F474166

General Info

Members Datasets Scaffolds Average Seq Length
671 340 1342 389

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10000228|Ga0307511_1000022824
Length 431
Sequence MINEGLKFGCKGKGEQGKIRNSIAQIPKNVYSSSELSIFALSDHFMQLIPITTPSQAKEFIQANVQLNRQNPAYIRPIDAEIDEVFDPAKNKAFRHGEITRWVLKDEEGKLIGRIAAFVNKKYKTKGDDVPVGGIGFFDCINDQEAADMLLDVARHWLSQRGMEAMDGPINFGERDKWWGLLTEGFYEPLYGMNFNPPYYRELLENYGFRPFFHQLCFSMDYKKPLNAKLQRRHETLAADPAYSARMIDKRQLLKFAEDFIAIYNPAYAGHGGLKEMKKDQAVQLFKKMKPLMDEKIVWFVYHNERPIAMFLNIPDLNQYFKHFNGRFGLLQKLYFLWLRRRGACKRFTGILFAIIPEFQGKGVDGYMIVEAGKVVQHQSSYEDYEMQWIGDFNPKMVNIAKGLGEVNRKLTTYRYLFDRAKEFKRHPMLS

Samples

Sample ID Description Type Environment
1 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
109 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
111 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
190 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
191 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
192 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
193 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
198 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
222 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
261 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
262 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
263 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
264 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
265 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
266 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
267 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
268 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
269 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
272 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
281 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
282 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
283 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
284 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
285 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
286 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
289 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
293 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
294 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
295 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
296 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
297 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
298 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
299 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
300 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
301 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
302 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
303 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
304 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
305 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
306 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
307 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
308 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
309 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
310 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
311 2738541278 Niastella sp. CF465 Isolate Unclassified
312 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
313 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
314 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
315 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
316 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
317 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
318 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
319 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
320 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
321 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
322 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
323 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
324 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
325 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
326 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
327 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
328 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
329 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
330 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
331 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
332 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
333 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
334 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
335 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
336 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
337 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
338 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
339 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
340 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.55
Metatranscriptomes 0
Isolates 7.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 5.96
Nodule 0.15
Rhizoplane 0.6
Rhizosphere 84.95
Stem 0
Stem Tuber 0
Unclassified 3.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307511_10000228 3300030521 Bacteria 57237
2 JGI24741J21665_1002211 3300001915 Bacteria 5163
3 JGI24744J21845_10007449 3300002077 Bacteria 2261
4 rootH1_10079717 3300003316 Bacteria 3130
5 rootH2_10009982 3300003320 Bacteria 25986
6 rootH2_10037920 3300003320 Bacteria 1945
7 rootH2_10050136 3300003320 Bacteria 12982
8 rootH2_10076592 3300003320 Bacteria 1912
9 rootL2_10266713 3300003322 Unclassified 1345
10 rootH1_10098969 3300003323 Bacteria 10813
11 rootH1_10259345 3300003323 Bacteria 6300
12 JGI25160J50197_1002332 3300003354 Bacteria 8881
13 Ga0055535_1007746 3300003761 Bacteria 2013
14 Ga0055534_1014363 3300003784 Bacteria 1486
15 Ga0055528_1000307 3300003790 Bacteria 41483
16 Ga0055528_1007947 3300003790 Bacteria 4622
17 Ga0055530_10001712 3300003791 Bacteria 15455
18 Ga0055531_10029535 3300003794 Unclassified 1865
19 Ga0055543_1006891 3300004625 Bacteria 2689
20 Ga0065165_1000722 3300005262 Bacteria 46444
21 Ga0065704_10020003 3300005289 Bacteria 1572
22 Ga0065707_10159377 3300005295 Bacteria 1577
23 Ga0070658_10036022 3300005327 Bacteria 3987
24 Ga0070658_10063362 3300005327 Unclassified 3014
25 Ga0070658_10076384 3300005327 Bacteria 2747
26 Ga0070658_10101670 3300005327 Bacteria 2376
27 Ga0070676_10005231 3300005328 Bacteria 6897
28 Ga0070676_10061783 3300005328 Bacteria 2227
29 Ga0070683_100004016 3300005329 Bacteria 12045
30 Ga0070683_100131528 3300005329 Bacteria 2368
31 Ga0070690_100052813 3300005330 Bacteria 2599
32 Ga0070690_100138638 3300005330 Bacteria 1649
33 Ga0070690_100149921 3300005330 Bacteria 1590
34 Ga0068869_100018653 3300005334 Bacteria 4727
35 Ga0068869_100029041 3300005334 Bacteria 3870
36 Ga0068869_100033033 3300005334 Bacteria 3651
37 Ga0068869_100052755 3300005334 Bacteria 2954
38 Ga0068869_100085349 3300005334 Bacteria 2365
39 Ga0070666_10000031 3300005335 Bacteria 132089
40 Ga0070666_10015920 3300005335 Bacteria 4804
41 Ga0070666_10158582 3300005335 Bacteria 1581
42 Ga0070680_100019674 3300005336 Bacteria 5354
43 Ga0070680_100052971 3300005336 Bacteria 3312
44 Ga0070680_100139304 3300005336 Bacteria 2034
45 Ga0070682_100000152 3300005337 Bacteria 54283
46 Ga0070682_100001276 3300005337 Bacteria 14283
47 Ga0070682_100032428 3300005337 Bacteria 3168
48 Ga0068868_100037647 3300005338 Bacteria 3751
49 Ga0068868_100341245 3300005338 Bacteria 1281
50 Ga0070660_100000201 3300005339 Bacteria 39920
51 Ga0070660_100027411 3300005339 Bacteria 4251
52 Ga0070660_100032879 3300005339 Bacteria 3907
53 Ga0070660_100063853 3300005339 Bacteria 2863
54 Ga0070689_100004257 3300005340 Bacteria 9644
55 Ga0070689_100065057 3300005340 Bacteria 2839
56 Ga0070689_100107592 3300005340 Bacteria 2214
57 Ga0070689_100214550 3300005340 Bacteria 1576
58 Ga0070687_100016820 3300005343 Bacteria 3348
59 Ga0070687_100067809 3300005343 Bacteria 1906
60 Ga0070661_100223479 3300005344 Bacteria 1445
61 Ga0070668_100049616 3300005347 Bacteria 3229
62 Ga0070669_100110056 3300005353 Bacteria 2089
63 Ga0070669_100289760 3300005353 Bacteria 1314
64 Ga0070675_100040413 3300005354 Bacteria 3807
65 Ga0070675_100061496 3300005354 Bacteria 3101
66 Ga0070675_100078587 3300005354 Bacteria 2748
67 Ga0070675_100107187 3300005354 Bacteria 2359
68 Ga0070671_100033594 3300005355 Unclassified 4244
69 Ga0070673_100034978 3300005364 Bacteria 3807
70 Ga0070673_100052550 3300005364 Bacteria 3197
71 Ga0070688_100003898 3300005365 Bacteria 7739
72 Ga0070688_100121359 3300005365 Bacteria 1751
73 Ga0070688_100122504 3300005365 Unclassified 1744
74 Ga0070659_100004878 3300005366 Bacteria 9586
75 Ga0070667_100004341 3300005367 Bacteria 11955
76 Ga0070667_100017484 3300005367 Bacteria 5943
77 Ga0070667_100095160 3300005367 Bacteria 2567
78 Ga0070667_100184404 3300005367 Bacteria 1846
79 Ga0070667_100231935 3300005367 Bacteria 1646
80 Ga0070700_100056409 3300005441 Bacteria 2462
81 Ga0070663_100224131 3300005455 Bacteria 1477
82 Ga0070662_100074215 3300005457 Bacteria 2515
83 Ga0070681_10016117 3300005458 Bacteria 7450
84 Ga0070681_10078377 3300005458 Bacteria 3261
85 Ga0068867_100011283 3300005459 Bacteria 6302
86 Ga0070685_10004480 3300005466 Bacteria 7066
87 Ga0070685_10023197 3300005466 Bacteria 3395
88 Ga0070698_100001241 3300005471 Bacteria 28439
89 Ga0070698_100003438 3300005471 Bacteria 17408
90 Ga0070698_100010706 3300005471 Bacteria 9767
91 Ga0070698_100168177 3300005471 Bacteria 2134
92 Ga0070679_100000836 3300005530 Bacteria 26787
93 Ga0070679_100034505 3300005530 Bacteria 5014
94 Ga0070684_100000232 3300005535 Bacteria 38587
95 Ga0070684_100004401 3300005535 Bacteria 10717
96 Ga0070684_100145662 3300005535 Bacteria 2144
97 Ga0068853_100000103 3300005539 Bacteria 57277
98 Ga0068853_100015582 3300005539 Bacteria 6245
99 Ga0068853_100040621 3300005539 Bacteria 3970
100 Ga0068853_100108228 3300005539 Bacteria 2466
101 Ga0068853_100312223 3300005539 Bacteria 1456
102 Ga0070672_100079740 3300005543 Bacteria 2621
103 Ga0070686_100008636 3300005544 Bacteria 5708
104 Ga0070693_100129416 3300005547 Bacteria 1576
105 Ga0070665_100004340 3300005548 Bacteria 14914
106 Ga0070665_100202416 3300005548 Unclassified 1986
107 Ga0068855_100031705 3300005563 Bacteria 6310
108 Ga0068855_100041522 3300005563 Bacteria 5451
109 Ga0068855_100078179 3300005563 Bacteria 3839
110 Ga0068855_100113607 3300005563 Bacteria 3106
111 Ga0068855_100127024 3300005563 Bacteria 2915
112 Ga0068855_100133045 3300005563 Bacteria 2839
113 Ga0070664_100205394 3300005564 Bacteria 1759
114 Ga0068857_100003404 3300005577 Bacteria 13251
115 Ga0068857_100004875 3300005577 Bacteria 11385
116 Ga0068857_100012331 3300005577 Bacteria 7439
117 Ga0068857_100103068 3300005577 Bacteria 2562
118 Ga0068854_100091866 3300005578 Bacteria 2260
119 Ga0068856_100025473 3300005614 Bacteria 5769
120 Ga0068856_100123380 3300005614 Bacteria 2593
121 Ga0068856_100165314 3300005614 Bacteria 2224
122 Ga0068856_100270077 3300005614 Unclassified 1717
123 Ga0068856_100282956 3300005614 Bacteria 1675
124 Ga0070702_100009538 3300005615 Bacteria 4755
125 Ga0068852_100001078 3300005616 Bacteria 18040
126 Ga0068852_100011910 3300005616 Bacteria 6577
127 Ga0068852_100063037 3300005616 Bacteria 3226
128 Ga0068859_100000045 3300005617 Bacteria 143607
129 Ga0068859_100030038 3300005617 Bacteria 5453
130 Ga0068859_100033339 3300005617 Bacteria 5172
131 Ga0068859_100094941 3300005617 Unclassified 3035
132 Ga0068859_100097286 3300005617 Bacteria 2996
133 Ga0068859_100141676 3300005617 Bacteria 2478
134 Ga0068864_100001622 3300005618 Bacteria 18523
135 Ga0068864_100045766 3300005618 Bacteria 3754
136 Ga0068861_100003382 3300005719 Bacteria 10578
137 Ga0068870_10036100 3300005840 Bacteria 2541
138 Ga0068863_100003089 3300005841 Bacteria 16457
139 Ga0068863_100006337 3300005841 Bacteria 11603
140 Ga0068863_100271972 3300005841 Bacteria 1640
141 Ga0068858_100024945 3300005842 Bacteria 5565
142 Ga0068858_100084450 3300005842 Bacteria 2953
143 Ga0068858_100126819 3300005842 Unclassified 2390
144 Ga0068860_100001289 3300005843 Bacteria 27204
145 Ga0068860_100007137 3300005843 Bacteria 11176
146 Ga0068860_100010059 3300005843 Bacteria 9372
147 Ga0068860_100011449 3300005843 Bacteria 8738
148 Ga0068860_100044074 3300005843 Bacteria 4253
149 Ga0068862_100035626 3300005844 Bacteria 4216
150 Ga0081540_1021338 3300005983 Bacteria 3861
151 Ga0075366_10017458 3300006195 Bacteria 4130
152 Ga0075366_10121674 3300006195 Bacteria 1573
153 Ga0097621_100001013 3300006237 Bacteria 19778
154 Ga0097621_100011779 3300006237 Bacteria 6458
155 Ga0097621_100154600 3300006237 Bacteria 1968
156 Ga0097621_100163905 3300006237 Bacteria 1912
157 Ga0068871_100007075 3300006358 Bacteria 7998
158 Ga0068871_100015208 3300006358 Bacteria 5754
159 Ga0068871_100082353 3300006358 Bacteria 2668
160 Ga0068871_100173743 3300006358 Bacteria 1848
161 Ga0068871_100279132 3300006358 Bacteria 1461
162 Ga0075428_100010044 3300006844 Bacteria 10516
163 Ga0075428_100048626 3300006844 Unclassified 4655
164 Ga0075430_100034545 3300006846 Bacteria 4291
165 Ga0075431_100009298 3300006847 Bacteria 9860
166 Ga0075431_100028606 3300006847 Bacteria 5730
167 Ga0075429_100006202 3300006880 Bacteria 10343
168 Ga0068865_100081601 3300006881 Unclassified 2323
169 Ga0097620_100000045 3300006931 Bacteria 143607
170 Ga0097620_100030038 3300006931 Bacteria 5453
171 Ga0097620_100033339 3300006931 Bacteria 5172
172 Ga0097620_100094942 3300006931 Unclassified 3035
173 Ga0097620_100097286 3300006931 Bacteria 2996
174 Ga0097620_100141676 3300006931 Bacteria 2478
175 Ga0105244_10000160 3300009036 Bacteria 69914
176 Ga0105240_10000040 3300009093 Bacteria 264634
177 Ga0105240_10001675 3300009093 Bacteria 37595
178 Ga0105240_10016117 3300009093 Bacteria 10127
179 Ga0105240_10016598 3300009093 Bacteria 9963
180 Ga0105240_10019498 3300009093 Bacteria 9060
181 Ga0105240_10022970 3300009093 Bacteria 8261
182 Ga0105240_10030232 3300009093 Bacteria 7041
183 Ga0105240_10044822 3300009093 Bacteria 5615
184 Ga0105240_10049425 3300009093 Bacteria 5307
185 Ga0105240_10060410 3300009093 Bacteria 4725
186 Ga0105240_10126436 3300009093 Bacteria 3071
187 Ga0111539_10061973 3300009094 Bacteria 4429
188 Ga0111539_10085088 3300009094 Bacteria 3717
189 Ga0111539_10127052 3300009094 Unclassified 2986
190 Ga0111539_10157559 3300009094 Unclassified 2657
191 Ga0105247_10001867 3300009101 Bacteria 14743
192 Ga0105247_10048650 3300009101 Bacteria 2604
193 Ga0114129_10005331 3300009147 Bacteria 18156
194 Ga0114129_10022630 3300009147 Bacteria 8914
195 Ga0105243_10000734 3300009148 Bacteria 31383
196 Ga0105241_10001060 3300009174 Bacteria 20957
197 Ga0105241_10009040 3300009174 Bacteria 7329
198 Ga0105241_10023896 3300009174 Bacteria 4536
199 Ga0105241_10134609 3300009174 Bacteria 2005
200 Ga0105241_10345116 3300009174 Bacteria 1291
201 Ga0105242_10012376 3300009176 Bacteria 6567
202 Ga0105242_10111192 3300009176 Bacteria 2335
203 Ga0105242_10134512 3300009176 Bacteria 2138
204 Ga0105242_10136704 3300009176 Bacteria 2122
205 Ga0105237_10000710 3300009545 Bacteria 46041
206 Ga0105237_10002600 3300009545 Bacteria 22265
207 Ga0105237_10006952 3300009545 Bacteria 12475
208 Ga0105237_10008509 3300009545 Bacteria 11097
209 Ga0105237_10012157 3300009545 Bacteria 9081
210 Ga0105237_10017744 3300009545 Bacteria 7378
211 Ga0105237_10056726 3300009545 Bacteria 3920
212 Ga0105237_10081659 3300009545 Bacteria 3223
213 Ga0105238_10021649 3300009551 Bacteria 6549
214 Ga0105238_10043345 3300009551 Bacteria 4553
215 Ga0105249_10002002 3300009553 Bacteria 17698
216 Ga0105249_10002678 3300009553 Bacteria 15401
217 Ga0105249_10003252 3300009553 Bacteria 14074
218 Ga0105249_10025900 3300009553 Bacteria 5283
219 Ga0105249_10066632 3300009553 Bacteria 3315
220 Ga0105249_10078162 3300009553 Bacteria 3070
221 Ga0105249_10223003 3300009553 Bacteria 1856
222 Ga0105249_10350883 3300009553 Bacteria 1495
223 Ga0105239_10000133 3300010375 Bacteria 105033
224 Ga0105239_10000155 3300010375 Bacteria 98415
225 Ga0105239_10002424 3300010375 Bacteria 23755
226 Ga0105239_10003358 3300010375 Bacteria 19664
227 Ga0105239_10012014 3300010375 Bacteria 9656
228 Ga0105239_10041014 3300010375 Bacteria 5073
229 Ga0105239_10059834 3300010375 Bacteria 4180
230 Ga0105239_10081324 3300010375 Bacteria 3565
231 Ga0105239_10198320 3300010375 Bacteria 2248
232 Ga0105239_10205777 3300010375 Bacteria 2205
233 Ga0105246_10058294 3300011119 Bacteria 2675
234 Ga0105246_10083019 3300011119 Bacteria 2288
235 Ga0157373_10000006 3300013100 Bacteria 261768
236 Ga0157373_10008939 3300013100 Bacteria 7410
237 Ga0157373_10091116 3300013100 Bacteria 2147
238 Ga0157373_10151782 3300013100 Bacteria 1629
239 Ga0157371_10002372 3300013102 Bacteria 18010
240 Ga0157371_10018427 3300013102 Bacteria 5162
241 Ga0157371_10021384 3300013102 Bacteria 4750
242 Ga0157371_10021719 3300013102 Bacteria 4709
243 Ga0157371_10123604 3300013102 Bacteria 1840
244 Ga0157371_10202293 3300013102 Bacteria 1424
245 Ga0157370_10000585 3300013104 Bacteria 45433
246 Ga0157370_10001018 3300013104 Bacteria 35308
247 Ga0157370_10033056 3300013104 Bacteria 5045
248 Ga0157370_10098774 3300013104 Bacteria 2737
249 Ga0157370_10138597 3300013104 Bacteria 2267
250 Ga0157370_10162662 3300013104 Bacteria 2076
251 Ga0157370_10266930 3300013104 Bacteria 1581
252 Ga0157369_10036682 3300013105 Bacteria 5370
253 Ga0157369_10044601 3300013105 Bacteria 4825
254 Ga0157369_10302959 3300013105 Bacteria 1662
255 Ga0157374_10000025 3300013296 Bacteria 245131
256 Ga0157374_10053493 3300013296 Bacteria 3764
257 Ga0157374_10134520 3300013296 Bacteria 2395
258 Ga0157374_10139202 3300013296 Bacteria 2355
259 Ga0157378_10010333 3300013297 Bacteria 8149
260 Ga0157378_10016998 3300013297 Bacteria 6378
261 Ga0157378_10069852 3300013297 Bacteria 3152
262 Ga0157378_10346894 3300013297 Bacteria 1449
263 Ga0163162_10001289 3300013306 Bacteria 23440
264 Ga0163162_10006376 3300013306 Bacteria 11422
265 Ga0163162_10033897 3300013306 Bacteria 5077
266 Ga0163162_10040893 3300013306 Bacteria 4637
267 Ga0163162_10120363 3300013306 Bacteria 2729
268 Ga0163162_10510372 3300013306 Bacteria 1332
269 Ga0157372_10000294 3300013307 Bacteria 55599
270 Ga0157372_10000582 3300013307 Bacteria 39937
271 Ga0157372_10013871 3300013307 Bacteria 8607
272 Ga0157372_10018908 3300013307 Bacteria 7414
273 Ga0157372_10024498 3300013307 Bacteria 6557
274 Ga0157372_10042920 3300013307 Bacteria 5005
275 Ga0157372_10070836 3300013307 Bacteria 3924
276 Ga0157372_10153881 3300013307 Bacteria 2655
277 Ga0157372_10214981 3300013307 Bacteria 2228
278 Ga0157375_10000209 3300013308 Bacteria 54570
279 Ga0157375_10096980 3300013308 Bacteria 3022
280 Ga0157375_10179898 3300013308 Bacteria 2266
281 Ga0157375_10216686 3300013308 Bacteria 2072
282 Ga0163163_10040361 3300014325 Unclassified 4557
283 Ga0163163_10069315 3300014325 Bacteria 3511
284 Ga0163163_10227992 3300014325 Bacteria 1912
285 Ga0163163_10285138 3300014325 Bacteria 1703
286 Ga0157380_10000085 3300014326 Bacteria 52062
287 Ga0182008_10000003 3300014497 Bacteria 456880
288 Ga0157377_10007687 3300014745 Bacteria 5222
289 Ga0157376_10000892 3300014969 Bacteria 19514
290 Ga0157376_10063722 3300014969 Bacteria 3106
291 Ga0182006_1000001 3300015261 Bacteria 1091090
292 Ga0182005_1000071 3300015265 Bacteria 84771
293 Ga0163161_10032678 3300017792 Bacteria 3717
294 Ga0163161_10213990 3300017792 Bacteria 1490
295 Ga0163161_10225004 3300017792 Bacteria 1454
296 Ga0209436_102850 3300025208 Bacteria 4896
297 Ga0209258_100075 3300025242 Bacteria 270751
298 Ga0209646_1000876 3300025246 Bacteria 9991
299 Ga0209148_1000085 3300025254 Bacteria 265193
300 Ga0209673_1000242 3300025273 Bacteria 104669
301 Ga0209675_1003045 3300025291 Bacteria 8225
302 Ga0209758_1005981 3300025297 Bacteria 9011
303 Ga0209758_1008438 3300025297 Bacteria 6672
304 Ga0209050_1000298 3300025298 Bacteria 104315
305 Ga0207426_1001104 3300025302 Bacteria 24841
306 Ga0207426_1003320 3300025302 Bacteria 8903
307 Ga0207426_1011838 3300025302 Bacteria 3301
308 Ga0209257_1001270 3300025304 Bacteria 30945
309 Ga0207655_1000016 3300025728 Bacteria 551476
310 Ga0207710_10001020 3300025900 Bacteria 14622
311 Ga0207710_10024388 3300025900 Bacteria 2604
312 Ga0207688_10145581 3300025901 Bacteria 1397
313 Ga0207680_10000381 3300025903 Bacteria 21208
314 Ga0207680_10157501 3300025903 Bacteria 1520
315 Ga0207647_10009037 3300025904 Bacteria 7095
316 Ga0207647_10052313 3300025904 Bacteria 2521
317 Ga0207645_10022683 3300025907 Bacteria 4081
318 Ga0207645_10090423 3300025907 Bacteria 1968
319 Ga0207643_10002262 3300025908 Bacteria 10493
320 Ga0207705_10009260 3300025909 Bacteria 7164
321 Ga0207654_10002167 3300025911 Bacteria 10053
322 Ga0207654_10014389 3300025911 Bacteria 4087
323 Ga0207654_10014404 3300025911 Bacteria 4086
324 Ga0207654_10021660 3300025911 Bacteria 3420
325 Ga0207654_10166300 3300025911 Bacteria 1428
326 Ga0207707_10247460 3300025912 Unclassified 1549
327 Ga0207695_10000041 3300025913 Bacteria 450902
328 Ga0207695_10000282 3300025913 Bacteria 126242
329 Ga0207695_10000363 3300025913 Bacteria 103522
330 Ga0207695_10000647 3300025913 Bacteria 69264
331 Ga0207695_10002667 3300025913 Bacteria 26073
332 Ga0207695_10029084 3300025913 Bacteria 6115
333 Ga0207695_10061184 3300025913 Bacteria 3893
334 Ga0207671_10007629 3300025914 Bacteria 9351
335 Ga0207671_10020255 3300025914 Bacteria 5066
336 Ga0207671_10021298 3300025914 Bacteria 4920
337 Ga0207671_10146567 3300025914 Bacteria 1821
338 Ga0207660_10009202 3300025917 Bacteria 6390
339 Ga0207657_10001516 3300025919 Bacteria 24881
340 Ga0207657_10020393 3300025919 Bacteria 6264
341 Ga0207657_10034034 3300025919 Bacteria 4587
342 Ga0207649_10021758 3300025920 Bacteria 3697
343 Ga0207649_10287051 3300025920 Bacteria 1198
344 Ga0207652_10008365 3300025921 Bacteria 8321
345 Ga0207652_10009232 3300025921 Bacteria 7934
346 Ga0207681_10016298 3300025923 Bacteria 4647
347 Ga0207681_10024666 3300025923 Bacteria 3861
348 Ga0207681_10227426 3300025923 Bacteria 1446
349 Ga0207694_10046142 3300025924 Bacteria 3368
350 Ga0207694_10151790 3300025924 Bacteria 1867
351 Ga0207659_10067709 3300025926 Bacteria 2594
352 Ga0207644_10201161 3300025931 Bacteria 1571
353 Ga0207706_10009214 3300025933 Bacteria 9068
354 Ga0207706_10028796 3300025933 Bacteria 4958
355 Ga0207686_10001766 3300025934 Bacteria 12028
356 Ga0207686_10100521 3300025934 Bacteria 1930
357 Ga0207686_10153098 3300025934 Bacteria 1607
358 Ga0207709_10000355 3300025935 Bacteria 46675
359 Ga0207670_10004749 3300025936 Bacteria 7369
360 Ga0207670_10005483 3300025936 Bacteria 6970
361 Ga0207670_10085741 3300025936 Bacteria 2214
362 Ga0207669_10002707 3300025937 Bacteria 7584
363 Ga0207691_10001776 3300025940 Bacteria 21223
364 Ga0207691_10056602 3300025940 Bacteria 3572
365 Ga0207689_10002278 3300025942 Bacteria 17956
366 Ga0207689_10005351 3300025942 Bacteria 11492
367 Ga0207689_10005867 3300025942 Bacteria 10885
368 Ga0207689_10009880 3300025942 Bacteria 8225
369 Ga0207689_10024182 3300025942 Bacteria 5096
370 Ga0207661_10022325 3300025944 Bacteria 4764
371 Ga0207661_10025164 3300025944 Unclassified 4523
372 Ga0207679_10013108 3300025945 Bacteria 5428
373 Ga0207679_10188528 3300025945 Bacteria 1712
374 Ga0207667_10000403 3300025949 Bacteria 58481
375 Ga0207667_10002943 3300025949 Bacteria 21138
376 Ga0207667_10024878 3300025949 Bacteria 6565
377 Ga0207667_10069889 3300025949 Bacteria 3655
378 Ga0207667_10083746 3300025949 Bacteria 3302
379 Ga0207667_10260123 3300025949 Bacteria 1775
380 Ga0207651_10014588 3300025960 Bacteria 4543
381 Ga0207712_10002600 3300025961 Bacteria 11579
382 Ga0207712_10002732 3300025961 Bacteria 11271
383 Ga0207712_10005321 3300025961 Bacteria 8126
384 Ga0207712_10007140 3300025961 Bacteria 7047
385 Ga0207712_10020061 3300025961 Bacteria 4373
386 Ga0207668_10096611 3300025972 Bacteria 2184
387 Ga0207640_10035820 3300025981 Bacteria 3110
388 Ga0207658_10003968 3300025986 Bacteria 10391
389 Ga0207658_10118474 3300025986 Bacteria 2106
390 Ga0207677_10041580 3300026023 Bacteria 3041
391 Ga0207677_10160302 3300026023 Bacteria 1747
392 Ga0207703_10009138 3300026035 Bacteria 7802
393 Ga0207703_10046177 3300026035 Bacteria 3507
394 Ga0207703_10092251 3300026035 Bacteria 2549
395 Ga0207703_10395356 3300026035 Bacteria 1281
396 Ga0207639_10000812 3300026041 Bacteria 21212
397 Ga0207639_10007187 3300026041 Bacteria 7586
398 Ga0207639_10073213 3300026041 Bacteria 2685
399 Ga0207639_10079850 3300026041 Bacteria 2586
400 Ga0207639_10098994 3300026041 Bacteria 2352
401 Ga0207708_10035730 3300026075 Bacteria 3782
402 Ga0207702_10091585 3300026078 Bacteria 2662
403 Ga0207702_10116976 3300026078 Bacteria 2380
404 Ga0207702_10210810 3300026078 Unclassified 1806
405 Ga0207641_10000133 3300026088 Bacteria 109199
406 Ga0207641_10000549 3300026088 Bacteria 42051
407 Ga0207641_10033652 3300026088 Bacteria 4258
408 Ga0207648_10018930 3300026089 Bacteria 6220
409 Ga0207648_10027799 3300026089 Bacteria 5018
410 Ga0207648_10052785 3300026089 Bacteria 3555
411 Ga0207648_10102280 3300026089 Bacteria 2511
412 Ga0207648_10125193 3300026089 Bacteria 2260
413 Ga0207676_10021480 3300026095 Bacteria 4735
414 Ga0207676_10276046 3300026095 Bacteria 1524
415 Ga0207676_10381976 3300026095 Bacteria 1311
416 Ga0207676_10415124 3300026095 Bacteria 1261
417 Ga0207674_10000600 3300026116 Bacteria 47324
418 Ga0207674_10000755 3300026116 Bacteria 42269
419 Ga0207674_10049258 3300026116 Bacteria 4309
420 Ga0207674_10134557 3300026116 Bacteria 2434
421 Ga0207674_10172946 3300026116 Bacteria 2113
422 Ga0207674_10199914 3300026116 Bacteria 1948
423 Ga0207675_100005880 3300026118 Bacteria 11706
424 Ga0207675_100039927 3300026118 Bacteria 4379
425 Ga0207683_10051263 3300026121 Bacteria 3616
426 Ga0207698_10004932 3300026142 Bacteria 8180
427 Ga0207698_10037744 3300026142 Unclassified 3561
428 Ga0207698_10327172 3300026142 Bacteria 1438
429 Ga0268266_10000026 3300028379 Bacteria 434485
430 Ga0268264_10000015 3300028381 Bacteria 508501
431 Ga0268264_10000019 3300028381 Bacteria 488112
432 Ga0268264_10000054 3300028381 Bacteria 317048
433 Ga0268264_10001568 3300028381 Bacteria 21208
434 Ga0268264_10008314 3300028381 Bacteria 8626
435 Ga0268264_10019724 3300028381 Bacteria 5508
436 Ga0268264_10049395 3300028381 Bacteria 3500
437 Ga0265323_10000858 3300028653 Bacteria 16158
438 Ga0265336_10018321 3300028666 Bacteria 2270
439 Ga0307517_10000651 3300028786 Bacteria 59585
440 Ga0307515_10000001 3300028794 Bacteria 4259510
441 Ga0265327_10021796 3300031251 Bacteria 3855
442 Ga0265316_10000401 3300031344 Bacteria 49342
443 Ga0265316_10007723 3300031344 Bacteria 10080
444 Ga0307513_10128346 3300031456 Bacteria 2486
445 Ga0307509_10201839 3300031507 Bacteria 1824
446 Ga0265342_10069366 3300031712 Unclassified 2059
447 Ga0307516_10001571 3300031730 Bacteria 31452
448 Ga0307516_10069974 3300031730 Bacteria 3374
449 Ga0307412_10000036 3300031911 Bacteria 192270
450 Ga0307412_10000677 3300031911 Bacteria 19768
451 Ga0307412_10009055 3300031911 Bacteria 5704
452 Ga0307416_100000006 3300032002 Bacteria 466074
453 Ga0307414_10000043 3300032004 Bacteria 137764
454 Ga0307414_10000118 3300032004 Bacteria 56182
455 Ga0307414_10002983 3300032004 Bacteria 8960
456 Ga0307414_10025499 3300032004 Bacteria 3789
457 Ga0307414_10037854 3300032004 Bacteria 3234
458 Ga0307510_10000650 3300033180 Bacteria 35339
459 Ga0373955_0044342 3300035172 Bacteria 2395
460 Ga0373927_0016164 3300035695 Bacteria 4924
461 Ga0373937_0026430 3300036401 Bacteria 5246
462 Ga0395899_0009711 3300037312 Bacteria 7385
463 Ga0395900_0008178 3300037418 Bacteria 10764
464 Ga0395900_0166678 3300037418 Bacteria 2245
465 Ga0395900_0169069 3300037418 Bacteria 2226
466 Ga0395898_0011708 3300037466 Bacteria 9095
467 Ga0395905_0020312 3300037471 Bacteria 6292
468 Ga0395901_0014250 3300038443 Bacteria 8095
469 Ga0439436_0000451 3300041404 Bacteria 10493
470 Ga0439466_0013706 3300041411 Bacteria 2964
471 Ga0439465_0000069 3300041413 Bacteria 22418
472 Ga0451795_1332565 3300041456 Bacteria 1487
473 Ga0451807_2302037 3300041486 Bacteria 3072
474 Ga0451853_1731523 3300041512 Bacteria 3226
475 Ga0439445_0020832 3300042004 Bacteria 1644
476 Ga0439449_0059057 3300042007 Bacteria 1416
477 Ga0439457_000066 3300042014 Bacteria 22683
478 Ga0439462_0018605 3300042015 Bacteria 1804
479 Ga0451577_0001198 3300042876 Bacteria 36335
480 Ga0451577_0009122 3300042876 Bacteria 9573
481 Ga0451577_0191664 3300042876 Bacteria 1844
482 Ga0466969_0000004 3300044656 Bacteria 168068
483 Ga0466972_0000017 3300044658 Bacteria 199884
484 Ga0466972_0000500 3300044658 Bacteria 19594
485 Ga0466966_0000295 3300044684 Bacteria 32723
486 Ga0466961_0011193 3300044693 Bacteria 5736
487 Ga0466964_0027934 3300044706 Bacteria 2219
488 Ga0453684_0001281 3300044712 Bacteria 75118
489 Ga0453684_0001619 3300044712 Bacteria 61621
490 Ga0453684_0003038 3300044712 Bacteria 39029
491 Ga0466970_0018872 3300044765 Bacteria 3572
492 Ga0466970_0031131 3300044765 Bacteria 2817
493 Ga0466957_0001466 3300044842 Bacteria 12365
494 Ga0466957_0057610 3300044842 Bacteria 2378
495 Ga0466959_0000004 3300045049 Bacteria 216815
496 Ga0466959_0000566 3300045049 Bacteria 21533
497 Ga0495627_000081 3300046453 Bacteria 116262
498 Ga0495627_044018 3300046453 Bacteria 1363
499 Ga0495592_0081730 3300046454 Bacteria 2336
500 Ga0495638_0031527 3300046460 Bacteria 3406
501 Ga0495653_0118277 3300046463 Bacteria 1893
502 Ga0495596_0002543 3300046500 Bacteria 9747
503 Ga0495606_0003999 3300046507 Bacteria 15050
504 Ga0495606_0050953 3300046507 Bacteria 2703
505 Ga0495608_0063346 3300046511 Bacteria 2427
506 Ga0495610_0000005 3300046512 Bacteria 924111
507 Ga0495630_0060363 3300046517 Bacteria 2846
508 Ga0495632_0002129 3300046519 Bacteria 15416
509 Ga0495648_0001530 3300046524 Bacteria 22622
510 Ga0495663_0000680 3300046525 Bacteria 11726
511 Ga0495663_0005383 3300046525 Bacteria 3552
512 Ga0495654_0000003 3300046530 Bacteria 863485
513 Ga0495598_0009585 3300046537 Bacteria 2294
514 Ga0495621_0005078 3300046539 Bacteria 3756
515 Ga0495633_0000022 3300046558 Bacteria 226582
516 Ga0495633_0000114 3300046558 Bacteria 108708
517 Ga0495633_0031288 3300046558 Bacteria 2582
518 Ga0495668_0004556 3300046616 Bacteria 9761
519 Ga0495611_0001127 3300046648 Bacteria 14007
520 Ga0495611_0033424 3300046648 Bacteria 2269
521 Ga0495625_0002476 3300046660 Bacteria 19910
522 Ga0495625_0178743 3300046660 Bacteria 1413
523 Ga0495599_0114542 3300046678 Bacteria 1678
524 Ga0495672_0016266 3300047320 Bacteria 5020
525 Ga0495672_0019138 3300047320 Bacteria 4526
526 Ga0495687_000031 3300047443 Bacteria 274659
527 Ga0495684_0152327 3300047471 Bacteria 1728
528 Ga0495686_0000128 3300047472 Bacteria 156223
529 Ga0495686_0021354 3300047472 Unclassified 4302
530 Ga0495686_0062493 3300047472 Bacteria 2310
531 Ga0496103_0078546 3300048906 Bacteria 2073
532 Ga0496110_0114393 3300048913 Bacteria 2428
533 Ga0496116_0000029 3300048919 Bacteria 422187
534 Ga0496117_0000007 3300048920 Bacteria 720505
535 Ga0496118_0015187 3300048921 Bacteria 7150
536 Ga0496118_0099818 3300048921 Bacteria 1966
537 Ga0496119_0000007 3300048922 Bacteria 475920
538 Ga0496120_0067739 3300048923 Bacteria 1971
539 Ga0496121_0000010 3300048924 Bacteria 793488
540 Ga0496122_0000946 3300048925 Bacteria 52631
541 Ga0496122_0001893 3300048925 Bacteria 31687
542 Ga0496122_0001900 3300048925 Bacteria 31591
543 Ga0496122_0001976 3300048925 Bacteria 30631
544 Ga0496122_0002061 3300048925 Bacteria 29808
545 Ga0496123_0001726 3300048926 Bacteria 29009
546 Ga0496123_0008606 3300048926 Bacteria 9340
547 Ga0496124_0001116 3300048927 Bacteria 42242
548 Ga0496125_0001777 3300048928 Bacteria 29790
549 Ga0496125_0017671 3300048928 Bacteria 6790
550 Ga0496126_0004748 3300048929 Bacteria 16022
551 Ga0501032_0002044 3300049569 Bacteria 15933
552 Ga0501033_0021393 3300049570 Bacteria 4880
553 Ga0501034_0009033 3300049571 Bacteria 10466
554 Ga0501034_0015128 3300049571 Bacteria 7930
555 Ga0501036_0011432 3300049572 Bacteria 7348
556 Ga0501037_0006267 3300049573 Bacteria 8696
557 Ga0501037_0032056 3300049573 Bacteria 3880
558 Ga0501038_0011204 3300049574 Bacteria 8186
559 Ga0501038_0028995 3300049574 Bacteria 4910
560 Ga0501043_0007889 3300049579 Bacteria 8415
561 Ga0501043_0015301 3300049579 Bacteria 6010
562 Ga0501043_0135302 3300049579 Bacteria 1931
563 Ga0501046_0011009 3300049580 Bacteria 7752
564 Ga0501047_0025590 3300049581 Bacteria 5673
565 Ga0501047_0045479 3300049581 Bacteria 4245
566 Ga0501047_0057178 3300049581 Bacteria 3772
567 Ga0501047_0071567 3300049581 Bacteria 3337
568 Ga0501047_0090965 3300049581 Bacteria 2929
569 Ga0501047_0195725 3300049581 Bacteria 1884
570 Ga0501048_0048606 3300049582 Bacteria 3025
571 Ga0501070_0013567 3300049586 Bacteria 6868
572 Ga0501072_0153683 3300049588 Bacteria 1835
573 Ga0501073_0003476 3300049589 Bacteria 11825
574 Ga0501074_0003529 3300049590 Bacteria 11096
575 Ga0501201_000329 3300049651 Bacteria 4368
576 Ga0501223_000724 3300049663 Bacteria 7868
577 Ga0501224_000319 3300049664 Bacteria 5632
578 Ga0501235_001375 3300049669 Bacteria 5158
579 Ga0501242_000579 3300049674 Bacteria 3311
580 Ga0501252_000079 3300049682 Bacteria 5041
581 Ga0501257_006977 3300049686 Bacteria 2516
582 Ga0501259_001418 3300049688 Bacteria 3985
583 Ga0501259_001520 3300049688 Bacteria 3863
584 Ga0501221_000581 3300049704 Bacteria 5835
585 Ga0501225_0000487 3300049705 Bacteria 12349
586 Ga0501225_0005736 3300049705 Bacteria 3636
587 Ga0501083_0096139 3300049744 Bacteria 1954
588 Ga0501241_000002 3300049758 Bacteria 194532
589 Ga0501241_000383 3300049758 Bacteria 9690
590 Ga0501269_000379 3300049766 Bacteria 10698
591 Ga0501035_0002820 3300049822 Bacteria 16814
592 Ga0501035_0033250 3300049822 Bacteria 4690
593 Ga0501044_0002356 3300049823 Bacteria 21549
594 Ga0501044_0022628 3300049823 Bacteria 6695
595 Ga0501044_0030671 3300049823 Bacteria 5664
596 nmdc:mga0k408_11249_c2 3300050493 Bacteria 4187
597 nmdc:mga0k408_27448_c1 3300050493 Bacteria 3233
598 nmdc:mga05p37_38869_c1 3300050507 Bacteria 5837
599 nmdc:mga09592_20617_c1 3300050508 Bacteria 5423
600 nmdc:mga09592_44624_c1 3300050508 Bacteria 3733
601 nmdc:mga06r32_138949_c1 3300050510 Bacteria 2405
602 nmdc:mga06r32_48218_c1 3300050510 Bacteria 4071
603 nmdc:mga08y16_109132_c1 3300050511 Bacteria 2881
604 nmdc:mga08y16_135439_c1 3300050511 Unclassified 2560
605 nmdc:mga08y16_94718_c1 3300050511 Bacteria 3110
606 Ga0500578_0087192 3300053086 Bacteria 1983
607 Ga0500644_0000593 3300053088 Bacteria 13830
608 Ga0500646_0001495 3300053090 Bacteria 6146
609 Ga0500583_0000062 3300053092 Bacteria 67892
610 Ga0500583_0000276 3300053092 Bacteria 17969
611 Ga0500583_0001457 3300053092 Bacteria 6785
612 Ga0500569_000223 3300053109 Bacteria 8953
613 Ga0500642_0016477 3300053130 Bacteria 2809
614 Ga0500658_0007468 3300053134 Bacteria 4040
615 Ga0500568_0000511 3300053139 Bacteria 28633
616 Ga0500577_0001525 3300053142 Bacteria 5902
617 Ga0500589_025059 3300053147 Bacteria 2760
618 Ga0500622_0000144 3300053156 Bacteria 75663
619 Ga0500622_0000926 3300053156 Bacteria 24930
620 Ga0500622_0034403 3300053156 Bacteria 2654
621 Ga0501084_0064508 3300054114 Bacteria 3065
622 2511231035 2511231000 Bacteria 4488346
623 2524006166 2523533629 Bacteria 2982326
624 2585143660 2582581278 Bacteria 5296881
625 2585156499 2582581281 Bacteria 4487904
626 2585160850 2582581282 Bacteria 4495830
627 2587680048 2585428045 Bacteria 5203023
628 2587748704 2585428060 Bacteria 5304711
629 2587752268 2585428061 Bacteria 3939663
630 2587945381 2585428115 Bacteria 4420269
631 2588211563 2585428182 Bacteria 5007281
632 2588215947 2585428183 Bacteria 5166119
633 2588219369 2585428184 Bacteria 4978681
634 2588224851 2585428185 Bacteria 4969476
635 2588234683 2585428187 Bacteria 4629388
636 2588447638 2588253712 Bacteria 5403181
637 2590603268 2588254255 Bacteria 5014294
638 2590610281 2588254257 Bacteria 5436094
639 2729200689 2728369107 Bacteria 5082720
640 2738698321 2738541273 Bacteria 4048577
641 2738724497 2738541278 Bacteria 9755573
642 2739252647 2738543014 Bacteria 4048139
643 2740032167 2739367866 Bacteria 4215900
644 2740060501 2739367874 Bacteria 4872888
645 2753674271 2751185877 Bacteria 4921427
646 2765575759 2765235839 Bacteria 5314748
647 2772606100 2772190705 Bacteria 4666226
648 2775674264 2775506739 Bacteria 3855222
649 2816875598 2816332188 Bacteria 5133218
650 2819571871 2818991442 Bacteria 8318214
651 2821141885 2821136567 Bacteria 8080116
652 2839991403 2839989709 Bacteria 3773432
653 2842086327 2842083920 Bacteria 4857652
654 2871723679 2871720351 Bacteria 4862476
655 2884636702 2884634485 Bacteria 3928637
656 2884637318 2884634485 Bacteria 3928637
657 2889293745 2889290771 Bacteria 5530962
658 2904469702 2904467357 Bacteria 8057758
659 2906001110 2905999023 Bacteria 4591259
660 2910247858 2910245624 Bacteria 6935613
661 2919100760 2919097161 Bacteria 3860339
662 2919403122 2919399522 Bacteria 5164947
663 2919697545 2919692658 Bacteria 5943958
664 2929927737 2929921140 Bacteria 8649150
665 2945924730 2945924605 Bacteria 4296724
666 2946024154 2946019816 Bacteria 4621265
667 2977247682 2977243572 Bacteria 4374394
668 2984574515 2984572630 Bacteria 4186940
669 2984607966 2984606641 Bacteria 4186971
670 2993375024 2993372514 Bacteria 4214139
671 2993481888 2993480792 Bacteria 4022225
672 Ga0307511_10000228
673 JGI24741J21665_1002211
674 JGI24744J21845_10007449
675 rootH1_10079717
676 rootH2_10009982
677 rootH2_10037920
678 rootH2_10050136
679 rootH2_10076592
680 rootL2_10266713
681 rootH1_10098969
682 rootH1_10259345
683 JGI25160J50197_1002332
684 Ga0055535_1007746
685 Ga0055534_1014363
686 Ga0055528_1000307
687 Ga0055528_1007947
688 Ga0055530_10001712
689 Ga0055531_10029535
690 Ga0055543_1006891
691 Ga0065165_1000722
692 Ga0065704_10020003
693 Ga0065707_10159377
694 Ga0070658_10036022
695 Ga0070658_10063362
696 Ga0070658_10076384
697 Ga0070658_10101670
698 Ga0070676_10005231
699 Ga0070676_10061783
700 Ga0070683_100004016
701 Ga0070683_100131528
702 Ga0070690_100052813
703 Ga0070690_100138638
704 Ga0070690_100149921
705 Ga0068869_100018653
706 Ga0068869_100029041
707 Ga0068869_100033033
708 Ga0068869_100052755
709 Ga0068869_100085349
710 Ga0070666_10000031
711 Ga0070666_10015920
712 Ga0070666_10158582
713 Ga0070680_100019674
714 Ga0070680_100052971
715 Ga0070680_100139304
716 Ga0070682_100000152
717 Ga0070682_100001276
718 Ga0070682_100032428
719 Ga0068868_100037647
720 Ga0068868_100341245
721 Ga0070660_100000201
722 Ga0070660_100027411
723 Ga0070660_100032879
724 Ga0070660_100063853
725 Ga0070689_100004257
726 Ga0070689_100065057
727 Ga0070689_100107592
728 Ga0070689_100214550
729 Ga0070687_100016820
730 Ga0070687_100067809
731 Ga0070661_100223479
732 Ga0070668_100049616
733 Ga0070669_100110056
734 Ga0070669_100289760
735 Ga0070675_100040413
736 Ga0070675_100061496
737 Ga0070675_100078587
738 Ga0070675_100107187
739 Ga0070671_100033594
740 Ga0070673_100034978
741 Ga0070673_100052550
742 Ga0070688_100003898
743 Ga0070688_100121359
744 Ga0070688_100122504
745 Ga0070659_100004878
746 Ga0070667_100004341
747 Ga0070667_100017484
748 Ga0070667_100095160
749 Ga0070667_100184404
750 Ga0070667_100231935
751 Ga0070700_100056409
752 Ga0070663_100224131
753 Ga0070662_100074215
754 Ga0070681_10016117
755 Ga0070681_10078377
756 Ga0068867_100011283
757 Ga0070685_10004480
758 Ga0070685_10023197
759 Ga0070698_100001241
760 Ga0070698_100003438
761 Ga0070698_100010706
762 Ga0070698_100168177
763 Ga0070679_100000836
764 Ga0070679_100034505
765 Ga0070684_100000232
766 Ga0070684_100004401
767 Ga0070684_100145662
768 Ga0068853_100000103
769 Ga0068853_100015582
770 Ga0068853_100040621
771 Ga0068853_100108228
772 Ga0068853_100312223
773 Ga0070672_100079740
774 Ga0070686_100008636
775 Ga0070693_100129416
776 Ga0070665_100004340
777 Ga0070665_100202416
778 Ga0068855_100031705
779 Ga0068855_100041522
780 Ga0068855_100078179
781 Ga0068855_100113607
782 Ga0068855_100127024
783 Ga0068855_100133045
784 Ga0070664_100205394
785 Ga0068857_100003404
786 Ga0068857_100004875
787 Ga0068857_100012331
788 Ga0068857_100103068
789 Ga0068854_100091866
790 Ga0068856_100025473
791 Ga0068856_100123380
792 Ga0068856_100165314
793 Ga0068856_100270077
794 Ga0068856_100282956
795 Ga0070702_100009538
796 Ga0068852_100001078
797 Ga0068852_100011910
798 Ga0068852_100063037
799 Ga0068859_100000045
800 Ga0068859_100030038
801 Ga0068859_100033339
802 Ga0068859_100094941
803 Ga0068859_100097286
804 Ga0068859_100141676
805 Ga0068864_100001622
806 Ga0068864_100045766
807 Ga0068861_100003382
808 Ga0068870_10036100
809 Ga0068863_100003089
810 Ga0068863_100006337
811 Ga0068863_100271972
812 Ga0068858_100024945
813 Ga0068858_100084450
814 Ga0068858_100126819
815 Ga0068860_100001289
816 Ga0068860_100007137
817 Ga0068860_100010059
818 Ga0068860_100011449
819 Ga0068860_100044074
820 Ga0068862_100035626
821 Ga0081540_1021338
822 Ga0075366_10017458
823 Ga0075366_10121674
824 Ga0097621_100001013
825 Ga0097621_100011779
826 Ga0097621_100154600
827 Ga0097621_100163905
828 Ga0068871_100007075
829 Ga0068871_100015208
830 Ga0068871_100082353
831 Ga0068871_100173743
832 Ga0068871_100279132
833 Ga0075428_100010044
834 Ga0075428_100048626
835 Ga0075430_100034545
836 Ga0075431_100009298
837 Ga0075431_100028606
838 Ga0075429_100006202
839 Ga0068865_100081601
840 Ga0097620_100000045
841 Ga0097620_100030038
842 Ga0097620_100033339
843 Ga0097620_100094942
844 Ga0097620_100097286
845 Ga0097620_100141676
846 Ga0105244_10000160
847 Ga0105240_10000040
848 Ga0105240_10001675
849 Ga0105240_10016117
850 Ga0105240_10016598
851 Ga0105240_10019498
852 Ga0105240_10022970
853 Ga0105240_10030232
854 Ga0105240_10044822
855 Ga0105240_10049425
856 Ga0105240_10060410
857 Ga0105240_10126436
858 Ga0111539_10061973
859 Ga0111539_10085088
860 Ga0111539_10127052
861 Ga0111539_10157559
862 Ga0105247_10001867
863 Ga0105247_10048650
864 Ga0114129_10005331
865 Ga0114129_10022630
866 Ga0105243_10000734
867 Ga0105241_10001060
868 Ga0105241_10009040
869 Ga0105241_10023896
870 Ga0105241_10134609
871 Ga0105241_10345116
872 Ga0105242_10012376
873 Ga0105242_10111192
874 Ga0105242_10134512
875 Ga0105242_10136704
876 Ga0105237_10000710
877 Ga0105237_10002600
878 Ga0105237_10006952
879 Ga0105237_10008509
880 Ga0105237_10012157
881 Ga0105237_10017744
882 Ga0105237_10056726
883 Ga0105237_10081659
884 Ga0105238_10021649
885 Ga0105238_10043345
886 Ga0105249_10002002
887 Ga0105249_10002678
888 Ga0105249_10003252
889 Ga0105249_10025900
890 Ga0105249_10066632
891 Ga0105249_10078162
892 Ga0105249_10223003
893 Ga0105249_10350883
894 Ga0105239_10000133
895 Ga0105239_10000155
896 Ga0105239_10002424
897 Ga0105239_10003358
898 Ga0105239_10012014
899 Ga0105239_10041014
900 Ga0105239_10059834
901 Ga0105239_10081324
902 Ga0105239_10198320
903 Ga0105239_10205777
904 Ga0105246_10058294
905 Ga0105246_10083019
906 Ga0157373_10000006
907 Ga0157373_10008939
908 Ga0157373_10091116
909 Ga0157373_10151782
910 Ga0157371_10002372
911 Ga0157371_10018427
912 Ga0157371_10021384
913 Ga0157371_10021719
914 Ga0157371_10123604
915 Ga0157371_10202293
916 Ga0157370_10000585
917 Ga0157370_10001018
918 Ga0157370_10033056
919 Ga0157370_10098774
920 Ga0157370_10138597
921 Ga0157370_10162662
922 Ga0157370_10266930
923 Ga0157369_10036682
924 Ga0157369_10044601
925 Ga0157369_10302959
926 Ga0157374_10000025
927 Ga0157374_10053493
928 Ga0157374_10134520
929 Ga0157374_10139202
930 Ga0157378_10010333
931 Ga0157378_10016998
932 Ga0157378_10069852
933 Ga0157378_10346894
934 Ga0163162_10001289
935 Ga0163162_10006376
936 Ga0163162_10033897
937 Ga0163162_10040893
938 Ga0163162_10120363
939 Ga0163162_10510372
940 Ga0157372_10000294
941 Ga0157372_10000582
942 Ga0157372_10013871
943 Ga0157372_10018908
944 Ga0157372_10024498
945 Ga0157372_10042920
946 Ga0157372_10070836
947 Ga0157372_10153881
948 Ga0157372_10214981
949 Ga0157375_10000209
950 Ga0157375_10096980
951 Ga0157375_10179898
952 Ga0157375_10216686
953 Ga0163163_10040361
954 Ga0163163_10069315
955 Ga0163163_10227992
956 Ga0163163_10285138
957 Ga0157380_10000085
958 Ga0182008_10000003
959 Ga0157377_10007687
960 Ga0157376_10000892
961 Ga0157376_10063722
962 Ga0182006_1000001
963 Ga0182005_1000071
964 Ga0163161_10032678
965 Ga0163161_10213990
966 Ga0163161_10225004
967 Ga0209436_102850
968 Ga0209258_100075
969 Ga0209646_1000876
970 Ga0209148_1000085
971 Ga0209673_1000242
972 Ga0209675_1003045
973 Ga0209758_1005981
974 Ga0209758_1008438
975 Ga0209050_1000298
976 Ga0207426_1001104
977 Ga0207426_1003320
978 Ga0207426_1011838
979 Ga0209257_1001270
980 Ga0207655_1000016
981 Ga0207710_10001020
982 Ga0207710_10024388
983 Ga0207688_10145581
984 Ga0207680_10000381
985 Ga0207680_10157501
986 Ga0207647_10009037
987 Ga0207647_10052313
988 Ga0207645_10022683
989 Ga0207645_10090423
990 Ga0207643_10002262
991 Ga0207705_10009260
992 Ga0207654_10002167
993 Ga0207654_10014389
994 Ga0207654_10014404
995 Ga0207654_10021660
996 Ga0207654_10166300
997 Ga0207707_10247460
998 Ga0207695_10000041
999 Ga0207695_10000282
1000 Ga0207695_10000363
1001 Ga0207695_10000647
1002 Ga0207695_10002667
1003 Ga0207695_10029084
1004 Ga0207695_10061184
1005 Ga0207671_10007629
1006 Ga0207671_10020255
1007 Ga0207671_10021298
1008 Ga0207671_10146567
1009 Ga0207660_10009202
1010 Ga0207657_10001516
1011 Ga0207657_10020393
1012 Ga0207657_10034034
1013 Ga0207649_10021758
1014 Ga0207649_10287051
1015 Ga0207652_10008365
1016 Ga0207652_10009232
1017 Ga0207681_10016298
1018 Ga0207681_10024666
1019 Ga0207681_10227426
1020 Ga0207694_10046142
1021 Ga0207694_10151790
1022 Ga0207659_10067709
1023 Ga0207644_10201161
1024 Ga0207706_10009214
1025 Ga0207706_10028796
1026 Ga0207686_10001766
1027 Ga0207686_10100521
1028 Ga0207686_10153098
1029 Ga0207709_10000355
1030 Ga0207670_10004749
1031 Ga0207670_10005483
1032 Ga0207670_10085741
1033 Ga0207669_10002707
1034 Ga0207691_10001776
1035 Ga0207691_10056602
1036 Ga0207689_10002278
1037 Ga0207689_10005351
1038 Ga0207689_10005867
1039 Ga0207689_10009880
1040 Ga0207689_10024182
1041 Ga0207661_10022325
1042 Ga0207661_10025164
1043 Ga0207679_10013108
1044 Ga0207679_10188528
1045 Ga0207667_10000403
1046 Ga0207667_10002943
1047 Ga0207667_10024878
1048 Ga0207667_10069889
1049 Ga0207667_10083746
1050 Ga0207667_10260123
1051 Ga0207651_10014588
1052 Ga0207712_10002600
1053 Ga0207712_10002732
1054 Ga0207712_10005321
1055 Ga0207712_10007140
1056 Ga0207712_10020061
1057 Ga0207668_10096611
1058 Ga0207640_10035820
1059 Ga0207658_10003968
1060 Ga0207658_10118474
1061 Ga0207677_10041580
1062 Ga0207677_10160302
1063 Ga0207703_10009138
1064 Ga0207703_10046177
1065 Ga0207703_10092251
1066 Ga0207703_10395356
1067 Ga0207639_10000812
1068 Ga0207639_10007187
1069 Ga0207639_10073213
1070 Ga0207639_10079850
1071 Ga0207639_10098994
1072 Ga0207708_10035730
1073 Ga0207702_10091585
1074 Ga0207702_10116976
1075 Ga0207702_10210810
1076 Ga0207641_10000133
1077 Ga0207641_10000549
1078 Ga0207641_10033652
1079 Ga0207648_10018930
1080 Ga0207648_10027799
1081 Ga0207648_10052785
1082 Ga0207648_10102280
1083 Ga0207648_10125193
1084 Ga0207676_10021480
1085 Ga0207676_10276046
1086 Ga0207676_10381976
1087 Ga0207676_10415124
1088 Ga0207674_10000600
1089 Ga0207674_10000755
1090 Ga0207674_10049258
1091 Ga0207674_10134557
1092 Ga0207674_10172946
1093 Ga0207674_10199914
1094 Ga0207675_100005880
1095 Ga0207675_100039927
1096 Ga0207683_10051263
1097 Ga0207698_10004932
1098 Ga0207698_10037744
1099 Ga0207698_10327172
1100 Ga0268266_10000026
1101 Ga0268264_10000015
1102 Ga0268264_10000019
1103 Ga0268264_10000054
1104 Ga0268264_10001568
1105 Ga0268264_10008314
1106 Ga0268264_10019724
1107 Ga0268264_10049395
1108 Ga0265323_10000858
1109 Ga0265336_10018321
1110 Ga0307517_10000651
1111 Ga0307515_10000001
1112 Ga0265327_10021796
1113 Ga0265316_10000401
1114 Ga0265316_10007723
1115 Ga0307513_10128346
1116 Ga0307509_10201839
1117 Ga0265342_10069366
1118 Ga0307516_10001571
1119 Ga0307516_10069974
1120 Ga0307412_10000036
1121 Ga0307412_10000677
1122 Ga0307412_10009055
1123 Ga0307416_100000006
1124 Ga0307414_10000043
1125 Ga0307414_10000118
1126 Ga0307414_10002983
1127 Ga0307414_10025499
1128 Ga0307414_10037854
1129 Ga0307510_10000650
1130 Ga0373955_0044342
1131 Ga0373927_0016164
1132 Ga0373937_0026430
1133 Ga0395899_0009711
1134 Ga0395900_0008178
1135 Ga0395900_0166678
1136 Ga0395900_0169069
1137 Ga0395898_0011708
1138 Ga0395905_0020312
1139 Ga0395901_0014250
1140 Ga0439436_0000451
1141 Ga0439466_0013706
1142 Ga0439465_0000069
1143 Ga0451795_1332565
1144 Ga0451807_2302037
1145 Ga0451853_1731523
1146 Ga0439445_0020832
1147 Ga0439449_0059057
1148 Ga0439457_000066
1149 Ga0439462_0018605
1150 Ga0451577_0001198
1151 Ga0451577_0009122
1152 Ga0451577_0191664
1153 Ga0466969_0000004
1154 Ga0466972_0000017
1155 Ga0466972_0000500
1156 Ga0466966_0000295
1157 Ga0466961_0011193
1158 Ga0466964_0027934
1159 Ga0453684_0001281
1160 Ga0453684_0001619
1161 Ga0453684_0003038
1162 Ga0466970_0018872
1163 Ga0466970_0031131
1164 Ga0466957_0001466
1165 Ga0466957_0057610
1166 Ga0466959_0000004
1167 Ga0466959_0000566
1168 Ga0495627_000081
1169 Ga0495627_044018
1170 Ga0495592_0081730
1171 Ga0495638_0031527
1172 Ga0495653_0118277
1173 Ga0495596_0002543
1174 Ga0495606_0003999
1175 Ga0495606_0050953
1176 Ga0495608_0063346
1177 Ga0495610_0000005
1178 Ga0495630_0060363
1179 Ga0495632_0002129
1180 Ga0495648_0001530
1181 Ga0495663_0000680
1182 Ga0495663_0005383
1183 Ga0495654_0000003
1184 Ga0495598_0009585
1185 Ga0495621_0005078
1186 Ga0495633_0000022
1187 Ga0495633_0000114
1188 Ga0495633_0031288
1189 Ga0495668_0004556
1190 Ga0495611_0001127
1191 Ga0495611_0033424
1192 Ga0495625_0002476
1193 Ga0495625_0178743
1194 Ga0495599_0114542
1195 Ga0495672_0016266
1196 Ga0495672_0019138
1197 Ga0495687_000031
1198 Ga0495684_0152327
1199 Ga0495686_0000128
1200 Ga0495686_0021354
1201 Ga0495686_0062493
1202 Ga0496103_0078546
1203 Ga0496110_0114393
1204 Ga0496116_0000029
1205 Ga0496117_0000007
1206 Ga0496118_0015187
1207 Ga0496118_0099818
1208 Ga0496119_0000007
1209 Ga0496120_0067739
1210 Ga0496121_0000010
1211 Ga0496122_0000946
1212 Ga0496122_0001893
1213 Ga0496122_0001900
1214 Ga0496122_0001976
1215 Ga0496122_0002061
1216 Ga0496123_0001726
1217 Ga0496123_0008606
1218 Ga0496124_0001116
1219 Ga0496125_0001777
1220 Ga0496125_0017671
1221 Ga0496126_0004748
1222 Ga0501032_0002044
1223 Ga0501033_0021393
1224 Ga0501034_0009033
1225 Ga0501034_0015128
1226 Ga0501036_0011432
1227 Ga0501037_0006267
1228 Ga0501037_0032056
1229 Ga0501038_0011204
1230 Ga0501038_0028995
1231 Ga0501043_0007889
1232 Ga0501043_0015301
1233 Ga0501043_0135302
1234 Ga0501046_0011009
1235 Ga0501047_0025590
1236 Ga0501047_0045479
1237 Ga0501047_0057178
1238 Ga0501047_0071567
1239 Ga0501047_0090965
1240 Ga0501047_0195725
1241 Ga0501048_0048606
1242 Ga0501070_0013567
1243 Ga0501072_0153683
1244 Ga0501073_0003476
1245 Ga0501074_0003529
1246 Ga0501201_000329
1247 Ga0501223_000724
1248 Ga0501224_000319
1249 Ga0501235_001375
1250 Ga0501242_000579
1251 Ga0501252_000079
1252 Ga0501257_006977
1253 Ga0501259_001418
1254 Ga0501259_001520
1255 Ga0501221_000581
1256 Ga0501225_0000487
1257 Ga0501225_0005736
1258 Ga0501083_0096139
1259 Ga0501241_000002
1260 Ga0501241_000383
1261 Ga0501269_000379
1262 Ga0501035_0002820
1263 Ga0501035_0033250
1264 Ga0501044_0002356
1265 Ga0501044_0022628
1266 Ga0501044_0030671
1267 nmdc:mga0k408_11249_c2
1268 nmdc:mga0k408_27448_c1
1269 nmdc:mga05p37_38869_c1
1270 nmdc:mga09592_20617_c1
1271 nmdc:mga09592_44624_c1
1272 nmdc:mga06r32_138949_c1
1273 nmdc:mga06r32_48218_c1
1274 nmdc:mga08y16_109132_c1
1275 nmdc:mga08y16_135439_c1
1276 nmdc:mga08y16_94718_c1
1277 Ga0500578_0087192
1278 Ga0500644_0000593
1279 Ga0500646_0001495
1280 Ga0500583_0000062
1281 Ga0500583_0000276
1282 Ga0500583_0001457
1283 Ga0500569_000223
1284 Ga0500642_0016477
1285 Ga0500658_0007468
1286 Ga0500568_0000511
1287 Ga0500577_0001525
1288 Ga0500589_025059
1289 Ga0500622_0000144
1290 Ga0500622_0000926
1291 Ga0500622_0034403
1292 Ga0501084_0064508
1293 2511231035
1294 2524006166
1295 2585143660
1296 2585156499
1297 2585160850
1298 2587680048
1299 2587748704
1300 2587752268
1301 2587945381
1302 2588211563
1303 2588215947
1304 2588219369
1305 2588224851
1306 2588234683
1307 2588447638
1308 2590603268
1309 2590610281
1310 2729200689
1311 2738698321
1312 2738724497
1313 2739252647
1314 2740032167
1315 2740060501
1316 2753674271
1317 2765575759
1318 2772606100
1319 2775674264
1320 2816875598
1321 2819571871
1322 2821141885
1323 2839991403
1324 2842086327
1325 2871723679
1326 2884636702
1327 2884637318
1328 2889293745
1329 2904469702
1330 2906001110
1331 2910247858
1332 2919100760
1333 2919403122
1334 2919697545
1335 2929927737
1336 2945924730
1337 2946024154
1338 2977247682
1339 2984574515
1340 2984607966
1341 2993375024
1342 2993481888

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8217 55 119
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.7959 55 119
1p0h-assembly1.cif.gz_A crystal structure of rv0819 from mycobacterium tuberculosis mshd-mycothiol synthase coenzyme a complex 0.7597 1 369
1p0h-assembly1.cif.gz_A crystal structure of rv0819 from mycobacterium tuberculosis mshd-mycothiol synthase coenzyme a complex 0.7574 1 369
6sll-assembly1.cif.gz_B diaminobutyrate acetyltransferase ecta from paenibacillus lautus in complex with its substrate l-2,4-diaminobutyric acid (dab) and coenzyme a 0.7548 195 331
ID Description Score Start End Superfamily
af_Q46840_21_390_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8803 5 371 3.40.630.30
af_Q46840_21_390_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8715 5 371 3.40.630.30
af_K7KMF1_95_188_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.794 55 115 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7895 259 323 3.40.630.30
2d4oA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7791 57 115 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A848NBQ9-F1-model_v4 N-acetyltransferase domain-containing protein 0.9917 1 380
AF-A0A5C7EWC3-F1-model_v4 GNAT family N-acetyltransferase 0.9906 3 383
AF-A0A0Q5QCL4-F1-model_v4 N-acetyltransferase domain-containing protein 0.9894 1 383
AF-A0A0Q5QCL4-F1-model_v4 N-acetyltransferase domain-containing protein 0.9868 1 383
AF-A0A381F7K6-F1-model_v4 N-acetyltransferase domain-containing protein 0.9858 1 383

Map