857465905 304
266 iso_pu_bacteria 2857591370 2857593925 304
267 iso_pu_bacteria 2915597211 2915599916 304
268 iso_pu_bacteria 2929183550 2929185095 304
269 3300005406 Ga0070703_10000141 Ga0070703_100001414 305
270 3300005440 Ga0070705_100007260 Ga0070705_1000072604 305
271 3300005444 Ga0070694_100012643 Ga0070694_1000126434 305
272 3300005444 Ga0070694_100077997 Ga0070694_1000779972 305
273 3300005445 Ga0070708_100109329 Ga0070708_1001093292 305
274 3300005467 Ga0070706_100020867 Ga0070706_1000208673 305
275 3300005467 Ga0070706_100119847 Ga0070706_1001198472 305
276 3300005467 Ga0070706_100141561 Ga0070706_1001415612 305
277 3300005468 Ga0070707_100019542 Ga0070707_1000195423 305
278 3300005468 Ga0070707_100070945 Ga0070707_1000709452 305
279 3300005468 Ga0070707_100132928 Ga0070707_1001329282 305
280 3300005471 Ga0070698_100022851 Ga0070698_1000228511 305
281 3300005518 Ga0070699_100023516 Ga0070699_1000235162 305
282 3300005518 Ga0070699_100075978 Ga0070699_1000759783 305
283 3300005518 Ga0070699_100149521 Ga0070699_1001495212 305
284 3300005536 Ga0070697_100006687 Ga0070697_1000066875 305
285 3300005536 Ga0070697_100031584 Ga0070697_1000315843 305
286 3300005545 Ga0070695_100017718 Ga0070695_1000177182 305
287 3300005545 Ga0070695_100083524 Ga0070695_1000835242 305
288 3300005546 Ga0070696_100000972 Ga0070696_1000009722 305
289 3300005546 Ga0070696_100001632 Ga0070696_1000016325 305
290 3300005546 Ga0070696_100004068 Ga0070696_1000040686 305
291 3300005549 Ga0070704_100003237 Ga0070704_1000032377 305
292 3300005549 Ga0070704_100006805 Ga0070704_1000068054 305
293 3300005549 Ga0070704_100220945 Ga0070704_1002209452 305
294 3300005937 Ga0081455_10013131 Ga0081455_100131316 305
295 3300005983 Ga0081540_1019241 Ga0081540_10192411 305
296 3300006852 Ga0075433_10014932 Ga0075433_100149322 305
297 3300006852 Ga0075433_10022900 Ga0075433_100229004 305
298 3300006914 Ga0075436_100041760 Ga0075436_1000417603 305
299 3300006914 Ga0075436_100082911 Ga0075436_1000829113 305
300 3300007076 Ga0075435_100000602 Ga0075435_1000006022 305
301 3300007076 Ga0075435_100212056 Ga0075435_1002120562 305
302 3300007076 Ga0075435_100334957 Ga0075435_1003349571 305
303 3300025885 Ga0207653_10000041 Ga0207653_1000004189 305
304 3300025910 Ga0207684_10013502 Ga0207684_100135023 305
305 3300025910 Ga0207684_10212088 Ga0207684_102120881 305
306 3300025917 Ga0207660_10027461 Ga0207660_100274612 305
307 3300025922 Ga0207646_10031201 Ga0207646_100312013 305
308 3300025922 Ga0207646_10073382 Ga0207646_100733822 305
309 3300027671 Ga0209588_1000268 Ga0209588_10002687 305
310 3300031731 Ga0307405_10436902 Ga0307405_104369021 305
311 3300031824 Ga0307413_10035103 Ga0307413_100351032 305
312 3300031852 Ga0307410_10013448 Ga0307410_100134482 305
313 3300031995 Ga0307409_100087698 Ga0307409_1000876982 305
314 3300031995 Ga0307409_100182486 Ga0307409_1001824862 305
315 3300032005 Ga0307411_10000165 Ga0307411_100001652 305
316 3300032126 Ga0307415_100063121 Ga0307415_1000631212 305
317 3300037312 Ga0395899_0017971 Ga0395899_0017971_4383_5324 305
318 3300037418 Ga0395900_0008866 Ga0395900_0008866_18_959 305
319 3300037466 Ga0395898_0177530 Ga0395898_0177530_127_1068 305
320 3300037471 Ga0395905_0006969 Ga0395905_0006969_3555_4496 305
321 3300038443 Ga0395901_0002719 Ga0395901_0002719_11270_12211 305
322 3300038443 Ga0395901_0014839 Ga0395901_0014839_6958_7899 305
323 3300041406 Ga0439439_0000896 Ga0439439_0000896_863_1822 305
324 3300042438 Ga0439459_0031404 Ga0439459_0031404_26_970 305
325 3300044673 Ga0453683_0076642 Ga0453683_0076642_139_1095 305
326 3300045051 Ga0451576_0119268 Ga0451576_0119268_1417_2373 305
327 3300045051 Ga0451576_0631939 Ga0451576_0631939_21_977 305
328 3300046528 Ga0495642_0059764 Ga0495642_0059764_350_1306 305
329 3300046538 Ga0495609_0072691 Ga0495609_0072691_89_1045 305
330 3300047318 Ga0495636_0073089 Ga0495636_0073089_417_1373 305
331 3300047318 Ga0495636_0109473 Ga0495636_0109473_130_1086 305
332 3300050507 nmdc:mga05p37_234274_c1 nmdc:mga05p37_234274_c1_192_1148 305
333 3300050510 nmdc:mga06r32_186783_c1 nmdc:mga06r32_186783_c1_992_1948 305
334 3300050512 nmdc:mga0n895_209700_c1 nmdc:mga0n895_209700_c1_611_1567 305
335 3300050512 nmdc:mga0n895_89912_c1 nmdc:mga0n895_89912_c1_1706_2662 305
336 3300050513 nmdc:mga0rr50_25993_c1 nmdc:mga0rr50_25993_c1_554_1510 305
337 3300050513 nmdc:mga0rr50_82695_c1 nmdc:mga0rr50_82695_c1_962_1918 305
338 3300050514 nmdc:mga08x19_11207_c1 nmdc:mga08x19_11207_c1_832_1788 305
339 3300050514 nmdc:mga08x19_28733_c1 nmdc:mga08x19_28733_c1_2067_3023 305
340 3300050514 nmdc:mga08x19_39131_c1 nmdc:mga08x19_39131_c1_814_1770 305
341 3300050514 nmdc:mga08x19_62328_c1 nmdc:mga08x19_62328_c1_269_1225 305
342 3300050515 nmdc:mga0a205_28643_c1 nmdc:mga0a205_28643_c1_4273_5229 305
343 3300050515 nmdc:mga0a205_62498_c1 nmdc:mga0a205_62498_c1_494_1450 305
344 3300005328 Ga0070676_10014751 Ga0070676_100147512 306
345 3300005333 Ga0070677_10020873 Ga0070677_100208732 306
346 3300005334 Ga0068869_100002403 Ga0068869_1000024039 306
347 3300005341 Ga0070691_10030710 Ga0070691_100307102 306
348 3300005347 Ga0070668_100083964 Ga0070668_1000839642 306
349 3300005356 Ga0070674_100000417 Ga0070674_10000041717 306
350 3300005367 Ga0070667_100032929 Ga0070667_1000329292 306
351 3300005439 Ga0070711_100004065 Ga0070711_1000040656 306
352 3300005439 Ga0070711_100130012 Ga0070711_1001300121 306
353 3300005440 Ga0070705_100043698 Ga0070705_1000436982 306
354 3300005441 Ga0070700_100091987 Ga0070700_1000919871 306
355 3300005444 Ga0070694_100045824 Ga0070694_1000458242 306
356 3300005456 Ga0070678_100000172 Ga0070678_1000001722 306
357 3300005457 Ga0070662_100000235 Ga0070662_1000002359 306
358 3300005458 Ga0070681_10023981 Ga0070681_100239813 306
359 3300005459 Ga0068867_100000212 Ga0068867_10000021237 306
360 3300005467 Ga0070706_100211976 Ga0070706_1002119762 306
361 3300005471 Ga0070698_100034305 Ga0070698_1000343053 306
362 3300005518 Ga0070699_100003805 Ga0070699_1000038053 306
363 3300005518 Ga0070699_100040468 Ga0070699_1000404682 306
364 3300005518 Ga0070699_100119611 Ga0070699_1001196112 306
365 3300005536 Ga0070697_100020132 Ga0070697_1000201322 306
366 3300005539 Ga0068853_100131889 Ga0068853_1001318892 306
367 3300005543 Ga0070672_100305864 Ga0070672_1003058642 306
368 3300005544 Ga0070686_100071516 Ga0070686_1000715162 306
369 3300005545 Ga0070695_100000600 Ga0070695_10000060017 306
370 3300005545 Ga0070695_100027419 Ga0070695_1000274192 306
371 3300005546 Ga0070696_100005183 Ga0070696_1000051832 306
372 3300005546 Ga0070696_100006176 Ga0070696_1000061762 306
373 3300005546 Ga0070696_100044069 Ga0070696_1000440692 306
374 3300005547 Ga0070693_100180452 Ga0070693_1001804521 306
375 3300005549 Ga0070704_100108796 Ga0070704_1001087962 306
376 3300005564 Ga0070664_100100782 Ga0070664_1001007822 306
377 3300005564 Ga0070664_100318482 Ga0070664_1003184821 306
378 3300005578 Ga0068854_100000686 Ga0068854_10000068616 306
379 3300005615 Ga0070702_100022974 Ga0070702_1000229742 306
380 3300005618 Ga0068864_100007049 Ga0068864_1000070495 306
381 3300005718 Ga0068866_10000113 Ga0068866_100001134 306
382 3300005840 Ga0068870_10013916 Ga0068870_100139162 306
383 3300005937 Ga0081455_10151809 Ga0081455_101518092 306
384 3300005981 Ga0081538_10028155 Ga0081538_100281552 306
385 3300006237 Ga0097621_100008373 Ga0097621_1000083732 306
386 3300006844 Ga0075428_100000665 Ga0075428_10000066529 306
387 3300006881 Ga0068865_100010352 Ga0068865_1000103523 306
388 3300009093 Ga0105240_10011885 Ga0105240_100118859 306
389 3300009094 Ga0111539_10110770 Ga0111539_101107702 306
390 3300009098 Ga0105245_10066779 Ga0105245_100667793 306
391 3300009147 Ga0114129_10006218 Ga0114129_1000621816 306
392 3300009147 Ga0114129_10097432 Ga0114129_100974322 306
393 3300009147 Ga0114129_10338893 Ga0114129_103388931 306
394 3300009148 Ga0105243_10001173 Ga0105243_1000117323 306
395 3300009174 Ga0105241_10055921 Ga0105241_100559212 306
396 3300009176 Ga0105242_10001800 Ga0105242_100018002 306
397 3300009177 Ga0105248_10012592 Ga0105248_100125922 306
398 3300010375 Ga0105239_10051254 Ga0105239_100512542 306
399 3300013297 Ga0157378_10047119 Ga0157378_100471192 306
400 3300013306 Ga0163162_10022311 Ga0163162_100223113 306
401 3300013306 Ga0163162_10025193 Ga0163162_100251936 306
402 3300013307 Ga0157372_10297395 Ga0157372_102973952 306
403 3300013308 Ga0157375_10113592 Ga0157375_101135922 306
404 3300014326 Ga0157380_10245160 Ga0157380_102451602 306
405 3300014968 Ga0157379_10271073 Ga0157379_102710732 306
406 3300025899 Ga0207642_10004609 Ga0207642_100046094 306
407 3300025906 Ga0207699_10272775 Ga0207699_102727752 306
408 3300025906 Ga0207699_10275546 Ga0207699_102755462 306
409 3300025907 Ga0207645_10001077 Ga0207645_1000107716 306
410 3300025910 Ga0207684_10126537 Ga0207684_101265372 306
411 3300025911 Ga0207654_10034656 Ga0207654_100346562 306
412 3300025917 Ga0207660_10135014 Ga0207660_101350142 306
413 3300025917 Ga0207660_10226774 Ga0207660_102267742 306
414 3300025923 Ga0207681_10038703 Ga0207681_100387032 306
415 3300025927 Ga0207687_10017397 Ga0207687_100173972 306
416 3300025933 Ga0207706_10000005 Ga0207706_10000005106 306
417 3300025934 Ga0207686_10000296 Ga0207686_1000029618 306
418 3300025935 Ga0207709_10003132 Ga0207709_100031325 306
419 3300025937 Ga0207669_10006045 Ga0207669_100060453 306
420 3300025938 Ga0207704_10010560 Ga0207704_100105602 306
421 3300025940 Ga0207691_10084205 Ga0207691_100842052 306
422 3300025941 Ga0207711_10003456 Ga0207711_100034562 306
423 3300025942 Ga0207689_10029021 Ga0207689_100290212 306
424 3300025945 Ga0207679_10008283 Ga0207679_100082834 306
425 3300025945 Ga0207679_10108141 Ga0207679_101081412 306
426 3300025961 Ga0207712_10073260 Ga0207712_100732603 306
427 3300025972 Ga0207668_10085963 Ga0207668_100859633 306
428 3300025981 Ga0207640_10001479 Ga0207640_100014792 306
429 3300026075 Ga0207708_10036561 Ga0207708_100365613 306
430 3300026089 Ga0207648_10000008 Ga0207648_10000008174 306
431 3300026095 Ga0207676_10010332 Ga0207676_100103323 306
432 3300026095 Ga0207676_10167452 Ga0207676_101674522 306
433 3300026118 Ga0207675_100059853 Ga0207675_1000598532 306
434 3300026121 Ga0207683_10004563 Ga0207683_100045632 306
435 3300027876 Ga0209974_10025617 Ga0209974_100256172 306
436 3300028380 Ga0268265_10149737 Ga0268265_101497372 306
437 3300031548 Ga0307408_100018440 Ga0307408_1000184402 306
438 3300031548 Ga0307408_100156041 Ga0307408_1001560412 306
439 3300031731 Ga0307405_10039216 Ga0307405_100392163 306
440 3300031731 Ga0307405_10100001 Ga0307405_101000012 306
441 3300031824 Ga0307413_10015828 Ga0307413_100158282 306
442 3300031824 Ga0307413_10041247 Ga0307413_100412472 306
443 3300031824 Ga0307413_10069269 Ga0307413_100692692 306
444 3300031824 Ga0307413_10094898 Ga0307413_100948982 306
445 3300031824 Ga0307413_10250429 Ga0307413_102504291 306
446 3300031852 Ga0307410_10007011 Ga0307410_100070113 306
447 3300031852 Ga0307410_10007617 Ga0307410_100076172 306
448 3300031852 Ga0307410_10110452 Ga0307410_101104521 306
449 3300031852 Ga0307410_10190103 Ga0307410_101901032 306
450 3300031901 Ga0307406_10035430 Ga0307406_100354302 306
451 3300031901 Ga0307406_10157951 Ga0307406_101579512 306
452 3300031903 Ga0307407_10026801 Ga0307407_100268012 306
453 3300031903 Ga0307407_10151633 Ga0307407_101516332 306
454 3300031911 Ga0307412_10210619 Ga0307412_102106192 306
455 3300031911 Ga0307412_10362911 Ga0307412_103629112 306
456 3300031995 Ga0307409_100004334 Ga0307409_1000043342 306
457 3300031995 Ga0307409_100009550 Ga0307409_1000095506 306
458 3300031995 Ga0307409_100031270 Ga0307409_1000312702 306
459 3300032002 Ga0307416_100002674 Ga0307416_1000026749 306
460 3300032002 Ga0307416_100025550 Ga0307416_1000255502 306
461 3300032002 Ga0307416_100034472 Ga0307416_1000344722 306
462 3300032002 Ga0307416_100044149 Ga0307416_1000441492 306
463 3300032002 Ga0307416_100085498 Ga0307416_1000854982 306
464 3300032002 Ga0307416_100111500 Ga0307416_1001115002 306
465 3300032004 Ga0307414_10013612 Ga0307414_100136122 306
466 3300032005 Ga0307411_10022105 Ga0307411_100221052 306
467 3300032005 Ga0307411_10050621 Ga0307411_100506212 306
468 3300032005 Ga0307411_10067047 Ga0307411_100670473 306
469 3300032005 Ga0307411_10101767 Ga0307411_101017672 306
470 3300032126 Ga0307415_100052153 Ga0307415_1000521532 306
471 3300032126 Ga0307415_100066282 Ga0307415_1000662823 306
472 3300032126 Ga0307415_100109660 Ga0307415_1001096602 306
473 3300032126 Ga0307415_100110883 Ga0307415_1001108832 306
474 3300032126 Ga0307415_100179108 Ga0307415_1001791082 306
475 3300035085 Ga0373929_0004520 Ga0373929_0004520_599_1561 306
476 3300035089 Ga0373944_0060966 Ga0373944_0060966_165_1127 306
477 3300042876 Ga0451577_0003860 Ga0451577_0003860_14015_14980 306
478 3300042876 Ga0451577_0060419 Ga0451577_0060419_784_1746 306
479 3300044673 Ga0453683_0235695 Ga0453683_0235695_162_1124 306
480 3300044901 Ga0466960_0101269 Ga0466960_0101269_228_1190 306
481 3300045051 Ga0451576_0072884 Ga0451576_0072884_438_1400 306
482 3300046472 Ga0495580_0085505 Ga0495580_0085505_413_1375 306
483 3300046477 Ga0495664_0006645 Ga0495664_0006645_4379_5341 306
484 3300046499 Ga0495594_0003060 Ga0495594_0003060_5709_6671 306
485 3300046499 Ga0495594_0072165 Ga0495594_0072165_752_1714 306
486 3300046535 Ga0495586_0017256 Ga0495586_0017256_1053_2015 306
487 3300046683 Ga0495658_0131014 Ga0495658_0131014_66_1028 306
488 3300047315 Ga0495581_0122015 Ga0495581_0122015_458_1420 306
489 3300047321 Ga0495676_0243184 Ga0495676_0243184_238_1200 306
490 3300048905 Ga0496102_0321315 Ga0496102_0321315_279_1241 306
491 3300048908 Ga0496105_0053528 Ga0496105_0053528_1466_2428 306
492 3300048909 Ga0496106_0373708 Ga0496106_0373708_147_1109 306
493 3300048911 Ga0496108_0005508 Ga0496108_0005508_1856_2818 306
494 3300048912 Ga0496109_0003563 Ga0496109_0003563_8962_9924 306
495 3300048913 Ga0496110_0005979 Ga0496110_0005979_6234_7196 306
496 3300048914 Ga0496111_0006601 Ga0496111_0006601_4857_5819 306
497 3300048915 Ga0496112_0013660 Ga0496112_0013660_4903_5865 306
498 3300048915 Ga0496112_0261684 Ga0496112_0261684_412_1374 306
499 3300049571 Ga0501034_0007407 Ga0501034_0007407_2808_3773 306
500 3300049572 Ga0501036_0034112 Ga0501036_0034112_1023_1994 306
501 3300049572 Ga0501036_0321296 Ga0501036_0321296_74_1045 306
502 3300049572 Ga0501036_0418257 Ga0501036_0418257_106_1077 306
503 3300049573 Ga0501037_0217015 Ga0501037_0217015_127_1098 306
504 3300049574 Ga0501038_0025744 Ga0501038_0025744_3062_4033 306
505 3300049574 Ga0501038_0222040 Ga0501038_0222040_497_1468 306
506 3300049575 Ga0501039_0075270 Ga0501039_0075270_1394_2365 306
507 3300049576 Ga0501040_0039174 Ga0501040_0039174_938_1909 306
508 3300049576 Ga0501040_0071967 Ga0501040_0071967_751_1722 306
509 3300049576 Ga0501040_0267471 Ga0501040_0267471_64_1035 306
510 3300049577 Ga0501041_0013881 Ga0501041_0013881_1051_2022 306
511 3300049577 Ga0501041_0172890 Ga0501041_0172890_312_1274 306
512 3300049578 Ga0501042_0298674 Ga0501042_0298674_52_1014 306
513 3300049580 Ga0501046_0047153 Ga0501046_0047153_458_1429 306
514 3300049582 Ga0501048_0020618 Ga0501048_0020618_589_1560 306
515 3300049583 Ga0501067_0015410 Ga0501067_0015410_2986_3948 306
516 3300049583 Ga0501067_0018508 Ga0501067_0018508_917_1879 306
517 3300049585 Ga0501069_0000689 Ga0501069_0000689_586_1551 306
518 3300049585 Ga0501069_0126094 Ga0501069_0126094_388_1350 306
519 3300049586 Ga0501070_0025563 Ga0501070_0025563_86_1051 306
520 3300049587 Ga0501071_0014896 Ga0501071_0014896_3369_4340 306
521 3300049587 Ga0501071_0016584 Ga0501071_0016584_75_1040 306
522 3300049587 Ga0501071_0102099 Ga0501071_0102099_475_1437 306
523 3300049588 Ga0501072_0014314 Ga0501072_0014314_1154_2125 306
524 3300049590 Ga0501074_0051417 Ga0501074_0051417_1667_2638 306
525 3300049590 Ga0501074_0115330 Ga0501074_0115330_399_1361 306
526 3300049591 Ga0501075_0061267 Ga0501075_0061267_573_1544 306
527 3300049591 Ga0501075_0168989 Ga0501075_0168989_362_1333 306
528 3300049592 Ga0501076_0048031 Ga0501076_0048031_1679_2641 306
529 3300049592 Ga0501076_0210914 Ga0501076_0210914_519_1490 306
530 3300049592 Ga0501076_0497247 Ga0501076_0497247_16_978 306
531 3300049593 Ga0501077_0002040 Ga0501077_0002040_10022_10993 306
532 3300049593 Ga0501077_0042832 Ga0501077_0042832_1073_2035 306
533 3300049679 Ga0501249_000958 Ga0501249_000958_2233_3195 306
534 3300049705 Ga0501225_0021050 Ga0501225_0021050_654_1625 306
535 3300049741 Ga0501079_0001685 Ga0501079_0001685_2167_3138 306
536 3300049742 Ga0501080_0005592 Ga0501080_0005592_3724_4689 306
537 3300049742 Ga0501080_0055403 Ga0501080_0055403_1818_2780 306
538 3300049742 Ga0501080_0096824 Ga0501080_0096824_1061_2032 306
539 3300049742 Ga0501080_0409709 Ga0501080_0409709_20_982 306
540 3300049743 Ga0501081_0003218 Ga0501081_0003218_6568_7539 306
541 3300049743 Ga0501081_0039977 Ga0501081_0039977_2008_2970 306
542 3300049743 Ga0501081_0049877 Ga0501081_0049877_428_1390 306
543 3300049743 Ga0501081_0253745 Ga0501081_0253745_25_987 306
544 3300049744 Ga0501083_0028432 Ga0501083_0028432_2809_3774 306
545 3300049769 Ga0501272_000438 Ga0501272_000438_378_1340 306
546 3300049775 Ga0501279_010501 Ga0501279_010501_173_1144 306
547 3300049824 Ga0501045_0007510 Ga0501045_0007510_2235_3206 306
548 3300049824 Ga0501045_0022179 Ga0501045_0022179_598_1569 306
549 3300049824 Ga0501045_0096168 Ga0501045_0096168_995_1957 306
550 3300050507 nmdc:mga05p37_346_c1 nmdc:mga05p37_346_c1_1712_2656 306
551 3300050510 nmdc:mga06r32_29280_c1 nmdc:mga06r32_29280_c1_3805_4767 306
552 3300050510 nmdc:mga06r32_35029_c1 nmdc:mga06r32_35029_c1_2727_3671 306
553 3300050515 nmdc:mga0a205_21501_c1 nmdc:mga0a205_21501_c1_406_1368 306
554 3300054114 Ga0501084_0006395 Ga0501084_0006395_36_1001 306
555 3300054114 Ga0501084_0013453 Ga0501084_0013453_321_1292 306
556 3300054114 Ga0501084_0040850 Ga0501084_0040850_2168_3130 306
557 3300054114 Ga0501084_0078552 Ga0501084_0078552_949_1920 306
558 3300059421 Ga0590071_003167 Ga0590071_003167_1027_1998 306
559 3300059421 Ga0590071_007530 Ga0590071_007530_968_1939 306
560 3300059424 Ga0590075_008578 Ga0590075_008578_758_1729 306
561 3300060353 Ga0501082_0016430 Ga0501082_0016430_4804_5775 306
562 3300060353 Ga0501082_0129817 Ga0501082_0129817_385_1356 306
563 3300061734 Ga0530510_0090337 Ga0530510_0090337_567_1529 306
564 3300005337 Ga0070682_100009960 Ga0070682_1000099603 307
565 3300005435 Ga0070714_100057012 Ga0070714_1000570122 307
566 3300005436 Ga0070713_100105297 Ga0070713_1001052973 307
567 3300005439 Ga0070711_100033054 Ga0070711_1000330542 307
568 3300006175 Ga0070712_100411933 Ga0070712_1004119331 307
569 3300006871 Ga0075434_100035095 Ga0075434_1000350954 307
570 3300025915 Ga0207693_10045631 Ga0207693_100456312 307
571 3300025929 Ga0207664_10062044 Ga0207664_100620443 307
572 3300028577 Ga0265318_10018073 Ga0265318_100180732 307
573 3300028800 Ga0265338_10112616 Ga0265338_101126162 307
574 3300031235 Ga0265330_10071737 Ga0265330_100717372 307
575 3300031238 Ga0265332_10030414 Ga0265332_100304142 307
576 3300031241 Ga0265325_10015719 Ga0265325_100157195 307
577 3300031241 Ga0265325_10018834 Ga0265325_100188341 307
578 3300031249 Ga0265339_10028296 Ga0265339_100282962 307
579 3300031344 Ga0265316_10069709 Ga0265316_100697092 307
580 3300031595 Ga0265313_10016232 Ga0265313_100162323 307
581 3300031711 Ga0265314_10005023 Ga0265314_100050233 307
582 3300031712 Ga0265342_10094937 Ga0265342_100949372 307
583 3300048915 Ga0496112_0273883 Ga0496112_0273883_528_1472 307
584 3300048918 Ga0496115_0374128 Ga0496115_0374128_115_1059 307
585 3300061734 Ga0530510_0123106 Ga0530510_0123106_181_1146 307
586 3300006038 Ga0075365_10055827 Ga0075365_100558273 308
587 3300048907 Ga0496104_0037877 Ga0496104_0037877_2910_3842 308
588 3300005458 Ga0070681_10084845 Ga0070681_100848452 309
589 3300005536 Ga0070697_100142924 Ga0070697_1001429242 309
590 3300005563 Ga0068855_100265469 Ga0068855_1002654691 309
591 3300041413 Ga0439465_0014429 Ga0439465_0014429_1235_2167 309
592 3300042439 Ga0439464_0061228 Ga0439464_0061228_31_1023 311
593 3300006051 Ga0075364_10035294 Ga0075364_100352943 312
594 3300006177 Ga0075362_10055711 Ga0075362_100557112 312
595 3300006194 Ga0075427_10002923 Ga0075427_100029232 312
596 3300006846 Ga0075430_100129038 Ga0075430_1001290382 312
597 3300006880 Ga0075429_100124802 Ga0075429_1001248022 312
598 3300009147 Ga0114129_10099546 Ga0114129_100995464 313
599 3300050507 nmdc:mga05p37_290208_c1 nmdc:mga05p37_290208_c1_923_1870 313
600 3300050515 nmdc:mga0a205_68387_c1 nmdc:mga0a205_68387_c1_1873_2820 313
601 3300005347 Ga0070668_100120331 Ga0070668_1001203312 315
602 3300005354 Ga0070675_100238574 Ga0070675_1002385742 315
603 3300005459 Ga0068867_100061882 Ga0068867_1000618823 315
604 3300005535 Ga0070684_100031078 Ga0070684_1000310782 315
605 3300005543 Ga0070672_100068055 Ga0070672_1000680553 315
606 3300009098 Ga0105245_10052342 Ga0105245_100523421 315
607 3300010375 Ga0105239_10036624 Ga0105239_100366243 315
608 3300014745 Ga0157377_10108340 Ga0157377_101083402 315
609 3300025901 Ga0207688_10012123 Ga0207688_100121234 315
610 3300025926 Ga0207659_10244669 Ga0207659_102446692 315
611 3300026075 Ga0207708_10146532 Ga0207708_101465322 315
612 3300026089 Ga0207648_10431234 Ga0207648_104312342 315
613 3300037418 Ga0395900_0091480 Ga0395900_0091480_1918_2889 316
614 3300037418 Ga0395900_0288436 Ga0395900_0288436_189_1157 316
615 3300037466 Ga0395898_0030677 Ga0395898_0030677_2056_3027 316
616 3300037471 Ga0395905_0029039 Ga0395905_0029039_2628_3599 316
617 3300046473 Ga0495582_0193722 Ga0495582_0193722_112_1083 316
618 3300046473 Ga0495582_0208948 Ga0495582_0208948_131_1102 316
619 3300046615 Ga0495656_0034550 Ga0495656_0034550_615_1586 316
620 3300046681 Ga0495647_0064385 Ga0495647_0064385_101_1072 316
621 3300046683 Ga0495658_0076016 Ga0495658_0076016_870_1841 316
622 3300046690 Ga0495624_0061727 Ga0495624_0061727_278_1249 316
623 3300047315 Ga0495581_0000299 Ga0495581_0000299_5586_6557 316
624 3300047321 Ga0495676_0011923 Ga0495676_0011923_40_1011 316
625 3300005937 Ga0081455_10044037 Ga0081455_100440373 317
626 3300005981 Ga0081538_10047517 Ga0081538_100475173 318
627 3300050511 nmdc:mga08y16_226181_c1 nmdc:mga08y16_226181_c1_699_1700 318
628 3300050515 nmdc:mga0a205_212896_c1 nmdc:mga0a205_212896_c1_481_1482 318
629 3300005981 Ga0081538_10097149 Ga0081538_100971492 319
630 3300037466 Ga0395898_0326498 Ga0395898_0326498_340_1311 319
631 3300003373 JGI25407J50210_10000027 JGI25407J50210_1000002716 320
632 3300005937 Ga0081455_10003760 Ga0081455_1000376013 320
633 3300005937 Ga0081455_10007369 Ga0081455_100073692 320
634 3300005937 Ga0081455_10024581 Ga0081455_100245813 320
635 3300005981 Ga0081538_10000100 Ga0081538_100001004 320
636 3300005981 Ga0081538_10000254 Ga0081538_1000025466 320
637 3300005981 Ga0081538_10000820 Ga0081538_1000082010 320
638 3300005981 Ga0081538_10003447 Ga0081538_1000344713 320
639 3300009094 Ga0111539_10439859 Ga0111539_104398592 320
640 3300037312 Ga0395899_0002355 Ga0395899_0002355_6928_7908 320
641 3300037312 Ga0395899_0003130 Ga0395899_0003130_3628_4608 320
642 3300037418 Ga0395900_0014115 Ga0395900_0014115_41_1021 320
643 3300037418 Ga0395900_0019538 Ga0395900_0019538_5025_5999 320
644 3300037466 Ga0395898_0059624 Ga0395898_0059624_1014_1994 320
645 3300037466 Ga0395898_0089295 Ga0395898_0089295_30_1004 320
646 3300037471 Ga0395905_0078430 Ga0395905_0078430_398_1378 320
647 3300037471 Ga0395905_0107477 Ga0395905_0107477_603_1583 320
648 3300038443 Ga0395901_0002069 Ga0395901_0002069_10977_11957 320
649 3300038443 Ga0395901_0058399 Ga0395901_0058399_2335_3315 320
650 3300038443 Ga0395901_0175559 Ga0395901_0175559_829_1803 320
651 3300042119 Ga0450915_000083 Ga0450915_000083_64_1053 320
652 3300049570 Ga0501033_0000939 Ga0501033_0000939_972_1961 320
653 3300049573 Ga0501037_0002891 Ga0501037_0002891_11049_12038 320
654 3300049576 Ga0501040_0025993 Ga0501040_0025993_2529_3518 320
655 3300049577 Ga0501041_0014347 Ga0501041_0014347_1298_2287 320
656 3300049578 Ga0501042_0090920 Ga0501042_0090920_243_1232 320
657 3300049579 Ga0501043_0006223 Ga0501043_0006223_8327_9316 320
658 3300049580 Ga0501046_0006055 Ga0501046_0006055_4632_5621 320
659 3300049582 Ga0501048_0003885 Ga0501048_0003885_1511_2500 320
660 3300049584 Ga0501068_0018705 Ga0501068_0018705_1421_2410 320
661 3300049585 Ga0501069_0011109 Ga0501069_0011109_1149_2138 320
662 3300049586 Ga0501070_0080847 Ga0501070_0080847_1330_2319 320
663 3300049589 Ga0501073_0009788 Ga0501073_0009788_4177_5166 320
664 3300049590 Ga0501074_0011723 Ga0501074_0011723_4760_5749 320
665 3300049591 Ga0501075_0020752 Ga0501075_0020752_420_1409 320
666 3300049741 Ga0501079_0281262 Ga0501079_0281262_176_1156 320
667 3300049742 Ga0501080_0066839 Ga0501080_0066839_1604_2593 320
668 3300049743 Ga0501081_0059008 Ga0501081_0059008_195_1175 320
669 3300050491 nmdc:mga00v17_41663_c1 nmdc:mga00v17_41663_c1_1141_2130 320
670 3300050493 nmdc:mga0k408_119938_c1 nmdc:mga0k408_119938_c1_337_1326 320
671 3300050510 nmdc:mga06r32_99960_c1 nmdc:mga06r32_99960_c1_1190_2179 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

15

322

0.98

PF01039

Carboxyl_trans

Carboxyl transferase domain

50

292

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9201 34 307
2f9i-assembly1.cif.gz_A crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9023 30 308
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9019 30 308
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.856 7 308
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.8379 30 308
ID Description Score Start End Superfamily
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9071 49 307 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8904 49 307 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8318 7 308 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7985 7 308 3.90.226.10
4l6wA02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7739 37 284 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A2N8GSY0-F1-model_v4 deleted 0.9641 92 186
AF-A0A0P9DLY9-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9628 50 155 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A1G3JA39-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9607 49 278 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A3C1LYA3-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9606 50 190 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A1S9CM11-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9596 49 310 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295

Feature Viewer

pLDDT pTM Quality
85.11 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map