F474167

General Info

Members Datasets Scaffolds Average Seq Length
671 328 671 60

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10173653|Ga0265330_101736532
Length 70
Sequence MQATQSMQNLSPRHVKTEEALWLGVVSGWYSTKVSGTFVSGPHDSEADCLSRIAEINPPPAKRIRVAPAA

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
178 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
179 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
196 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
299 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
300 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
301 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
302 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
303 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
304 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
305 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
306 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
307 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
308 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
309 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
310 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
311 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
312 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
313 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
314 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
315 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
316 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
317 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
318 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
319 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
320 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
321 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
322 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
323 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
324 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
325 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
326 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
327 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
328 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.49
Nodule 0
Rhizoplane 7.15
Rhizosphere 77.79
Stem 0
Stem Tuber 0
Unclassified 6.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1031737 3300001904 Bacteria 816
2 JGI24739J22299_10000994 3300001989 Bacteria 10559
3 JGI24739J22299_10020547 3300001989 Bacteria 2359
4 JGI24737J22298_10002808 3300001990 Bacteria 6167
5 JGI24737J22298_10009616 3300001990 Bacteria 3207
6 JGI24735J21928_10006210 3300002067 Bacteria 3946
7 JGI25153J46596_10059817 3300003215 Bacteria 1041
8 Ga0065715_10120325 3300005293 Bacteria 2261
9 Ga0070658_10306872 3300005327 Bacteria 1354
10 Ga0070683_100050223 3300005329 Bacteria 3860
11 Ga0070683_100783139 3300005329 Bacteria 914
12 Ga0070683_102313892 3300005329 Unclassified 515
13 Ga0070677_10507936 3300005333 Bacteria 654
14 Ga0068869_100636811 3300005334 Bacteria 904
15 Ga0068869_100966370 3300005334 Bacteria 740
16 Ga0070680_100361631 3300005336 Bacteria 1234
17 Ga0070680_100906893 3300005336 Bacteria 760
18 Ga0070682_100865885 3300005337 Bacteria 740
19 Ga0068868_100897588 3300005338 Bacteria 805
20 Ga0068868_101109224 3300005338 Bacteria 728
21 Ga0068868_101963200 3300005338 Bacteria 555
22 Ga0070660_100003722 3300005339 Bacteria 10534
23 Ga0070660_100256463 3300005339 Bacteria 1427
24 Ga0070660_101547230 3300005339 Bacteria 564
25 Ga0070687_101187946 3300005343 Bacteria 562
26 Ga0070661_100271222 3300005344 Bacteria 1314
27 Ga0070661_100315525 3300005344 Bacteria 1220
28 Ga0070668_101119995 3300005347 Bacteria 711
29 Ga0070668_101130424 3300005347 Bacteria 708
30 Ga0070668_101829452 3300005347 Bacteria 559
31 Ga0070675_100602962 3300005354 Bacteria 996
32 Ga0070674_101619814 3300005356 Bacteria 584
33 Ga0070673_101832984 3300005364 Bacteria 575
34 Ga0070659_100233334 3300005366 Bacteria 1521
35 Ga0070659_100258064 3300005366 Bacteria 1446
36 Ga0070659_101784772 3300005366 Bacteria 551
37 Ga0070667_100317816 3300005367 Bacteria 1405
38 Ga0070709_10003383 3300005434 Bacteria 8567
39 Ga0070709_10097254 3300005434 Bacteria 1954
40 Ga0070709_10353795 3300005434 Bacteria 1086
41 Ga0070714_100507205 3300005435 Bacteria 1151
42 Ga0070714_100636630 3300005435 Bacteria 1026
43 Ga0070714_101925400 3300005435 Bacteria 577
44 Ga0070713_100002594 3300005436 Bacteria 11804
45 Ga0070713_100111204 3300005436 Bacteria 2389
46 Ga0070713_100251769 3300005436 Bacteria 1611
47 Ga0070710_10005449 3300005437 Bacteria 6046
48 Ga0070710_10043834 3300005437 Bacteria 2479
49 Ga0070711_100023046 3300005439 Bacteria 4044
50 Ga0070711_100025335 3300005439 Bacteria 3881
51 Ga0070711_100289792 3300005439 Bacteria 1298
52 Ga0070711_101446452 3300005439 Bacteria 599
53 Ga0070711_101569920 3300005439 Unclassified 575
54 Ga0070663_100017501 3300005455 Bacteria 4679
55 Ga0070663_101074072 3300005455 Bacteria 703
56 Ga0070663_101365250 3300005455 Unclassified 627
57 Ga0070663_101588143 3300005455 Bacteria 583
58 Ga0070678_100079467 3300005456 Bacteria 2481
59 Ga0070662_100075193 3300005457 Bacteria 2501
60 Ga0070681_10010223 3300005458 Bacteria 9257
61 Ga0070681_10057793 3300005458 Bacteria 3859
62 Ga0070681_10469730 3300005458 Bacteria 1170
63 Ga0068867_100523272 3300005459 Bacteria 1023
64 Ga0070706_100330359 3300005467 Bacteria 1422
65 Ga0070706_100612872 3300005467 Bacteria 1011
66 Ga0070707_100106096 3300005468 Bacteria 2725
67 Ga0070698_100842729 3300005471 Bacteria 861
68 Ga0070699_101641184 3300005518 Bacteria 589
69 Ga0070679_100004045 3300005530 Bacteria 13508
70 Ga0070679_101021125 3300005530 Bacteria 771
71 Ga0070684_100212619 3300005535 Bacteria 1763
72 Ga0070684_100218336 3300005535 Bacteria 1739
73 Ga0070684_100684088 3300005535 Bacteria 956
74 Ga0070684_101301882 3300005535 Bacteria 684
75 Ga0070697_100008732 3300005536 Bacteria 7911
76 Ga0070697_100424487 3300005536 Bacteria 1156
77 Ga0070697_101111451 3300005536 Bacteria 703
78 Ga0068853_100011965 3300005539 Bacteria 7057
79 Ga0068853_100044352 3300005539 Bacteria 3807
80 Ga0068853_100058719 3300005539 Bacteria 3321
81 Ga0068853_100078277 3300005539 Bacteria 2889
82 Ga0068853_100106594 3300005539 Bacteria 2484
83 Ga0068853_102021580 3300005539 Bacteria 559
84 Ga0070672_100025342 3300005543 Bacteria 4397
85 Ga0070672_100448674 3300005543 Bacteria 1111
86 Ga0070686_100094482 3300005544 Bacteria 2007
87 Ga0070693_100349127 3300005547 Bacteria 1012
88 Ga0070693_100652772 3300005547 Bacteria 765
89 Ga0070693_100689407 3300005547 Bacteria 747
90 Ga0070665_100830823 3300005548 Bacteria 937
91 Ga0070665_101452953 3300005548 Bacteria 694
92 Ga0070665_101880714 3300005548 Bacteria 604
93 Ga0068855_100020255 3300005563 Bacteria 7984
94 Ga0068855_100020651 3300005563 Bacteria 7898
95 Ga0068855_100024639 3300005563 Bacteria 7197
96 Ga0070664_100199805 3300005564 Bacteria 1784
97 Ga0070664_100392479 3300005564 Bacteria 1268
98 Ga0068857_100010911 3300005577 Bacteria 7909
99 Ga0068857_100073096 3300005577 Bacteria 3055
100 Ga0068857_100185123 3300005577 Bacteria 1896
101 Ga0068854_100057575 3300005578 Bacteria 2804
102 Ga0068854_100206793 3300005578 Bacteria 1546
103 Ga0068854_102057572 3300005578 Bacteria 527
104 Ga0068856_100013826 3300005614 Bacteria 7803
105 Ga0070702_100370414 3300005615 Bacteria 1015
106 Ga0068852_100275230 3300005616 Bacteria 1621
107 Ga0068852_100674898 3300005616 Bacteria 1042
108 Ga0068852_101989409 3300005616 Unclassified 603
109 Ga0068852_102210537 3300005616 Bacteria 572
110 Ga0068859_100298992 3300005617 Bacteria 1703
111 Ga0068859_102089109 3300005617 Unclassified 625
112 Ga0068866_10389442 3300005718 Bacteria 896
113 Ga0068851_10242155 3300005834 Bacteria 1020
114 Ga0068851_10434412 3300005834 Bacteria 777
115 Ga0068851_11044693 3300005834 Bacteria 517
116 Ga0068863_100835384 3300005841 Bacteria 919
117 Ga0068863_100902150 3300005841 Bacteria 884
118 Ga0068858_100177733 3300005842 Bacteria 2009
119 Ga0068858_100226200 3300005842 Bacteria 1773
120 Ga0068858_101093175 3300005842 Unclassified 783
121 Ga0068860_100993774 3300005843 Bacteria 857
122 Ga0068860_101243427 3300005843 Bacteria 765
123 Ga0081455_10035923 3300005937 Bacteria 4419
124 Ga0070717_10067381 3300006028 Bacteria 2978
125 Ga0070717_10179047 3300006028 Bacteria 1847
126 Ga0070717_10392678 3300006028 Bacteria 1245
127 Ga0070717_11596520 3300006028 Bacteria 591
128 Ga0075365_10138058 3300006038 Bacteria 1691
129 Ga0075365_10400926 3300006038 Bacteria 968
130 Ga0075365_11322186 3300006038 Bacteria 506
131 Ga0075364_10183994 3300006051 Bacteria 1414
132 Ga0070715_10003754 3300006163 Bacteria 4892
133 Ga0070715_10094890 3300006163 Bacteria 1380
134 Ga0070716_100055242 3300006173 Bacteria 2271
135 Ga0070716_100117844 3300006173 Bacteria 1657
136 Ga0070716_100498210 3300006173 Bacteria 898
137 Ga0070716_101024157 3300006173 Bacteria 654
138 Ga0070712_100009607 3300006175 Bacteria 6098
139 Ga0070712_100039813 3300006175 Bacteria 3218
140 Ga0070712_100405534 3300006175 Bacteria 1127
141 Ga0075367_10206761 3300006178 Bacteria 1227
142 Ga0075367_10268677 3300006178 Unclassified 1071
143 Ga0075369_10654701 3300006186 Bacteria 504
144 Ga0097621_100225663 3300006237 Bacteria 1634
145 Ga0097621_100815406 3300006237 Bacteria 865
146 Ga0097621_102323818 3300006237 Bacteria 513
147 Ga0097621_102335592 3300006237 Bacteria 512
148 Ga0068865_100338136 3300006881 Bacteria 1216
149 Ga0097620_100298996 3300006931 Bacteria 1703
150 Ga0097620_102089854 3300006931 Unclassified 625
151 Ga0099794_10585178 3300007265 Bacteria 591
152 Ga0099794_10671529 3300007265 Unclassified 551
153 Ga0099794_10726870 3300007265 Bacteria 529
154 Ga0099794_10730020 3300007265 Bacteria 528
155 Ga0099795_10021022 3300007788 Bacteria 2135
156 Ga0099795_10027813 3300007788 Bacteria 1916
157 Ga0099795_10148003 3300007788 Bacteria 960
158 Ga0099795_10654860 3300007788 Bacteria 503
159 Ga0105240_10031140 3300009093 Bacteria 6922
160 Ga0105240_10035863 3300009093 Bacteria 6387
161 Ga0105240_10197718 3300009093 Bacteria 2358
162 Ga0105240_10398156 3300009093 Bacteria 1551
163 Ga0105240_10402848 3300009093 Bacteria 1540
164 Ga0105240_10523887 3300009093 Bacteria 1315
165 Ga0105247_10158870 3300009101 Bacteria 1495
166 Ga0105247_10287949 3300009101 Bacteria 1135
167 Ga0105247_10448835 3300009101 Bacteria 929
168 Ga0105247_11862777 3300009101 Bacteria 502
169 Ga0105243_10370078 3300009148 Bacteria 1322
170 Ga0105243_11257933 3300009148 Bacteria 755
171 Ga0105241_10055041 3300009174 Bacteria 3047
172 Ga0105241_10200352 3300009174 Bacteria 1667
173 Ga0105241_11454213 3300009174 Unclassified 658
174 Ga0105241_11601032 3300009174 Bacteria 630
175 Ga0105242_10630021 3300009176 Bacteria 1040
176 Ga0105248_10025081 3300009177 Bacteria 6629
177 Ga0105248_10305891 3300009177 Bacteria 1790
178 Ga0105248_12988661 3300009177 Bacteria 539
179 Ga0105237_10009459 3300009545 Bacteria 10438
180 Ga0105237_10009470 3300009545 Bacteria 10433
181 Ga0105237_10123402 3300009545 Bacteria 2584
182 Ga0105237_10255007 3300009545 Bacteria 1756
183 Ga0105237_10275301 3300009545 Bacteria 1686
184 Ga0105237_10758847 3300009545 Bacteria 977
185 Ga0105237_11182669 3300009545 Bacteria 771
186 Ga0105237_11723665 3300009545 Unclassified 634
187 Ga0105238_10009011 3300009551 Bacteria 9983
188 Ga0105238_10017548 3300009551 Bacteria 7278
189 Ga0105238_10156359 3300009551 Bacteria 2255
190 Ga0105238_10390752 3300009551 Bacteria 1383
191 Ga0105249_10219056 3300009553 Bacteria 1872
192 Ga0105249_10251662 3300009553 Bacteria 1752
193 Ga0099796_10075009 3300010159 Bacteria 1229
194 Ga0099796_10160526 3300010159 Bacteria 891
195 Ga0099796_10308289 3300010159 Bacteria 672
196 Ga0105239_10015132 3300010375 Bacteria 8551
197 Ga0105239_10027064 3300010375 Bacteria 6313
198 Ga0105239_10149385 3300010375 Bacteria 2607
199 Ga0105239_10253658 3300010375 Bacteria 1976
200 Ga0105239_10464963 3300010375 Bacteria 1436
201 Ga0105239_11447518 3300010375 Bacteria 793
202 Ga0105239_12527561 3300010375 Bacteria 599
203 Ga0105246_10331686 3300011119 Bacteria 1240
204 Ga0105246_10488858 3300011119 Bacteria 1043
205 Ga0105246_10805062 3300011119 Bacteria 834
206 Ga0105246_12329422 3300011119 Bacteria 524
207 Ga0157370_10033076 3300013104 Bacteria 5042
208 Ga0157369_10020222 3300013105 Bacteria 7443
209 Ga0157369_12204306 3300013105 Bacteria 559
210 Ga0157374_10460966 3300013296 Bacteria 1273
211 Ga0157374_11793989 3300013296 Bacteria 639
212 Ga0163162_10484505 3300013306 Bacteria 1368
213 Ga0157372_10166903 3300013307 Bacteria 2546
214 Ga0157375_12882046 3300013308 Bacteria 575
215 Ga0163163_10963761 3300014325 Unclassified 916
216 Ga0163163_11128721 3300014325 Bacteria 847
217 Ga0163163_11673690 3300014325 Unclassified 697
218 Ga0163163_12214358 3300014325 Unclassified 609
219 Ga0157380_13161504 3300014326 Bacteria 526
220 Ga0182008_10110458 3300014497 Bacteria 1362
221 Ga0157377_10281129 3300014745 Bacteria 1091
222 Ga0157379_10209148 3300014968 Bacteria 1766
223 Ga0157379_10939541 3300014968 Bacteria 822
224 Ga0157376_10319065 3300014969 Bacteria 1477
225 Ga0157376_12611199 3300014969 Bacteria 545
226 Ga0163161_10095370 3300017792 Bacteria 2207
227 Ga0163161_11457037 3300017792 Bacteria 600
228 Ga0209758_1004067 3300025297 Bacteria 12592
229 Ga0207697_10007283 3300025315 Bacteria 4942
230 Ga0207656_10083290 3300025321 Bacteria 1441
231 Ga0207656_10216650 3300025321 Bacteria 929
232 Ga0207692_10032424 3300025898 Bacteria 2511
233 Ga0207692_10129017 3300025898 Bacteria 1425
234 Ga0207710_10473186 3300025900 Unclassified 648
235 Ga0207710_10549819 3300025900 Bacteria 601
236 Ga0207688_10149914 3300025901 Bacteria 1377
237 Ga0207647_10006000 3300025904 Bacteria 8850
238 Ga0207647_10022741 3300025904 Bacteria 4160
239 Ga0207647_10156001 3300025904 Bacteria 1333
240 Ga0207647_10344404 3300025904 Bacteria 844
241 Ga0207685_10027964 3300025905 Bacteria 1980
242 Ga0207699_10018080 3300025906 Bacteria 3728
243 Ga0207699_10030363 3300025906 Bacteria 3023
244 Ga0207699_10172022 3300025906 Bacteria 1450
245 Ga0207699_10713003 3300025906 Unclassified 735
246 Ga0207705_10295032 3300025909 Bacteria 1243
247 Ga0207684_10568814 3300025910 Bacteria 969
248 Ga0207654_10876709 3300025911 Bacteria 650
249 Ga0207707_10005343 3300025912 Bacteria 11225
250 Ga0207707_10051455 3300025912 Bacteria 3587
251 Ga0207707_10088161 3300025912 Bacteria 2710
252 Ga0207695_10047109 3300025913 Bacteria 4565
253 Ga0207695_10096550 3300025913 Bacteria 2957
254 Ga0207695_10223701 3300025913 Bacteria 1789
255 Ga0207695_10252428 3300025913 Bacteria 1663
256 Ga0207695_10299191 3300025913 Bacteria 1500
257 Ga0207695_10475279 3300025913 Bacteria 1132
258 Ga0207695_10883556 3300025913 Bacteria 773
259 Ga0207671_10084211 3300025914 Bacteria 2388
260 Ga0207671_10126647 3300025914 Bacteria 1957
261 Ga0207671_10723876 3300025914 Bacteria 791
262 Ga0207671_10776972 3300025914 Bacteria 760
263 Ga0207671_11437910 3300025914 Unclassified 534
264 Ga0207693_10015799 3300025915 Bacteria 6048
265 Ga0207693_10184408 3300025915 Bacteria 1643
266 Ga0207693_10233469 3300025915 Bacteria 1444
267 Ga0207663_10055078 3300025916 Bacteria 2494
268 Ga0207663_10212756 3300025916 Bacteria 1402
269 Ga0207663_10300981 3300025916 Bacteria 1198
270 Ga0207663_10349887 3300025916 Bacteria 1118
271 Ga0207660_10018171 3300025917 Bacteria 4682
272 Ga0207660_10053074 3300025917 Bacteria 2888
273 Ga0207662_10941031 3300025918 Bacteria 612
274 Ga0207657_10006315 3300025919 Bacteria 12312
275 Ga0207657_11238234 3300025919 Bacteria 566
276 Ga0207649_10125903 3300025920 Bacteria 1734
277 Ga0207649_11688191 3300025920 Bacteria 501
278 Ga0207652_10116431 3300025921 Bacteria 2374
279 Ga0207652_10145273 3300025921 Bacteria 2122
280 Ga0207652_10857866 3300025921 Bacteria 804
281 Ga0207694_10043027 3300025924 Bacteria 3485
282 Ga0207694_10105853 3300025924 Bacteria 2234
283 Ga0207694_10118535 3300025924 Bacteria 2112
284 Ga0207694_10415166 3300025924 Bacteria 1120
285 Ga0207659_10724391 3300025926 Bacteria 852
286 Ga0207700_10003371 3300025928 Bacteria 9275
287 Ga0207700_10056874 3300025928 Bacteria 2947
288 Ga0207700_10090527 3300025928 Bacteria 2415
289 Ga0207664_10020128 3300025929 Bacteria 4941
290 Ga0207664_10146209 3300025929 Bacteria 2005
291 Ga0207664_10548180 3300025929 Bacteria 1037
292 Ga0207690_10080187 3300025932 Bacteria 2277
293 Ga0207690_11675302 3300025932 Bacteria 531
294 Ga0207706_10101488 3300025933 Bacteria 2531
295 Ga0207706_10229253 3300025933 Bacteria 1625
296 Ga0207686_10586344 3300025934 Bacteria 876
297 Ga0207686_11329049 3300025934 Bacteria 591
298 Ga0207709_11047440 3300025935 Bacteria 668
299 Ga0207670_10180841 3300025936 Bacteria 1588
300 Ga0207669_10419467 3300025937 Bacteria 1053
301 Ga0207669_11132619 3300025937 Bacteria 661
302 Ga0207669_11622139 3300025937 Bacteria 552
303 Ga0207665_10033272 3300025939 Bacteria 3416
304 Ga0207665_10938287 3300025939 Bacteria 687
305 Ga0207711_10109583 3300025941 Bacteria 2454
306 Ga0207711_10324839 3300025941 Bacteria 1422
307 Ga0207711_10911551 3300025941 Bacteria 817
308 Ga0207661_10032322 3300025944 Bacteria 4052
309 Ga0207661_10051711 3300025944 Bacteria 3279
310 Ga0207661_11155184 3300025944 Bacteria 713
311 Ga0207661_11311935 3300025944 Bacteria 665
312 Ga0207667_10014461 3300025949 Bacteria 8997
313 Ga0207667_10023959 3300025949 Bacteria 6715
314 Ga0207667_10044250 3300025949 Bacteria 4719
315 Ga0207667_10867583 3300025949 Bacteria 896
316 Ga0207667_10878231 3300025949 Bacteria 890
317 Ga0207712_10375695 3300025961 Bacteria 1188
318 Ga0207712_10873808 3300025961 Bacteria 793
319 Ga0207712_11090285 3300025961 Bacteria 710
320 Ga0207640_10015094 3300025981 Bacteria 4464
321 Ga0207640_10420404 3300025981 Bacteria 1094
322 Ga0207640_12017685 3300025981 Bacteria 523
323 Ga0207658_10807077 3300025986 Bacteria 852
324 Ga0207703_10371248 3300026035 Bacteria 1321
325 Ga0207703_12133922 3300026035 Bacteria 536
326 Ga0207639_10031182 3300026041 Bacteria 3916
327 Ga0207639_10088708 3300026041 Bacteria 2469
328 Ga0207639_10134662 3300026041 Bacteria 2050
329 Ga0207639_10656871 3300026041 Bacteria 970
330 Ga0207639_10702688 3300026041 Bacteria 938
331 Ga0207639_11961514 3300026041 Bacteria 546
332 Ga0207678_10135485 3300026067 Bacteria 2101
333 Ga0207678_10510941 3300026067 Bacteria 1048
334 Ga0207678_10535077 3300026067 Bacteria 1024
335 Ga0207702_10026782 3300026078 Bacteria 4787
336 Ga0207702_10693403 3300026078 Bacteria 1003
337 Ga0207641_10265154 3300026088 Bacteria 1610
338 Ga0207641_10405586 3300026088 Bacteria 1310
339 Ga0207674_10006945 3300026116 Bacteria 13259
340 Ga0207674_10017516 3300026116 Bacteria 7815
341 Ga0207674_10078005 3300026116 Bacteria 3318
342 Ga0207675_101843607 3300026118 Bacteria 624
343 Ga0207683_10351773 3300026121 Bacteria 1352
344 Ga0207683_11201608 3300026121 Bacteria 703
345 Ga0207698_10139373 3300026142 Bacteria 2087
346 Ga0207698_10355981 3300026142 Bacteria 1384
347 Ga0207698_10885328 3300026142 Bacteria 899
348 Ga0209179_1019280 3300027512 Bacteria 1312
349 Ga0209179_1058124 3300027512 Bacteria 837
350 Ga0209179_1074138 3300027512 Bacteria 747
351 Ga0209179_1093384 3300027512 Bacteria 668
352 Ga0209588_1079305 3300027671 Bacteria 1061
353 Ga0209813_10323648 3300027866 Unclassified 604
354 Ga0268266_11795174 3300028379 Bacteria 588
355 Ga0268264_11223208 3300028381 Bacteria 761
356 Ga0268264_11249358 3300028381 Bacteria 753
357 Ga0265334_10066879 3300028573 Bacteria 1344
358 Ga0307517_10000483 3300028786 Bacteria 68332
359 Ga0307517_10544396 3300028786 Bacteria 581
360 Ga0307515_10035400 3300028794 Bacteria 8125
361 Ga0307515_10393518 3300028794 Bacteria 1014
362 Ga0307515_10867000 3300028794 Bacteria 531
363 Ga0265762_1015148 3300030760 Bacteria 1395
364 Ga0265763_1011726 3300030763 Bacteria 827
365 Ga0265760_10052842 3300031090 Bacteria 1225
366 Ga0265330_10003310 3300031235 Bacteria 8474
367 Ga0265330_10020070 3300031235 Bacteria 3055
368 Ga0265330_10056010 3300031235 Bacteria 1721
369 Ga0265330_10173653 3300031235 Bacteria 913
370 Ga0265332_10329663 3300031238 Bacteria 630
371 Ga0265328_10260667 3300031239 Bacteria 665
372 Ga0265325_10066080 3300031241 Bacteria 1824
373 Ga0265340_10000504 3300031247 Bacteria 21438
374 Ga0265340_10044772 3300031247 Bacteria 2165
375 Ga0265331_10289362 3300031250 Bacteria 734
376 Ga0265316_10134732 3300031344 Bacteria 1859
377 Ga0265316_10324436 3300031344 Bacteria 1118
378 Ga0307513_10211720 3300031456 Bacteria 1769
379 Ga0307408_100433661 3300031548 Bacteria 1136
380 Ga0307408_100800787 3300031548 Bacteria 855
381 Ga0265313_10053565 3300031595 Bacteria 1920
382 Ga0307508_10091451 3300031616 Bacteria 2631
383 Ga0307508_10124169 3300031616 Bacteria 2184
384 Ga0307508_10179322 3300031616 Bacteria 1721
385 Ga0265314_10005362 3300031711 Bacteria 11590
386 Ga0265342_10087734 3300031712 Bacteria 1787
387 Ga0265342_10160817 3300031712 Bacteria 1241
388 Ga0307516_10032161 3300031730 Bacteria 5284
389 Ga0307516_10195303 3300031730 Bacteria 1747
390 Ga0307516_10620178 3300031730 Bacteria 736
391 Ga0307516_10990182 3300031730 Bacteria 512
392 Ga0307405_10710768 3300031731 Bacteria 833
393 Ga0307413_10679583 3300031824 Bacteria 853
394 Ga0307406_10090174 3300031901 Bacteria 2062
395 Ga0307412_10635582 3300031911 Bacteria 908
396 Ga0307416_100340528 3300032002 Bacteria 1512
397 Ga0307416_100984081 3300032002 Bacteria 946
398 Ga0307411_10409545 3300032005 Bacteria 1123
399 Ga0307411_10523279 3300032005 Bacteria 1007
400 Ga0307411_12120760 3300032005 Bacteria 526
401 Ga0307415_102017136 3300032126 Bacteria 562
402 Ga0373930_0029012 3300034816 Bacteria 1129
403 Ga0373948_0070034 3300034817 Bacteria 785
404 Ga0373958_0202952 3300034819 Bacteria 520
405 Ga0373929_0129057 3300035085 Bacteria 661
406 Ga0373934_0018773 3300035086 Bacteria 2649
407 Ga0373952_0009417 3300035092 Bacteria 1870
408 Ga0373923_0026612 3300035111 Bacteria 2302
409 Ga0373932_0428040 3300035112 Bacteria 516
410 Ga0373936_0089798 3300035113 Bacteria 1287
411 Ga0373939_0225005 3300035114 Bacteria 720
412 Ga0373939_0468383 3300035114 Bacteria 533
413 Ga0373941_0019211 3300035115 Bacteria 1899
414 Ga0373953_0036598 3300035117 Bacteria 1934
415 Ga0373954_0000167 3300035118 Bacteria 23536
416 Ga0373954_0010236 3300035118 Bacteria 4135
417 Ga0373956_0008200 3300035119 Bacteria 4228
418 Ga0373957_0010346 3300035120 Bacteria 3081
419 Ga0373943_0514682 3300035170 Bacteria 700
420 Ga0373946_0121518 3300035171 Bacteria 1193
421 Ga0373955_0036864 3300035172 Bacteria 2598
422 Ga0373942_0252111 3300035207 Bacteria 600
423 Ga0373961_0340611 3300035241 Bacteria 563
424 Ga0373931_0046226 3300035691 Bacteria 2300
425 Ga0373931_1031291 3300035691 Bacteria 558
426 Ga0373935_0064843 3300035692 Bacteria 2343
427 Ga0373935_0189332 3300035692 Bacteria 1416
428 Ga0373927_0030244 3300035695 Bacteria 3534
429 Ga0373927_0054833 3300035695 Bacteria 2578
430 Ga0373927_0137605 3300035695 Bacteria 1596
431 Ga0373933_0000007 3300035724 Bacteria 123599
432 Ga0373933_0167420 3300035724 Bacteria 1397
433 Ga0373933_0813823 3300035724 Bacteria 615
434 Ga0373947_0007264 3300035725 Bacteria 6418
435 Ga0373947_0026147 3300035725 Bacteria 3408
436 Ga0373947_0315040 3300035725 Bacteria 1045
437 Ga0373937_0109431 3300036401 Bacteria 2569
438 Ga0373937_1354069 3300036401 Bacteria 660
439 Ga0373925_0054927 3300037068 Bacteria 2980
440 Ga0373925_0321310 3300037068 Bacteria 1252
441 Ga0373925_0406969 3300037068 Bacteria 1110
442 Ga0373925_0853740 3300037068 Bacteria 750
443 Ga0395905_0108267 3300037471 Bacteria 2609
444 Ga0439465_0164620 3300041413 Bacteria 797
445 Ga0451797_0927315 3300041453 Bacteria 620
446 Ga0451807_0729203 3300041486 Bacteria 539
447 Ga0451807_2732070 3300041486 Bacteria 751
448 Ga0451843_1558469 3300041509 Bacteria 569
449 Ga0451853_1829236 3300041512 Bacteria 547
450 Ga0451853_3880663 3300041512 Bacteria 1037
451 Ga0495592_0098584 3300046454 Bacteria 2085
452 Ga0495592_0347980 3300046454 Bacteria 951
453 Ga0495603_0044822 3300046455 Bacteria 2639
454 Ga0495603_0182585 3300046455 Bacteria 1214
455 Ga0495603_0203838 3300046455 Bacteria 1143
456 Ga0495629_0007517 3300046459 Bacteria 8035
457 Ga0495629_0598971 3300046459 Bacteria 737
458 Ga0495638_0146764 3300046460 Bacteria 1372
459 Ga0495638_0206863 3300046460 Bacteria 1104
460 Ga0495641_0276798 3300046461 Bacteria 755
461 Ga0495651_0070399 3300046462 Bacteria 2661
462 Ga0495651_0237577 3300046462 Bacteria 1251
463 Ga0495651_0396542 3300046462 Bacteria 902
464 Ga0495653_0046964 3300046463 Bacteria 3341
465 Ga0495580_0380064 3300046472 Bacteria 954
466 Ga0495582_0821511 3300046473 Bacteria 538
467 Ga0495639_0219630 3300046475 Bacteria 934
468 Ga0495639_0418016 3300046475 Bacteria 679
469 Ga0495664_0141838 3300046477 Bacteria 1457
470 Ga0495585_0195454 3300046492 Bacteria 1033
471 Ga0495594_0179064 3300046499 Bacteria 1207
472 Ga0495608_0020550 3300046511 Bacteria 4538
473 Ga0495608_0356938 3300046511 Bacteria 899
474 Ga0495618_0099410 3300046514 Bacteria 1862
475 Ga0495618_0468346 3300046514 Bacteria 763
476 Ga0495628_0075427 3300046516 Bacteria 2626
477 Ga0495628_0948014 3300046516 Bacteria 595
478 Ga0495628_1202165 3300046516 Bacteria 514
479 Ga0495630_0111792 3300046517 Bacteria 2069
480 Ga0495630_1082726 3300046517 Bacteria 608
481 Ga0495631_0200633 3300046518 Bacteria 853
482 Ga0495632_0146203 3300046519 Bacteria 1094
483 Ga0495652_0519930 3300046529 Bacteria 823
484 Ga0495652_0678237 3300046529 Bacteria 695
485 Ga0495652_1108562 3300046529 Bacteria 513
486 Ga0495640_0478595 3300046533 Bacteria 759
487 Ga0495640_0806888 3300046533 Bacteria 559
488 Ga0495640_0809797 3300046533 Bacteria 558
489 Ga0495587_0091601 3300046536 Bacteria 1755
490 Ga0495587_0746320 3300046536 Bacteria 535
491 Ga0495609_0140149 3300046538 Bacteria 1032
492 Ga0495645_0010229 3300046543 Bacteria 6573
493 Ga0495633_0163374 3300046558 Bacteria 1027
494 Ga0495667_0526317 3300046559 Bacteria 739
495 Ga0495668_0063371 3300046616 Bacteria 2036
496 Ga0495668_0208938 3300046616 Bacteria 1069
497 Ga0495668_0293011 3300046616 Bacteria 892
498 Ga0495668_0369223 3300046616 Bacteria 788
499 Ga0495634_0014308 3300046642 Bacteria 5724
500 Ga0495625_0281457 3300046660 Bacteria 1070
501 Ga0495625_0455891 3300046660 Bacteria 789
502 Ga0495635_0003274 3300046663 Bacteria 11179
503 Ga0495635_0995604 3300046663 Bacteria 534
504 Ga0495588_0089468 3300046674 Bacteria 1612
505 Ga0495657_0080130 3300046675 Bacteria 2113
506 Ga0495657_0282121 3300046675 Bacteria 994
507 Ga0495599_0151751 3300046678 Bacteria 1434
508 Ga0495623_0030686 3300046679 Bacteria 3457
509 Ga0495623_0257122 3300046679 Bacteria 980
510 Ga0495646_0056840 3300046680 Bacteria 2344
511 Ga0495658_0342121 3300046683 Bacteria 950
512 Ga0495669_0144623 3300046684 Bacteria 1123
513 Ga0495613_0434284 3300046689 Bacteria 892
514 Ga0495613_0485165 3300046689 Bacteria 834
515 Ga0495624_0157474 3300046690 Bacteria 1388
516 Ga0495624_0480984 3300046690 Bacteria 743
517 Ga0495600_0277534 3300046809 Bacteria 1061
518 Ga0495600_0408815 3300046809 Bacteria 843
519 Ga0495581_0197796 3300047315 Bacteria 1176
520 Ga0495604_0336399 3300047317 Bacteria 1006
521 Ga0495604_0443849 3300047317 Bacteria 848
522 Ga0495604_0743782 3300047317 Bacteria 621
523 Ga0495674_0059246 3300047319 Bacteria 3345
524 Ga0495674_0693374 3300047319 Bacteria 800
525 Ga0495674_1244652 3300047319 Bacteria 561
526 Ga0495672_0043133 3300047320 Bacteria 2714
527 Ga0495672_0051539 3300047320 Bacteria 2423
528 Ga0495680_0628819 3300047322 Bacteria 715
529 Ga0495680_0727409 3300047322 Bacteria 653
530 Ga0495683_0457694 3300047323 Unclassified 523
531 Ga0495675_0336293 3300047444 Bacteria 890
532 Ga0495675_0812056 3300047444 Unclassified 517
533 Ga0495684_0004169 3300047471 Bacteria 11285
534 Ga0495684_0488731 3300047471 Bacteria 849
535 Ga0495686_0684323 3300047472 Bacteria 524
536 Ga0495593_0000677 3300047673 Bacteria 19636
537 Ga0495602_0128374 3300048088 Bacteria 2027
538 Ga0495602_0165923 3300048088 Bacteria 1719
539 Ga0496100_0121130 3300048903 Bacteria 1830
540 Ga0496100_0777672 3300048903 Bacteria 749
541 Ga0496101_0351167 3300048904 Bacteria 1159
542 Ga0496101_0553801 3300048904 Bacteria 909
543 Ga0496101_0800897 3300048904 Bacteria 743
544 Ga0496102_0041504 3300048905 Bacteria 4166
545 Ga0496102_0886682 3300048905 Bacteria 814
546 Ga0496102_1048929 3300048905 Bacteria 735
547 Ga0496103_0044738 3300048906 Bacteria 2729
548 Ga0496103_0682323 3300048906 Unclassified 652
549 Ga0496103_0782969 3300048906 Bacteria 602
550 Ga0496104_0049725 3300048907 Bacteria 3953
551 Ga0496104_0796277 3300048907 Bacteria 851
552 Ga0496105_0279096 3300048908 Bacteria 1347
553 Ga0496105_0624893 3300048908 Unclassified 834
554 Ga0496106_0037402 3300048909 Bacteria 3631
555 Ga0496106_0427881 3300048909 Bacteria 1064
556 Ga0496106_0469218 3300048909 Bacteria 1011
557 Ga0496107_0018511 3300048910 Bacteria 4905
558 Ga0496108_0183820 3300048911 Bacteria 1811
559 Ga0496108_0226278 3300048911 Bacteria 1626
560 Ga0496108_0813113 3300048911 Unclassified 806
561 Ga0496109_0043350 3300048912 Bacteria 4078
562 Ga0496110_0042751 3300048913 Bacteria 3955
563 Ga0496110_0189253 3300048913 Bacteria 1869
564 Ga0496110_0326242 3300048913 Bacteria 1398
565 Ga0496110_0753317 3300048913 Unclassified 877
566 Ga0496110_1255030 3300048913 Unclassified 650
567 Ga0496111_0260331 3300048914 Bacteria 1287
568 Ga0496112_0163417 3300048915 Bacteria 2192
569 Ga0496112_0166716 3300048915 Bacteria 2168
570 Ga0496112_0205865 3300048915 Bacteria 1926
571 Ga0496112_0324303 3300048915 Bacteria 1484
572 Ga0496113_0411753 3300048916 Bacteria 1086
573 Ga0496113_0508110 3300048916 Bacteria 967
574 Ga0496114_0042890 3300048917 Bacteria 3750
575 Ga0496114_0114398 3300048917 Bacteria 2314
576 Ga0496114_0196302 3300048917 Bacteria 1767
577 Ga0496115_0043376 3300048918 Bacteria 3587
578 Ga0496115_0097503 3300048918 Bacteria 2407
579 Ga0496115_0300779 3300048918 Bacteria 1315
580 Ga0496115_0418620 3300048918 Bacteria 1085
581 Ga0496115_0511437 3300048918 Bacteria 964
582 Ga0496115_0913531 3300048918 Bacteria 676
583 Ga0496115_1069548 3300048918 Bacteria 613
584 Ga0496116_0294912 3300048919 Bacteria 776
585 Ga0496117_0162709 3300048920 Bacteria 1305
586 Ga0496118_0027432 3300048921 Bacteria 4819
587 Ga0496118_0551070 3300048921 Bacteria 562
588 Ga0496119_0059502 3300048922 Bacteria 2294
589 Ga0496119_0062748 3300048922 Bacteria 2213
590 Ga0496119_0167090 3300048922 Bacteria 1165
591 Ga0496121_0000214 3300048924 Bacteria 127349
592 Ga0496121_0004032 3300048924 Bacteria 20180
593 Ga0496121_0258443 3300048924 Bacteria 1204
594 Ga0496121_0288958 3300048924 Bacteria 1118
595 Ga0496121_0296884 3300048924 Bacteria 1098
596 Ga0496121_0823307 3300048924 Bacteria 543
597 Ga0496124_0416664 3300048927 Bacteria 927
598 Ga0496124_0507151 3300048927 Bacteria 807
599 Ga0496124_0893796 3300048927 Bacteria 540
600 Ga0496125_0104958 3300048928 Bacteria 2067
601 Ga0496125_0559300 3300048928 Bacteria 632
602 Ga0496126_0007566 3300048929 Bacteria 11875
603 Ga0496126_0072520 3300048929 Bacteria 3063
604 Ga0496126_0087634 3300048929 Bacteria 2743
605 Ga0496126_0269056 3300048929 Bacteria 1415
606 Ga0496126_0291012 3300048929 Bacteria 1351
607 Ga0496126_0577425 3300048929 Bacteria 888
608 Ga0496126_0664367 3300048929 Bacteria 814
609 Ga0496126_0880732 3300048929 Bacteria 680
610 Ga0496126_1198702 3300048929 Bacteria 558
611 Ga0496126_1298660 3300048929 Bacteria 530
612 Ga0495682_0191647 3300049460 Bacteria 726
613 nmdc:mga00v17_664988_c1 3300050491 Bacteria 669
614 nmdc:mga0yw44_285726_c1 3300050492 Bacteria 1103
615 nmdc:mga0yw44_652479_c1 3300050492 Bacteria 715
616 nmdc:mga0yw44_937617_c1 3300050492 Bacteria 587
617 nmdc:mga06z11_30105_c1 3300050494 Bacteria 2623
618 nmdc:mga06z11_96577_c1 3300050494 Bacteria 1614
619 nmdc:mga04h51_356935_c1 3300050495 Unclassified 605
620 nmdc:mga07m45_680025_c1 3300050496 Bacteria 592
621 nmdc:mga0n895_1083211_c1 3300050512 Bacteria 779
622 nmdc:mga0sz30_428918_c1 3300050516 Bacteria 593
623 Ga0495601_0084762 3300053077 Bacteria 2036
624 Ga0495601_0108481 3300053077 Bacteria 1796
625 Ga0495601_0616018 3300053077 Bacteria 696
626 Ga0495612_0390829 3300053078 Bacteria 631
627 Ga0495655_0201406 3300053083 Bacteria 651
628 Ga0495595_0002075 3300053084 Bacteria 7796
629 Ga0495595_0091768 3300053084 Bacteria 1458
630 Ga0495595_0211033 3300053084 Bacteria 968
631 Ga0495619_0224410 3300053085 Bacteria 1301
632 Ga0495619_0732760 3300053085 Bacteria 671
633 Ga0495619_1211703 3300053085 Bacteria 500
634 Ga0500578_0341153 3300053086 Bacteria 878
635 Ga0500647_0058237 3300053091 Bacteria 1858
636 Ga0500583_0231463 3300053092 Bacteria 915
637 Ga0500651_0012431 3300053093 Bacteria 5160
638 Ga0500651_0583040 3300053093 Bacteria 608
639 Ga0500566_0002356 3300053094 Bacteria 11186
640 Ga0500640_045834 3300053095 Bacteria 1916
641 Ga0500641_0385284 3300053096 Bacteria 555
642 Ga0500648_277890 3300053097 Bacteria 758
643 Ga0500556_0202273 3300053104 Bacteria 785
644 Ga0500572_003525 3300053111 Bacteria 3567
645 Ga0500591_110324 3300053115 Bacteria 1154
646 Ga0500595_000750 3300053119 Bacteria 19098
647 Ga0500595_050019 3300053119 Bacteria 1299
648 Ga0500595_076672 3300053119 Bacteria 984
649 Ga0500595_124352 3300053119 Bacteria 728
650 Ga0500614_007597 3300053123 Bacteria 2288
651 Ga0500642_0191408 3300053130 Bacteria 954
652 Ga0500559_0034525 3300053136 Bacteria 2181
653 Ga0500559_0360938 3300053136 Bacteria 679
654 Ga0500568_0027565 3300053139 Bacteria 2374
655 Ga0500568_0249295 3300053139 Bacteria 647
656 Ga0500588_0361290 3300053146 Bacteria 552
657 Ga0500603_008356 3300053150 Bacteria 2293
658 Ga0500620_075241 3300053155 Bacteria 1165
659 Ga0500622_0198884 3300053156 Bacteria 913
660 Ga0500627_0072588 3300053158 Bacteria 1526
661 Ga0500630_008710 3300053159 Bacteria 4982
662 Ga0500638_005430 3300053162 Bacteria 5075
663 Ga0500639_002312 3300053163 Bacteria 9561
664 Ga0500636_0017300 3300053177 Bacteria 4256
665 Ga0500636_0116518 3300053177 Bacteria 1503
666 Ga0500637_0020670 3300053178 Bacteria 3569
667 Ga0500576_150756 3300053725 Bacteria 869
668 Ga0500611_044358 3300053727 Bacteria 991
669 Ga0500609_016984 3300053731 Bacteria 988
670 Ga0500596_002233 3300053735 Bacteria 3841
671 Ga0500601_010962 3300053737 Bacteria 1017

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005547 Ga0070693_100652772 Ga0070693_1006527722 56
2 3300025913 Ga0207695_10475279 Ga0207695_104752792 56
3 3300035112 Ga0373932_0428040 Ga0373932_0428040_226_426 56
4 3300005293 Ga0065715_10120325 Ga0065715_101203254 57
5 3300005329 Ga0070683_100783139 Ga0070683_1007831393 57
6 3300005334 Ga0068869_100966370 Ga0068869_1009663702 57
7 3300005337 Ga0070682_100865885 Ga0070682_1008658852 57
8 3300005343 Ga0070687_101187946 Ga0070687_1011879462 57
9 3300005367 Ga0070667_100317816 Ga0070667_1003178164 57
10 3300005459 Ga0068867_100523272 Ga0068867_1005232722 57
11 3300005535 Ga0070684_101301882 Ga0070684_1013018822 57
12 3300005539 Ga0068853_102021580 Ga0068853_1020215802 57
13 3300005544 Ga0070686_100094482 Ga0070686_1000944823 57
14 3300005547 Ga0070693_100349127 Ga0070693_1003491272 57
15 3300005617 Ga0068859_100298992 Ga0068859_1002989922 57
16 3300005718 Ga0068866_10389442 Ga0068866_103894422 57
17 3300005841 Ga0068863_100902150 Ga0068863_1009021502 57
18 3300005842 Ga0068858_100226200 Ga0068858_1002262004 57
19 3300005843 Ga0068860_100993774 Ga0068860_1009937742 57
20 3300006237 Ga0097621_102335592 Ga0097621_1023355922 57
21 3300006881 Ga0068865_100338136 Ga0068865_1003381362 57
22 3300006931 Ga0097620_100298996 Ga0097620_1002989964 57
23 3300009101 Ga0105247_10448835 Ga0105247_104488351 57
24 3300009174 Ga0105241_10055041 Ga0105241_100550416 57
25 3300009177 Ga0105248_10305891 Ga0105248_103058914 57
26 3300009545 Ga0105237_10758847 Ga0105237_107588473 57
27 3300010375 Ga0105239_10015132 Ga0105239_100151327 57
28 3300011119 Ga0105246_10331686 Ga0105246_103316863 57
29 3300031730 Ga0307516_10032161 Ga0307516_100321612 57
30 3300035170 Ga0373943_0514682 Ga0373943_0514682_212_385 57
31 3300035695 Ga0373927_0137605 Ga0373927_0137605_306_479 57
32 3300035724 Ga0373933_0813823 Ga0373933_0813823_379_552 57
33 3300035725 Ga0373947_0007264 Ga0373947_0007264_5115_5288 57
34 3300037068 Ga0373925_0321310 Ga0373925_0321310_257_430 57
35 3300041486 Ga0451807_0729203 Ga0451807_0729203_107_298 57
36 3300046472 Ga0495580_0380064 Ga0495580_0380064_473_646 57
37 3300046473 Ga0495582_0821511 Ga0495582_0821511_16_189 57
38 3300046475 Ga0495639_0219630 Ga0495639_0219630_412_585 57
39 3300046517 Ga0495630_0111792 Ga0495630_0111792_652_825 57
40 3300046533 Ga0495640_0809797 Ga0495640_0809797_283_456 57
41 3300046663 Ga0495635_0995604 Ga0495635_0995604_136_309 57
42 3300046689 Ga0495613_0434284 Ga0495613_0434284_627_800 57
43 3300047315 Ga0495581_0197796 Ga0495581_0197796_892_1065 57
44 3300047471 Ga0495684_0488731 Ga0495684_0488731_640_813 57
45 3300005329 Ga0070683_102313892 Ga0070683_1023138921 58
46 3300005334 Ga0068869_100636811 Ga0068869_1006368113 58
47 3300005336 Ga0070680_100906893 Ga0070680_1009068931 58
48 3300005338 Ga0068868_100897588 Ga0068868_1008975882 58
49 3300005338 Ga0068868_101109224 Ga0068868_1011092242 58
50 3300005364 Ga0070673_101832984 Ga0070673_1018329842 58
51 3300005366 Ga0070659_100258064 Ga0070659_1002580644 58
52 3300005434 Ga0070709_10353795 Ga0070709_103537952 58
53 3300005435 Ga0070714_101925400 Ga0070714_1019254001 58
54 3300005436 Ga0070713_100251769 Ga0070713_1002517693 58
55 3300005439 Ga0070711_100025335 Ga0070711_1000253354 58
56 3300005439 Ga0070711_101446452 Ga0070711_1014464522 58
57 3300005439 Ga0070711_101569920 Ga0070711_1015699202 58
58 3300005455 Ga0070663_101074072 Ga0070663_1010740721 58
59 3300005458 Ga0070681_10010223 Ga0070681_1001022310 58
60 3300005530 Ga0070679_101021125 Ga0070679_1010211252 58
61 3300005616 Ga0068852_101989409 Ga0068852_1019894091 58
62 3300005843 Ga0068860_101243427 Ga0068860_1012434272 58
63 3300005937 Ga0081455_10035923 Ga0081455_100359234 58
64 3300006028 Ga0070717_10179047 Ga0070717_101790472 58
65 3300006038 Ga0075365_10138058 Ga0075365_101380582 58
66 3300006038 Ga0075365_10400926 Ga0075365_104009262 58
67 3300006173 Ga0070716_100498210 Ga0070716_1004982102 58
68 3300006173 Ga0070716_101024157 Ga0070716_1010241572 58
69 3300006175 Ga0070712_100405534 Ga0070712_1004055342 58
70 3300006186 Ga0075369_10654701 Ga0075369_106547012 58
71 3300006237 Ga0097621_100815406 Ga0097621_1008154061 58
72 3300006237 Ga0097621_102323818 Ga0097621_1023238182 58
73 3300009101 Ga0105247_10158870 Ga0105247_101588703 58
74 3300009174 Ga0105241_11454213 Ga0105241_114542133 58
75 3300009176 Ga0105242_10630021 Ga0105242_106300212 58
76 3300009177 Ga0105248_12988661 Ga0105248_129886612 58
77 3300009545 Ga0105237_10255007 Ga0105237_102550074 58
78 3300009553 Ga0105249_10219056 Ga0105249_102190564 58
79 3300010159 Ga0099796_10075009 Ga0099796_100750093 58
80 3300010375 Ga0105239_11447518 Ga0105239_114475183 58
81 3300011119 Ga0105246_10488858 Ga0105246_104888583 58
82 3300013105 Ga0157369_12204306 Ga0157369_122043061 58
83 3300013306 Ga0163162_10484505 Ga0163162_104845053 58
84 3300014745 Ga0157377_10281129 Ga0157377_102811293 58
85 3300014969 Ga0157376_10319065 Ga0157376_103190654 58
86 3300014969 Ga0157376_12611199 Ga0157376_126111992 58
87 3300017792 Ga0163161_10095370 Ga0163161_100953704 58
88 3300025900 Ga0207710_10549819 Ga0207710_105498192 58
89 3300025904 Ga0207647_10344404 Ga0207647_103444042 58
90 3300025906 Ga0207699_10713003 Ga0207699_107130032 58
91 3300025912 Ga0207707_10005343 Ga0207707_100053439 58
92 3300025915 Ga0207693_10233469 Ga0207693_102334692 58
93 3300025916 Ga0207663_10055078 Ga0207663_100550782 58
94 3300025918 Ga0207662_10941031 Ga0207662_109410312 58
95 3300025921 Ga0207652_10857866 Ga0207652_108578662 58
96 3300025932 Ga0207690_11675302 Ga0207690_116753022 58
97 3300025934 Ga0207686_10586344 Ga0207686_105863442 58
98 3300025936 Ga0207670_10180841 Ga0207670_101808414 58
99 3300025939 Ga0207665_10938287 Ga0207665_109382872 58
100 3300025941 Ga0207711_10324839 Ga0207711_103248392 58
101 3300025944 Ga0207661_11155184 Ga0207661_111551844 58
102 3300025944 Ga0207661_11311935 Ga0207661_113119352 58
103 3300025961 Ga0207712_10375695 Ga0207712_103756952 58
104 3300025961 Ga0207712_11090285 Ga0207712_110902851 58
105 3300026035 Ga0207703_12133922 Ga0207703_121339222 58
106 3300026067 Ga0207678_10510941 Ga0207678_105109413 58
107 3300026088 Ga0207641_10405586 Ga0207641_104055863 58
108 3300026121 Ga0207683_11201608 Ga0207683_112016082 58
109 3300027512 Ga0209179_1058124 Ga0209179_10581242 58
110 3300028381 Ga0268264_11223208 Ga0268264_112232082 58
111 3300028381 Ga0268264_11249358 Ga0268264_112493582 58
112 3300030760 Ga0265762_1015148 Ga0265762_10151482 58
113 3300030763 Ga0265763_1011726 Ga0265763_10117262 58
114 3300031090 Ga0265760_10052842 Ga0265760_100528423 58
115 3300031548 Ga0307408_100800787 Ga0307408_1008007872 58
116 3300031901 Ga0307406_10090174 Ga0307406_100901743 58
117 3300032002 Ga0307416_100984081 Ga0307416_1009840812 58
118 3300032005 Ga0307411_12120760 Ga0307411_121207602 58
119 3300034816 Ga0373930_0029012 Ga0373930_0029012_325_516 58
120 3300034817 Ga0373948_0070034 Ga0373948_0070034_425_616 58
121 3300034819 Ga0373958_0202952 Ga0373958_0202952_65_256 58
122 3300035085 Ga0373929_0129057 Ga0373929_0129057_436_627 58
123 3300035092 Ga0373952_0009417 Ga0373952_0009417_142_333 58
124 3300035114 Ga0373939_0225005 Ga0373939_0225005_356_532 58
125 3300035114 Ga0373939_0468383 Ga0373939_0468383_298_489 58
126 3300035115 Ga0373941_0019211 Ga0373941_0019211_1368_1559 58
127 3300035207 Ga0373942_0252111 Ga0373942_0252111_245_436 58
128 3300035241 Ga0373961_0340611 Ga0373961_0340611_316_507 58
129 3300035691 Ga0373931_0046226 Ga0373931_0046226_1950_2141 58
130 3300035692 Ga0373935_0064843 Ga0373935_0064843_1097_1288 58
131 3300035695 Ga0373927_0030244 Ga0373927_0030244_1191_1382 58
132 3300035724 Ga0373933_0000007 Ga0373933_0000007_82116_82292 58
133 3300035725 Ga0373947_0315040 Ga0373947_0315040_330_521 58
134 3300037068 Ga0373925_0853740 Ga0373925_0853740_229_420 58
135 3300037471 Ga0395905_0108267 Ga0395905_0108267_689_865 58
136 3300041413 Ga0439465_0164620 Ga0439465_0164620_291_467 58
137 3300041512 Ga0451853_3880663 Ga0451853_3880663_592_780 58
138 3300046460 Ga0495638_0146764 Ga0495638_0146764_166_342 58
139 3300046475 Ga0495639_0418016 Ga0495639_0418016_120_296 58
140 3300046477 Ga0495664_0141838 Ga0495664_0141838_34_210 58
141 3300046516 Ga0495628_1202165 Ga0495628_1202165_86_262 58
142 3300046533 Ga0495640_0478595 Ga0495640_0478595_447_623 58
143 3300046616 Ga0495668_0369223 Ga0495668_0369223_385_561 58
144 3300047472 Ga0495686_0684323 Ga0495686_0684323_86_262 58
145 3300048903 Ga0496100_0121130 Ga0496100_0121130_229_420 58
146 3300048903 Ga0496100_0777672 Ga0496100_0777672_256_432 58
147 3300048904 Ga0496101_0351167 Ga0496101_0351167_14_190 58
148 3300048904 Ga0496101_0553801 Ga0496101_0553801_380_571 58
149 3300048905 Ga0496102_0041504 Ga0496102_0041504_2008_2199 58
150 3300048905 Ga0496102_0886682 Ga0496102_0886682_589_765 58
151 3300048905 Ga0496102_1048929 Ga0496102_1048929_518_694 58
152 3300048906 Ga0496103_0044738 Ga0496103_0044738_852_1043 58
153 3300048907 Ga0496104_0049725 Ga0496104_0049725_515_706 58
154 3300048907 Ga0496104_0796277 Ga0496104_0796277_341_517 58
155 3300048908 Ga0496105_0279096 Ga0496105_0279096_840_1031 58
156 3300048909 Ga0496106_0037402 Ga0496106_0037402_1066_1257 58
157 3300048909 Ga0496106_0427881 Ga0496106_0427881_326_502 58
158 3300048910 Ga0496107_0018511 Ga0496107_0018511_2334_2525 58
159 3300048911 Ga0496108_0183820 Ga0496108_0183820_1531_1707 58
160 3300048912 Ga0496109_0043350 Ga0496109_0043350_1538_1729 58
161 3300048913 Ga0496110_0042751 Ga0496110_0042751_3259_3450 58
162 3300048913 Ga0496110_1255030 Ga0496110_1255030_50_226 58
163 3300048914 Ga0496111_0260331 Ga0496111_0260331_784_960 58
164 3300048915 Ga0496112_0163417 Ga0496112_0163417_1870_2061 58
165 3300048915 Ga0496112_0205865 Ga0496112_0205865_106_282 58
166 3300048916 Ga0496113_0411753 Ga0496113_0411753_784_960 58
167 3300048916 Ga0496113_0508110 Ga0496113_0508110_189_380 58
168 3300048917 Ga0496114_0042890 Ga0496114_0042890_1042_1233 58
169 3300048917 Ga0496114_0196302 Ga0496114_0196302_669_845 58
170 3300048918 Ga0496115_0097503 Ga0496115_0097503_907_1098 58
171 3300048918 Ga0496115_0511437 Ga0496115_0511437_710_886 58
172 3300048918 Ga0496115_0913531 Ga0496115_0913531_36_212 58
173 3300048918 Ga0496115_1069548 Ga0496115_1069548_252_428 58
174 3300048919 Ga0496116_0294912 Ga0496116_0294912_449_625 58
175 3300048920 Ga0496117_0162709 Ga0496117_0162709_951_1127 58
176 3300048921 Ga0496118_0027432 Ga0496118_0027432_3269_3445 58
177 3300048921 Ga0496118_0551070 Ga0496118_0551070_63_239 58
178 3300048922 Ga0496119_0059502 Ga0496119_0059502_384_560 58
179 3300048922 Ga0496119_0062748 Ga0496119_0062748_979_1155 58
180 3300048924 Ga0496121_0004032 Ga0496121_0004032_18587_18763 58
181 3300048924 Ga0496121_0288958 Ga0496121_0288958_489_665 58
182 3300048927 Ga0496124_0416664 Ga0496124_0416664_52_240 58
183 3300048927 Ga0496124_0893796 Ga0496124_0893796_339_515 58
184 3300048928 Ga0496125_0559300 Ga0496125_0559300_307_483 58
185 3300048929 Ga0496126_0007566 Ga0496126_0007566_5750_5926 58
186 3300048929 Ga0496126_0269056 Ga0496126_0269056_216_392 58
187 3300048929 Ga0496126_0577425 Ga0496126_0577425_570_746 58
188 3300048929 Ga0496126_1298660 Ga0496126_1298660_304_480 58
189 3300049460 Ga0495682_0191647 Ga0495682_0191647_197_373 58
190 3300050492 nmdc:mga0yw44_652479_c1 nmdc:mga0yw44_652479_c1_95_271 58
191 3300050512 nmdc:mga0n895_1083211_c1 nmdc:mga0n895_1083211_c1_26_202 58
192 3300050516 nmdc:mga0sz30_428918_c1 nmdc:mga0sz30_428918_c1_214_390 58
193 3300053077 Ga0495601_0084762 Ga0495601_0084762_751_927 58
194 3300053077 Ga0495601_0616018 Ga0495601_0616018_179_370 58
195 3300053086 Ga0500578_0341153 Ga0500578_0341153_19_195 58
196 3300053092 Ga0500583_0231463 Ga0500583_0231463_729_905 58
197 3300053093 Ga0500651_0012431 Ga0500651_0012431_2174_2350 58
198 3300053093 Ga0500651_0583040 Ga0500651_0583040_113_289 58
199 3300053096 Ga0500641_0385284 Ga0500641_0385284_54_230 58
200 3300053119 Ga0500595_000750 Ga0500595_000750_1768_1944 58
201 3300053119 Ga0500595_050019 Ga0500595_050019_191_367 58
202 3300053119 Ga0500595_076672 Ga0500595_076672_83_259 58
203 3300053130 Ga0500642_0191408 Ga0500642_0191408_20_196 58
204 3300053139 Ga0500568_0249295 Ga0500568_0249295_385_561 58
205 3300053146 Ga0500588_0361290 Ga0500588_0361290_92_268 58
206 3300053156 Ga0500622_0198884 Ga0500622_0198884_588_764 58
207 3300053158 Ga0500627_0072588 Ga0500627_0072588_459_635 58
208 3300053177 Ga0500636_0017300 Ga0500636_0017300_838_1014 58
209 3300053731 Ga0500609_016984 Ga0500609_016984_143_319 58
210 3300005327 Ga0070658_10306872 Ga0070658_103068721 59
211 3300005329 Ga0070683_100050223 Ga0070683_1000502233 59
212 3300005336 Ga0070680_100361631 Ga0070680_1003616312 59
213 3300005339 Ga0070660_100003722 Ga0070660_1000037223 59
214 3300005344 Ga0070661_100315525 Ga0070661_1003155252 59
215 3300005347 Ga0070668_101119995 Ga0070668_1011199952 59
216 3300005366 Ga0070659_100233334 Ga0070659_1002333342 59
217 3300005435 Ga0070714_100636630 Ga0070714_1006366303 59
218 3300005439 Ga0070711_100289792 Ga0070711_1002897922 59
219 3300005458 Ga0070681_10469730 Ga0070681_104697303 59
220 3300005467 Ga0070706_100612872 Ga0070706_1006128722 59
221 3300005518 Ga0070699_101641184 Ga0070699_1016411842 59
222 3300005535 Ga0070684_100212619 Ga0070684_1002126192 59
223 3300005535 Ga0070684_100218336 Ga0070684_1002183362 59
224 3300005536 Ga0070697_100008732 Ga0070697_1000087326 59
225 3300005539 Ga0068853_100011965 Ga0068853_10001196512 59
226 3300005539 Ga0068853_100106594 Ga0068853_1001065946 59
227 3300005547 Ga0070693_100689407 Ga0070693_1006894072 59
228 3300005548 Ga0070665_100830823 Ga0070665_1008308232 59
229 3300005564 Ga0070664_100199805 Ga0070664_1001998053 59
230 3300005577 Ga0068857_100073096 Ga0068857_1000730965 59
231 3300005578 Ga0068854_102057572 Ga0068854_1020575721 59
232 3300005616 Ga0068852_100674898 Ga0068852_1006748981 59
233 3300005616 Ga0068852_102210537 Ga0068852_1022105371 59
234 3300005834 Ga0068851_10434412 Ga0068851_104344122 59
235 3300005834 Ga0068851_11044693 Ga0068851_110446931 59
236 3300005841 Ga0068863_100835384 Ga0068863_1008353841 59
237 3300005842 Ga0068858_100177733 Ga0068858_1001777332 59
238 3300006028 Ga0070717_11596520 Ga0070717_115965201 59
239 3300007265 Ga0099794_10585178 Ga0099794_105851781 59
240 3300007265 Ga0099794_10726870 Ga0099794_107268702 59
241 3300007265 Ga0099794_10730020 Ga0099794_107300202 59
242 3300007788 Ga0099795_10021022 Ga0099795_100210223 59
243 3300007788 Ga0099795_10148003 Ga0099795_101480033 59
244 3300009093 Ga0105240_10197718 Ga0105240_101977183 59
245 3300009093 Ga0105240_10523887 Ga0105240_105238873 59
246 3300009101 Ga0105247_11862777 Ga0105247_118627771 59
247 3300009177 Ga0105248_10025081 Ga0105248_100250818 59
248 3300009545 Ga0105237_10009459 Ga0105237_100094596 59
249 3300009545 Ga0105237_11182669 Ga0105237_111826693 59
250 3300009551 Ga0105238_10009011 Ga0105238_100090112 59
251 3300010159 Ga0099796_10160526 Ga0099796_101605262 59
252 3300010375 Ga0105239_10253658 Ga0105239_102536583 59
253 3300010375 Ga0105239_10464963 Ga0105239_104649632 59
254 3300013104 Ga0157370_10033076 Ga0157370_100330768 59
255 3300013105 Ga0157369_10020222 Ga0157369_100202221 59
256 3300013296 Ga0157374_11793989 Ga0157374_117939892 59
257 3300013307 Ga0157372_10166903 Ga0157372_101669032 59
258 3300014325 Ga0163163_11673690 Ga0163163_116736902 59
259 3300014968 Ga0157379_10209148 Ga0157379_102091484 59
260 3300025321 Ga0207656_10083290 Ga0207656_100832901 59
261 3300025900 Ga0207710_10473186 Ga0207710_104731862 59
262 3300025909 Ga0207705_10295032 Ga0207705_102950323 59
263 3300025910 Ga0207684_10568814 Ga0207684_105688142 59
264 3300025912 Ga0207707_10088161 Ga0207707_100881614 59
265 3300025913 Ga0207695_10096550 Ga0207695_100965502 59
266 3300025914 Ga0207671_10084211 Ga0207671_100842112 59
267 3300025915 Ga0207693_10184408 Ga0207693_101844082 59
268 3300025916 Ga0207663_10349887 Ga0207663_103498873 59
269 3300025917 Ga0207660_10018171 Ga0207660_100181712 59
270 3300025919 Ga0207657_10006315 Ga0207657_100063153 59
271 3300025920 Ga0207649_10125903 Ga0207649_101259032 59
272 3300025921 Ga0207652_10116431 Ga0207652_101164313 59
273 3300025924 Ga0207694_10043027 Ga0207694_100430272 59
274 3300025924 Ga0207694_10415166 Ga0207694_104151662 59
275 3300025928 Ga0207700_10056874 Ga0207700_100568743 59
276 3300025929 Ga0207664_10548180 Ga0207664_105481803 59
277 3300025932 Ga0207690_10080187 Ga0207690_100801872 59
278 3300025941 Ga0207711_10109583 Ga0207711_101095833 59
279 3300025941 Ga0207711_10911551 Ga0207711_109115512 59
280 3300025944 Ga0207661_10032322 Ga0207661_100323226 59
281 3300025944 Ga0207661_10051711 Ga0207661_100517112 59
282 3300025949 Ga0207667_10014461 Ga0207667_100144612 59
283 3300025981 Ga0207640_12017685 Ga0207640_120176852 59
284 3300026041 Ga0207639_10031182 Ga0207639_100311826 59
285 3300026041 Ga0207639_10656871 Ga0207639_106568711 59
286 3300026088 Ga0207641_10265154 Ga0207641_102651543 59
287 3300026116 Ga0207674_10078005 Ga0207674_100780055 59
288 3300026142 Ga0207698_10355981 Ga0207698_103559813 59
289 3300027512 Ga0209179_1019280 Ga0209179_10192802 59
290 3300027512 Ga0209179_1074138 Ga0209179_10741382 59
291 3300027671 Ga0209588_1079305 Ga0209588_10793052 59
292 3300028794 Ga0307515_10393518 Ga0307515_103935181 59
293 3300031239 Ga0265328_10260667 Ga0265328_102606672 59
294 3300031616 Ga0307508_10091451 Ga0307508_100914512 59
295 3300031616 Ga0307508_10124169 Ga0307508_101241693 59
296 3300035113 Ga0373936_0089798 Ga0373936_0089798_146_349 59
297 3300035118 Ga0373954_0010236 Ga0373954_0010236_1663_1887 59
298 3300035171 Ga0373946_0121518 Ga0373946_0121518_510_692 59
299 3300035691 Ga0373931_1031291 Ga0373931_1031291_38_217 59
300 3300035692 Ga0373935_0189332 Ga0373935_0189332_642_824 59
301 3300035695 Ga0373927_0054833 Ga0373927_0054833_735_917 59
302 3300035725 Ga0373947_0026147 Ga0373947_0026147_1161_1343 59
303 3300036401 Ga0373937_1354069 Ga0373937_1354069_134_313 59
304 3300037068 Ga0373925_0054927 Ga0373925_0054927_695_877 59
305 3300037068 Ga0373925_0406969 Ga0373925_0406969_482_661 59
306 3300041486 Ga0451807_2732070 Ga0451807_2732070_497_676 59
307 3300046455 Ga0495603_0044822 Ga0495603_0044822_1586_1768 59
308 3300046455 Ga0495603_0182585 Ga0495603_0182585_349_528 59
309 3300046459 Ga0495629_0598971 Ga0495629_0598971_185_364 59
310 3300046461 Ga0495641_0276798 Ga0495641_0276798_204_386 59
311 3300046492 Ga0495585_0195454 Ga0495585_0195454_725_907 59
312 3300046499 Ga0495594_0179064 Ga0495594_0179064_592_774 59
313 3300046511 Ga0495608_0356938 Ga0495608_0356938_122_301 59
314 3300046529 Ga0495652_0678237 Ga0495652_0678237_466_645 59
315 3300046558 Ga0495633_0163374 Ga0495633_0163374_351_533 59
316 3300046616 Ga0495668_0293011 Ga0495668_0293011_14_196 59
317 3300046674 Ga0495588_0089468 Ga0495588_0089468_913_1095 59
318 3300046675 Ga0495657_0282121 Ga0495657_0282121_84_263 59
319 3300046679 Ga0495623_0257122 Ga0495623_0257122_756_935 59
320 3300046683 Ga0495658_0342121 Ga0495658_0342121_494_676 59
321 3300046690 Ga0495624_0157474 Ga0495624_0157474_461_643 59
322 3300046690 Ga0495624_0480984 Ga0495624_0480984_31_210 59
323 3300047317 Ga0495604_0743782 Ga0495604_0743782_18_197 59
324 3300047319 Ga0495674_1244652 Ga0495674_1244652_244_423 59
325 3300047320 Ga0495672_0043133 Ga0495672_0043133_1053_1232 59
326 3300047322 Ga0495680_0727409 Ga0495680_0727409_88_267 59
327 3300048088 Ga0495602_0128374 Ga0495602_0128374_637_816 59
328 3300048911 Ga0496108_0813113 Ga0496108_0813113_308_487 59
329 3300048918 Ga0496115_0043376 Ga0496115_0043376_3373_3552 59
330 3300048924 Ga0496121_0000214 Ga0496121_0000214_35933_36112 59
331 3300048924 Ga0496121_0296884 Ga0496121_0296884_782_961 59
332 3300048927 Ga0496124_0507151 Ga0496124_0507151_434_613 59
333 3300048928 Ga0496125_0104958 Ga0496125_0104958_1437_1616 59
334 3300048929 Ga0496126_0072520 Ga0496126_0072520_87_266 59
335 3300048929 Ga0496126_0087634 Ga0496126_0087634_733_912 59
336 3300048929 Ga0496126_0291012 Ga0496126_0291012_757_936 59
337 3300048929 Ga0496126_1198702 Ga0496126_1198702_311_493 59
338 3300053083 Ga0495655_0201406 Ga0495655_0201406_179_361 59
339 3300053084 Ga0495595_0091768 Ga0495595_0091768_1068_1247 59
340 3300053085 Ga0495619_0732760 Ga0495619_0732760_257_436 59
341 3300053085 Ga0495619_1211703 Ga0495619_1211703_35_214 59
342 3300053091 Ga0500647_0058237 Ga0500647_0058237_1474_1677 59
343 3300053094 Ga0500566_0002356 Ga0500566_0002356_3639_3842 59
344 3300053095 Ga0500640_045834 Ga0500640_045834_1551_1754 59
345 3300053097 Ga0500648_277890 Ga0500648_277890_119_322 59
346 3300053104 Ga0500556_0202273 Ga0500556_0202273_433_612 59
347 3300053111 Ga0500572_003525 Ga0500572_003525_2472_2675 59
348 3300053115 Ga0500591_110324 Ga0500591_110324_59_262 59
349 3300053123 Ga0500614_007597 Ga0500614_007597_1841_2044 59
350 3300053136 Ga0500559_0034525 Ga0500559_0034525_926_1129 59
351 3300053136 Ga0500559_0360938 Ga0500559_0360938_401_580 59
352 3300053139 Ga0500568_0027565 Ga0500568_0027565_1286_1465 59
353 3300053150 Ga0500603_008356 Ga0500603_008356_162_365 59
354 3300053159 Ga0500630_008710 Ga0500630_008710_1915_2118 59
355 3300053162 Ga0500638_005430 Ga0500638_005430_3174_3377 59
356 3300053163 Ga0500639_002312 Ga0500639_002312_3254_3457 59
357 3300053177 Ga0500636_0116518 Ga0500636_0116518_752_931 59
358 3300053725 Ga0500576_150756 Ga0500576_150756_582_785 59
359 3300053735 Ga0500596_002233 Ga0500596_002233_660_863 59
360 3300053737 Ga0500601_010962 Ga0500601_010962_438_641 59
361 3300001989 JGI24739J22299_10020547 JGI24739J22299_100205473 60
362 3300001990 JGI24737J22298_10009616 JGI24737J22298_100096167 60
363 3300003215 JGI25153J46596_10059817 JGI25153J46596_100598173 60
364 3300005344 Ga0070661_100271222 Ga0070661_1002712223 60
365 3300005347 Ga0070668_101130424 Ga0070668_1011304243 60
366 3300005366 Ga0070659_101784772 Ga0070659_1017847722 60
367 3300005436 Ga0070713_100002594 Ga0070713_1000025945 60
368 3300005455 Ga0070663_100017501 Ga0070663_1000175013 60
369 3300005467 Ga0070706_100330359 Ga0070706_1003303593 60
370 3300005468 Ga0070707_100106096 Ga0070707_1001060965 60
371 3300005471 Ga0070698_100842729 Ga0070698_1008427291 60
372 3300005536 Ga0070697_101111451 Ga0070697_1011114511 60
373 3300005539 Ga0068853_100058719 Ga0068853_1000587196 60
374 3300005563 Ga0068855_100024639 Ga0068855_1000246394 60
375 3300005564 Ga0070664_100392479 Ga0070664_1003924792 60
376 3300005577 Ga0068857_100185123 Ga0068857_1001851232 60
377 3300005578 Ga0068854_100206793 Ga0068854_1002067933 60
378 3300006028 Ga0070717_10067381 Ga0070717_100673815 60
379 3300006051 Ga0075364_10183994 Ga0075364_101839942 60
380 3300006178 Ga0075367_10206761 Ga0075367_102067613 60
381 3300006178 Ga0075367_10268677 Ga0075367_102686773 60
382 3300009093 Ga0105240_10035863 Ga0105240_100358631 60
383 3300009093 Ga0105240_10402848 Ga0105240_104028483 60
384 3300009148 Ga0105243_11257933 Ga0105243_112579333 60
385 3300009174 Ga0105241_10200352 Ga0105241_102003523 60
386 3300009545 Ga0105237_10009470 Ga0105237_100094709 60
387 3300009551 Ga0105238_10156359 Ga0105238_101563595 60
388 3300009551 Ga0105238_10390752 Ga0105238_103907522 60
389 3300009553 Ga0105249_10251662 Ga0105249_102516622 60
390 3300010375 Ga0105239_10149385 Ga0105239_101493854 60
391 3300010375 Ga0105239_12527561 Ga0105239_125275612 60
392 3300011119 Ga0105246_10805062 Ga0105246_108050622 60
393 3300014325 Ga0163163_10963761 Ga0163163_109637612 60
394 3300014968 Ga0157379_10939541 Ga0157379_109395412 60
395 3300025297 Ga0209758_1004067 Ga0209758_10040673 60
396 3300025904 Ga0207647_10006000 Ga0207647_1000600012 60
397 3300025906 Ga0207699_10172022 Ga0207699_101720222 60
398 3300025913 Ga0207695_10223701 Ga0207695_102237013 60
399 3300025913 Ga0207695_10883556 Ga0207695_108835562 60
400 3300025920 Ga0207649_11688191 Ga0207649_116881912 60
401 3300025924 Ga0207694_10105853 Ga0207694_101058534 60
402 3300025928 Ga0207700_10003371 Ga0207700_100033716 60
403 3300025929 Ga0207664_10020128 Ga0207664_100201285 60
404 3300025933 Ga0207706_10101488 Ga0207706_101014883 60
405 3300025949 Ga0207667_10867583 Ga0207667_108675831 60
406 3300025961 Ga0207712_10873808 Ga0207712_108738083 60
407 3300025981 Ga0207640_10420404 Ga0207640_104204042 60
408 3300026041 Ga0207639_11961514 Ga0207639_119615142 60
409 3300026067 Ga0207678_10135485 Ga0207678_101354854 60
410 3300026078 Ga0207702_10693403 Ga0207702_106934032 60
411 3300026116 Ga0207674_10006945 Ga0207674_1000694512 60
412 3300026118 Ga0207675_101843607 Ga0207675_1018436072 60
413 3300026142 Ga0207698_10139373 Ga0207698_101393732 60
414 3300027866 Ga0209813_10323648 Ga0209813_103236482 60
415 3300031711 Ga0265314_10005362 Ga0265314_100053627 60
416 3300048904 Ga0496101_0800897 Ga0496101_0800897_456_638 60
417 3300048906 Ga0496103_0782969 Ga0496103_0782969_251_433 60
418 3300048909 Ga0496106_0469218 Ga0496106_0469218_729_911 60
419 3300048911 Ga0496108_0226278 Ga0496108_0226278_1069_1251 60
420 3300048913 Ga0496110_0189253 Ga0496110_0189253_375_557 60
421 3300048917 Ga0496114_0114398 Ga0496114_0114398_804_986 60
422 3300050491 nmdc:mga00v17_664988_c1 nmdc:mga00v17_664988_c1_384_566 60
423 3300050492 nmdc:mga0yw44_285726_c1 nmdc:mga0yw44_285726_c1_407_589 60
424 3300050492 nmdc:mga0yw44_937617_c1 nmdc:mga0yw44_937617_c1_260_442 60
425 3300050494 nmdc:mga06z11_30105_c1 nmdc:mga06z11_30105_c1_584_769 60
426 3300050494 nmdc:mga06z11_96577_c1 nmdc:mga06z11_96577_c1_540_746 60
427 3300050495 nmdc:mga04h51_356935_c1 nmdc:mga04h51_356935_c1_17_202 60
428 3300005347 Ga0070668_101829452 Ga0070668_1018294521 61
429 3300005434 Ga0070709_10097254 Ga0070709_100972543 61
430 3300005435 Ga0070714_100507205 Ga0070714_1005072052 61
431 3300005436 Ga0070713_100111204 Ga0070713_1001112043 61
432 3300005437 Ga0070710_10043834 Ga0070710_100438343 61
433 3300005543 Ga0070672_100025342 Ga0070672_1000253421 61
434 3300006163 Ga0070715_10094890 Ga0070715_100948901 61
435 3300006173 Ga0070716_100117844 Ga0070716_1001178443 61
436 3300006175 Ga0070712_100009607 Ga0070712_1000096074 61
437 3300025898 Ga0207692_10129017 Ga0207692_101290171 61
438 3300025905 Ga0207685_10027964 Ga0207685_100279643 61
439 3300025906 Ga0207699_10018080 Ga0207699_100180803 61
440 3300025915 Ga0207693_10015799 Ga0207693_100157995 61
441 3300025916 Ga0207663_10300981 Ga0207663_103009813 61
442 3300025929 Ga0207664_10146209 Ga0207664_101462092 61
443 3300025934 Ga0207686_11329049 Ga0207686_113290491 61
444 3300025939 Ga0207665_10033272 Ga0207665_100332721 61
445 3300041453 Ga0451797_0927315 Ga0451797_0927315_424_609 61
446 3300041512 Ga0451853_1829236 Ga0451853_1829236_76_261 61
447 3300046460 Ga0495638_0206863 Ga0495638_0206863_425_610 61
448 3300046514 Ga0495618_0468346 Ga0495618_0468346_437_622 61
449 3300046517 Ga0495630_1082726 Ga0495630_1082726_99_284 61
450 3300046529 Ga0495652_0519930 Ga0495652_0519930_254_439 61
451 3300047317 Ga0495604_0336399 Ga0495604_0336399_357_542 61
452 3300047319 Ga0495674_0693374 Ga0495674_0693374_282_467 61
453 3300048924 Ga0496121_0258443 Ga0496121_0258443_116_301 61
454 3300048929 Ga0496126_0880732 Ga0496126_0880732_457_642 61
455 3300053119 Ga0500595_124352 Ga0500595_124352_61_246 61
456 3300053178 Ga0500637_0020670 Ga0500637_0020670_1772_1975 61
457 3300005356 Ga0070674_101619814 Ga0070674_1016198142 62
458 3300005455 Ga0070663_101588143 Ga0070663_1015881431 62
459 3300005548 Ga0070665_101452953 Ga0070665_1014529532 62
460 3300005548 Ga0070665_101880714 Ga0070665_1018807142 62
461 3300005617 Ga0068859_102089109 Ga0068859_1020891092 62
462 3300005842 Ga0068858_101093175 Ga0068858_1010931752 62
463 3300006931 Ga0097620_102089854 Ga0097620_1020898541 62
464 3300007788 Ga0099795_10027813 Ga0099795_100278133 62
465 3300009101 Ga0105247_10287949 Ga0105247_102879492 62
466 3300009148 Ga0105243_10370078 Ga0105243_103700782 62
467 3300009545 Ga0105237_11723665 Ga0105237_117236652 62
468 3300010159 Ga0099796_10308289 Ga0099796_103082892 62
469 3300013296 Ga0157374_10460966 Ga0157374_104609662 62
470 3300014326 Ga0157380_13161504 Ga0157380_131615041 62
471 3300017792 Ga0163161_11457037 Ga0163161_114570372 62
472 3300025315 Ga0207697_10007283 Ga0207697_100072831 62
473 3300025904 Ga0207647_10156001 Ga0207647_101560015 62
474 3300025913 Ga0207695_10299191 Ga0207695_102991911 62
475 3300025914 Ga0207671_10776972 Ga0207671_107769722 62
476 3300025914 Ga0207671_11437910 Ga0207671_114379101 62
477 3300025935 Ga0207709_11047440 Ga0207709_110474401 62
478 3300025937 Ga0207669_11622139 Ga0207669_116221392 62
479 3300026035 Ga0207703_10371248 Ga0207703_103712481 62
480 3300026041 Ga0207639_10702688 Ga0207639_107026882 62
481 3300027512 Ga0209179_1093384 Ga0209179_10933842 62
482 3300028786 Ga0307517_10000483 Ga0307517_1000048345 62
483 3300028786 Ga0307517_10544396 Ga0307517_105443962 62
484 3300028794 Ga0307515_10035400 Ga0307515_100354009 62
485 3300028794 Ga0307515_10867000 Ga0307515_108670002 62
486 3300031456 Ga0307513_10211720 Ga0307513_102117204 62
487 3300031548 Ga0307408_100433661 Ga0307408_1004336613 62
488 3300031616 Ga0307508_10179322 Ga0307508_101793222 62
489 3300031730 Ga0307516_10620178 Ga0307516_106201783 62
490 3300031731 Ga0307405_10710768 Ga0307405_107107682 62
491 3300031824 Ga0307413_10679583 Ga0307413_106795832 62
492 3300031911 Ga0307412_10635582 Ga0307412_106355821 62
493 3300032002 Ga0307416_100340528 Ga0307416_1003405284 62
494 3300032005 Ga0307411_10409545 Ga0307411_104095453 62
495 3300032005 Ga0307411_10523279 Ga0307411_105232792 62
496 3300046455 Ga0495603_0203838 Ga0495603_0203838_694_882 62
497 3300046518 Ga0495631_0200633 Ga0495631_0200633_368_556 62
498 3300046519 Ga0495632_0146203 Ga0495632_0146203_808_996 62
499 3300046538 Ga0495609_0140149 Ga0495609_0140149_254_442 62
500 3300046616 Ga0495668_0063371 Ga0495668_0063371_803_991 62
501 3300046660 Ga0495625_0281457 Ga0495625_0281457_607_795 62
502 3300046684 Ga0495669_0144623 Ga0495669_0144623_454_642 62
503 3300047320 Ga0495672_0051539 Ga0495672_0051539_1800_1988 62
504 3300047323 Ga0495683_0457694 Ga0495683_0457694_203_391 62
505 3300048906 Ga0496103_0682323 Ga0496103_0682323_46_237 62
506 3300048908 Ga0496105_0624893 Ga0496105_0624893_533_724 62
507 3300048913 Ga0496110_0753317 Ga0496110_0753317_403_594 62
508 3300048915 Ga0496112_0324303 Ga0496112_0324303_1103_1294 62
509 3300048918 Ga0496115_0418620 Ga0496115_0418620_125_319 62
510 3300048929 Ga0496126_0664367 Ga0496126_0664367_456_644 62
511 3300050496 nmdc:mga07m45_680025_c1 nmdc:mga07m45_680025_c1_266_454 62
512 3300053727 Ga0500611_044358 Ga0500611_044358_473_661 62
513 3300001904 JGI24736J21556_1031737 JGI24736J21556_10317371 63
514 3300001989 JGI24739J22299_10000994 JGI24739J22299_100009949 63
515 3300001990 JGI24737J22298_10002808 JGI24737J22298_100028084 63
516 3300002067 JGI24735J21928_10006210 JGI24735J21928_100062104 63
517 3300005333 Ga0070677_10507936 Ga0070677_105079361 63
518 3300005338 Ga0068868_101963200 Ga0068868_1019632002 63
519 3300005339 Ga0070660_100256463 Ga0070660_1002564633 63
520 3300005339 Ga0070660_101547230 Ga0070660_1015472302 63
521 3300005354 Ga0070675_100602962 Ga0070675_1006029622 63
522 3300005434 Ga0070709_10003383 Ga0070709_100033838 63
523 3300005437 Ga0070710_10005449 Ga0070710_100054493 63
524 3300005439 Ga0070711_100023046 Ga0070711_1000230463 63
525 3300005455 Ga0070663_101365250 Ga0070663_1013652501 63
526 3300005456 Ga0070678_100079467 Ga0070678_1000794673 63
527 3300005457 Ga0070662_100075193 Ga0070662_1000751932 63
528 3300005458 Ga0070681_10057793 Ga0070681_100577933 63
529 3300005530 Ga0070679_100004045 Ga0070679_1000040453 63
530 3300005535 Ga0070684_100684088 Ga0070684_1006840881 63
531 3300005536 Ga0070697_100424487 Ga0070697_1004244873 63
532 3300005539 Ga0068853_100044352 Ga0068853_1000443524 63
533 3300005539 Ga0068853_100078277 Ga0068853_1000782773 63
534 3300005543 Ga0070672_100448674 Ga0070672_1004486741 63
535 3300005563 Ga0068855_100020255 Ga0068855_1000202558 63
536 3300005563 Ga0068855_100020651 Ga0068855_1000206513 63
537 3300005577 Ga0068857_100010911 Ga0068857_1000109117 63
538 3300005578 Ga0068854_100057575 Ga0068854_1000575753 63
539 3300005614 Ga0068856_100013826 Ga0068856_1000138267 63
540 3300005615 Ga0070702_100370414 Ga0070702_1003704143 63
541 3300005616 Ga0068852_100275230 Ga0068852_1002752303 63
542 3300005834 Ga0068851_10242155 Ga0068851_102421553 63
543 3300006028 Ga0070717_10392678 Ga0070717_103926783 63
544 3300006038 Ga0075365_11322186 Ga0075365_113221862 63
545 3300006163 Ga0070715_10003754 Ga0070715_100037544 63
546 3300006173 Ga0070716_100055242 Ga0070716_1000552424 63
547 3300006175 Ga0070712_100039813 Ga0070712_1000398133 63
548 3300006237 Ga0097621_100225663 Ga0097621_1002256632 63
549 3300007265 Ga0099794_10671529 Ga0099794_106715292 63
550 3300007788 Ga0099795_10654860 Ga0099795_106548602 63
551 3300009093 Ga0105240_10031140 Ga0105240_100311406 63
552 3300009093 Ga0105240_10398156 Ga0105240_103981563 63
553 3300009174 Ga0105241_11601032 Ga0105241_116010322 63
554 3300009545 Ga0105237_10123402 Ga0105237_101234024 63
555 3300009545 Ga0105237_10275301 Ga0105237_102753013 63
556 3300009551 Ga0105238_10017548 Ga0105238_100175487 63
557 3300010375 Ga0105239_10027064 Ga0105239_100270647 63
558 3300011119 Ga0105246_12329422 Ga0105246_123294222 63
559 3300013308 Ga0157375_12882046 Ga0157375_128820462 63
560 3300014325 Ga0163163_11128721 Ga0163163_111287211 63
561 3300014325 Ga0163163_12214358 Ga0163163_122143581 63
562 3300014497 Ga0182008_10110458 Ga0182008_101104584 63
563 3300025321 Ga0207656_10216650 Ga0207656_102166501 63
564 3300025898 Ga0207692_10032424 Ga0207692_100324243 63
565 3300025901 Ga0207688_10149914 Ga0207688_101499141 63
566 3300025904 Ga0207647_10022741 Ga0207647_100227414 63
567 3300025906 Ga0207699_10030363 Ga0207699_100303633 63
568 3300025911 Ga0207654_10876709 Ga0207654_108767092 63
569 3300025912 Ga0207707_10051455 Ga0207707_100514553 63
570 3300025913 Ga0207695_10047109 Ga0207695_100471093 63
571 3300025913 Ga0207695_10252428 Ga0207695_102524283 63
572 3300025914 Ga0207671_10126647 Ga0207671_101266472 63
573 3300025914 Ga0207671_10723876 Ga0207671_107238763 63
574 3300025916 Ga0207663_10212756 Ga0207663_102127563 63
575 3300025917 Ga0207660_10053074 Ga0207660_100530744 63
576 3300025919 Ga0207657_11238234 Ga0207657_112382342 63
577 3300025921 Ga0207652_10145273 Ga0207652_101452733 63
578 3300025924 Ga0207694_10118535 Ga0207694_101185351 63
579 3300025926 Ga0207659_10724391 Ga0207659_107243913 63
580 3300025928 Ga0207700_10090527 Ga0207700_100905273 63
581 3300025933 Ga0207706_10229253 Ga0207706_102292532 63
582 3300025937 Ga0207669_10419467 Ga0207669_104194673 63
583 3300025937 Ga0207669_11132619 Ga0207669_111326192 63
584 3300025949 Ga0207667_10023959 Ga0207667_100239598 63
585 3300025949 Ga0207667_10044250 Ga0207667_100442503 63
586 3300025949 Ga0207667_10878231 Ga0207667_108782311 63
587 3300025981 Ga0207640_10015094 Ga0207640_100150948 63
588 3300025986 Ga0207658_10807077 Ga0207658_108070772 63
589 3300026041 Ga0207639_10088708 Ga0207639_100887083 63
590 3300026041 Ga0207639_10134662 Ga0207639_101346624 63
591 3300026067 Ga0207678_10535077 Ga0207678_105350772 63
592 3300026078 Ga0207702_10026782 Ga0207702_100267824 63
593 3300026116 Ga0207674_10017516 Ga0207674_100175167 63
594 3300026121 Ga0207683_10351773 Ga0207683_103517732 63
595 3300026142 Ga0207698_10885328 Ga0207698_108853283 63
596 3300028379 Ga0268266_11795174 Ga0268266_117951742 63
597 3300028573 Ga0265334_10066879 Ga0265334_100668793 63
598 3300031235 Ga0265330_10003310 Ga0265330_100033104 63
599 3300031235 Ga0265330_10020070 Ga0265330_100200706 63
600 3300031235 Ga0265330_10056010 Ga0265330_100560103 63
601 3300031235 Ga0265330_10173653 Ga0265330_101736532 63
602 3300031238 Ga0265332_10329663 Ga0265332_103296631 63
603 3300031241 Ga0265325_10066080 Ga0265325_100660804 63
604 3300031247 Ga0265340_10000504 Ga0265340_100005046 63
605 3300031247 Ga0265340_10044772 Ga0265340_100447722 63
606 3300031250 Ga0265331_10289362 Ga0265331_102893622 63
607 3300031344 Ga0265316_10134732 Ga0265316_101347324 63
608 3300031344 Ga0265316_10324436 Ga0265316_103244363 63
609 3300031595 Ga0265313_10053565 Ga0265313_100535652 63
610 3300031712 Ga0265342_10087734 Ga0265342_100877344 63
611 3300031712 Ga0265342_10160817 Ga0265342_101608174 63
612 3300031730 Ga0307516_10195303 Ga0307516_101953032 63
613 3300031730 Ga0307516_10990182 Ga0307516_109901822 63
614 3300032126 Ga0307415_102017136 Ga0307415_1020171362 63
615 3300035086 Ga0373934_0018773 Ga0373934_0018773_1876_2070 63
616 3300035111 Ga0373923_0026612 Ga0373923_0026612_1117_1311 63
617 3300035117 Ga0373953_0036598 Ga0373953_0036598_1357_1551 63
618 3300035118 Ga0373954_0000167 Ga0373954_0000167_21199_21393 63
619 3300035119 Ga0373956_0008200 Ga0373956_0008200_3071_3265 63
620 3300035120 Ga0373957_0010346 Ga0373957_0010346_2527_2721 63
621 3300035172 Ga0373955_0036864 Ga0373955_0036864_2228_2422 63
622 3300035724 Ga0373933_0167420 Ga0373933_0167420_421_615 63
623 3300036401 Ga0373937_0109431 Ga0373937_0109431_554_748 63
624 3300041509 Ga0451843_1558469 Ga0451843_1558469_19_210 63
625 3300046454 Ga0495592_0098584 Ga0495592_0098584_687_881 63
626 3300046454 Ga0495592_0347980 Ga0495592_0347980_405_596 63
627 3300046459 Ga0495629_0007517 Ga0495629_0007517_4640_4834 63
628 3300046462 Ga0495651_0070399 Ga0495651_0070399_225_419 63
629 3300046462 Ga0495651_0237577 Ga0495651_0237577_78_272 63
630 3300046462 Ga0495651_0396542 Ga0495651_0396542_49_240 63
631 3300046463 Ga0495653_0046964 Ga0495653_0046964_1562_1756 63
632 3300046511 Ga0495608_0020550 Ga0495608_0020550_1374_1568 63
633 3300046514 Ga0495618_0099410 Ga0495618_0099410_1513_1707 63
634 3300046516 Ga0495628_0075427 Ga0495628_0075427_759_953 63
635 3300046516 Ga0495628_0948014 Ga0495628_0948014_97_288 63
636 3300046529 Ga0495652_1108562 Ga0495652_1108562_168_362 63
637 3300046533 Ga0495640_0806888 Ga0495640_0806888_95_289 63
638 3300046536 Ga0495587_0091601 Ga0495587_0091601_1178_1372 63
639 3300046536 Ga0495587_0746320 Ga0495587_0746320_70_264 63
640 3300046543 Ga0495645_0010229 Ga0495645_0010229_5157_5351 63
641 3300046559 Ga0495667_0526317 Ga0495667_0526317_125_319 63
642 3300046616 Ga0495668_0208938 Ga0495668_0208938_338_529 63
643 3300046642 Ga0495634_0014308 Ga0495634_0014308_5382_5576 63
644 3300046660 Ga0495625_0455891 Ga0495625_0455891_348_539 63
645 3300046663 Ga0495635_0003274 Ga0495635_0003274_9245_9439 63
646 3300046675 Ga0495657_0080130 Ga0495657_0080130_179_373 63
647 3300046678 Ga0495599_0151751 Ga0495599_0151751_272_466 63
648 3300046679 Ga0495623_0030686 Ga0495623_0030686_421_615 63
649 3300046680 Ga0495646_0056840 Ga0495646_0056840_1720_1914 63
650 3300046689 Ga0495613_0485165 Ga0495613_0485165_100_294 63
651 3300046809 Ga0495600_0277534 Ga0495600_0277534_235_426 63
652 3300046809 Ga0495600_0408815 Ga0495600_0408815_271_465 63
653 3300047317 Ga0495604_0443849 Ga0495604_0443849_554_748 63
654 3300047319 Ga0495674_0059246 Ga0495674_0059246_1827_2021 63
655 3300047322 Ga0495680_0628819 Ga0495680_0628819_384_578 63
656 3300047444 Ga0495675_0336293 Ga0495675_0336293_421_615 63
657 3300047444 Ga0495675_0812056 Ga0495675_0812056_115_309 63
658 3300047471 Ga0495684_0004169 Ga0495684_0004169_10520_10714 63
659 3300047673 Ga0495593_0000677 Ga0495593_0000677_4324_4518 63
660 3300048088 Ga0495602_0165923 Ga0495602_0165923_515_709 63
661 3300048913 Ga0496110_0326242 Ga0496110_0326242_430_624 63
662 3300048915 Ga0496112_0166716 Ga0496112_0166716_288_482 63
663 3300048918 Ga0496115_0300779 Ga0496115_0300779_64_258 63
664 3300048922 Ga0496119_0167090 Ga0496119_0167090_564_755 63
665 3300048924 Ga0496121_0823307 Ga0496121_0823307_152_343 63
666 3300053077 Ga0495601_0108481 Ga0495601_0108481_599_793 63
667 3300053078 Ga0495612_0390829 Ga0495612_0390829_63_257 63
668 3300053084 Ga0495595_0002075 Ga0495595_0002075_5168_5362 63
669 3300053084 Ga0495595_0211033 Ga0495595_0211033_41_232 63
670 3300053085 Ga0495619_0224410 Ga0495619_0224410_687_881 63
671 3300053155 Ga0500620_075241 Ga0500620_075241_686_877 63

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gqo-assembly1.cif.gz_A solution nmr structure of vaccinia virus protein a28: an entry-fusion complex component 0.5661 2 49
7aoi-assembly1.cif.gz_AY trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate 0.5496 1 40
6tgv-assembly1.cif.gz_A-3 crystal structure of mycobacterium smegmatis coabc in complex with ctp and fmn 0.5465 24 50
5xfa-assembly2.cif.gz_H crystal structure of nad+-reducing [nife]-hydrogenase in the h2-reduced state 0.5395 1 38
5int-assembly1.cif.gz_A crystal structure of the c-terminal domain of coenzyme a biosynthesis bifunctional protein coabc 0.5346 21 50
ID Description Score Start End Superfamily
af_A0A2R8QCJ3_2_77_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.6495 22 39 2.60.40.60
af_Q4W5T0_135_269_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.6241 2 38 3.30.980.10
1nrwA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6152 12 50 3.40.50.1000
3fkfD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.5461 9 51 3.40.30.10
af_G5ECV3_236_352_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.5406 9 50 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A537L3Y8-F1-model_v4 Uncharacterized protein 1.002 1 50
AF-A0A2V5XVS4-F1-model_v4 Uncharacterized protein 0.9567 1 58
AF-A0A7Z0TRP6-F1-model_v4 DUF2188 domain-containing protein 0.9465 1 58
AF-A0A6N6ZMF4-F1-model_v4 deleted 0.9431 2 50
AF-A0A537PXX7-F1-model_v4 Uncharacterized protein 0.9424 1 61

Feature Viewer

pLDDT pTM Quality
84.54 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map