F474167
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 671 | 328 | 671 | 60 |
Family's Representative Sequence
| Representative Sequence | 3300031235|Ga0265330_10173653|Ga0265330_101736532 |
| Length | 70 |
| Sequence | MQATQSMQNLSPRHVKTEEALWLGVVSGWYSTKVSGTFVSGPHDSEADCLSRIAEINPPPAKRIRVAPAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 71 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 152 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 153 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 160 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 167 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 178 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 179 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 181 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 183 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 187 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 192 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 206 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 209 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 210 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 273 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 274 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 277 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 278 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 279 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 280 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 287 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 288 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 289 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 290 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 291 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 293 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 299 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 300 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 301 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 302 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 303 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 304 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 305 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 306 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 307 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 308 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 309 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 310 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 311 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 312 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 313 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 314 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 315 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 316 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 317 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 318 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 320 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 321 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 322 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 324 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 325 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 326 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 327 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 328 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.55 |
| Metatranscriptomes | 0.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.49 |
| Nodule | 0 |
| Rhizoplane | 7.15 |
| Rhizosphere | 77.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1031737 | 3300001904 | Bacteria | 816 |
| 2 | JGI24739J22299_10000994 | 3300001989 | Bacteria | 10559 |
| 3 | JGI24739J22299_10020547 | 3300001989 | Bacteria | 2359 |
| 4 | JGI24737J22298_10002808 | 3300001990 | Bacteria | 6167 |
| 5 | JGI24737J22298_10009616 | 3300001990 | Bacteria | 3207 |
| 6 | JGI24735J21928_10006210 | 3300002067 | Bacteria | 3946 |
| 7 | JGI25153J46596_10059817 | 3300003215 | Bacteria | 1041 |
| 8 | Ga0065715_10120325 | 3300005293 | Bacteria | 2261 |
| 9 | Ga0070658_10306872 | 3300005327 | Bacteria | 1354 |
| 10 | Ga0070683_100050223 | 3300005329 | Bacteria | 3860 |
| 11 | Ga0070683_100783139 | 3300005329 | Bacteria | 914 |
| 12 | Ga0070683_102313892 | 3300005329 | Unclassified | 515 |
| 13 | Ga0070677_10507936 | 3300005333 | Bacteria | 654 |
| 14 | Ga0068869_100636811 | 3300005334 | Bacteria | 904 |
| 15 | Ga0068869_100966370 | 3300005334 | Bacteria | 740 |
| 16 | Ga0070680_100361631 | 3300005336 | Bacteria | 1234 |
| 17 | Ga0070680_100906893 | 3300005336 | Bacteria | 760 |
| 18 | Ga0070682_100865885 | 3300005337 | Bacteria | 740 |
| 19 | Ga0068868_100897588 | 3300005338 | Bacteria | 805 |
| 20 | Ga0068868_101109224 | 3300005338 | Bacteria | 728 |
| 21 | Ga0068868_101963200 | 3300005338 | Bacteria | 555 |
| 22 | Ga0070660_100003722 | 3300005339 | Bacteria | 10534 |
| 23 | Ga0070660_100256463 | 3300005339 | Bacteria | 1427 |
| 24 | Ga0070660_101547230 | 3300005339 | Bacteria | 564 |
| 25 | Ga0070687_101187946 | 3300005343 | Bacteria | 562 |
| 26 | Ga0070661_100271222 | 3300005344 | Bacteria | 1314 |
| 27 | Ga0070661_100315525 | 3300005344 | Bacteria | 1220 |
| 28 | Ga0070668_101119995 | 3300005347 | Bacteria | 711 |
| 29 | Ga0070668_101130424 | 3300005347 | Bacteria | 708 |
| 30 | Ga0070668_101829452 | 3300005347 | Bacteria | 559 |
| 31 | Ga0070675_100602962 | 3300005354 | Bacteria | 996 |
| 32 | Ga0070674_101619814 | 3300005356 | Bacteria | 584 |
| 33 | Ga0070673_101832984 | 3300005364 | Bacteria | 575 |
| 34 | Ga0070659_100233334 | 3300005366 | Bacteria | 1521 |
| 35 | Ga0070659_100258064 | 3300005366 | Bacteria | 1446 |
| 36 | Ga0070659_101784772 | 3300005366 | Bacteria | 551 |
| 37 | Ga0070667_100317816 | 3300005367 | Bacteria | 1405 |
| 38 | Ga0070709_10003383 | 3300005434 | Bacteria | 8567 |
| 39 | Ga0070709_10097254 | 3300005434 | Bacteria | 1954 |
| 40 | Ga0070709_10353795 | 3300005434 | Bacteria | 1086 |
| 41 | Ga0070714_100507205 | 3300005435 | Bacteria | 1151 |
| 42 | Ga0070714_100636630 | 3300005435 | Bacteria | 1026 |
| 43 | Ga0070714_101925400 | 3300005435 | Bacteria | 577 |
| 44 | Ga0070713_100002594 | 3300005436 | Bacteria | 11804 |
| 45 | Ga0070713_100111204 | 3300005436 | Bacteria | 2389 |
| 46 | Ga0070713_100251769 | 3300005436 | Bacteria | 1611 |
| 47 | Ga0070710_10005449 | 3300005437 | Bacteria | 6046 |
| 48 | Ga0070710_10043834 | 3300005437 | Bacteria | 2479 |
| 49 | Ga0070711_100023046 | 3300005439 | Bacteria | 4044 |
| 50 | Ga0070711_100025335 | 3300005439 | Bacteria | 3881 |
| 51 | Ga0070711_100289792 | 3300005439 | Bacteria | 1298 |
| 52 | Ga0070711_101446452 | 3300005439 | Bacteria | 599 |
| 53 | Ga0070711_101569920 | 3300005439 | Unclassified | 575 |
| 54 | Ga0070663_100017501 | 3300005455 | Bacteria | 4679 |
| 55 | Ga0070663_101074072 | 3300005455 | Bacteria | 703 |
| 56 | Ga0070663_101365250 | 3300005455 | Unclassified | 627 |
| 57 | Ga0070663_101588143 | 3300005455 | Bacteria | 583 |
| 58 | Ga0070678_100079467 | 3300005456 | Bacteria | 2481 |
| 59 | Ga0070662_100075193 | 3300005457 | Bacteria | 2501 |
| 60 | Ga0070681_10010223 | 3300005458 | Bacteria | 9257 |
| 61 | Ga0070681_10057793 | 3300005458 | Bacteria | 3859 |
| 62 | Ga0070681_10469730 | 3300005458 | Bacteria | 1170 |
| 63 | Ga0068867_100523272 | 3300005459 | Bacteria | 1023 |
| 64 | Ga0070706_100330359 | 3300005467 | Bacteria | 1422 |
| 65 | Ga0070706_100612872 | 3300005467 | Bacteria | 1011 |
| 66 | Ga0070707_100106096 | 3300005468 | Bacteria | 2725 |
| 67 | Ga0070698_100842729 | 3300005471 | Bacteria | 861 |
| 68 | Ga0070699_101641184 | 3300005518 | Bacteria | 589 |
| 69 | Ga0070679_100004045 | 3300005530 | Bacteria | 13508 |
| 70 | Ga0070679_101021125 | 3300005530 | Bacteria | 771 |
| 71 | Ga0070684_100212619 | 3300005535 | Bacteria | 1763 |
| 72 | Ga0070684_100218336 | 3300005535 | Bacteria | 1739 |
| 73 | Ga0070684_100684088 | 3300005535 | Bacteria | 956 |
| 74 | Ga0070684_101301882 | 3300005535 | Bacteria | 684 |
| 75 | Ga0070697_100008732 | 3300005536 | Bacteria | 7911 |
| 76 | Ga0070697_100424487 | 3300005536 | Bacteria | 1156 |
| 77 | Ga0070697_101111451 | 3300005536 | Bacteria | 703 |
| 78 | Ga0068853_100011965 | 3300005539 | Bacteria | 7057 |
| 79 | Ga0068853_100044352 | 3300005539 | Bacteria | 3807 |
| 80 | Ga0068853_100058719 | 3300005539 | Bacteria | 3321 |
| 81 | Ga0068853_100078277 | 3300005539 | Bacteria | 2889 |
| 82 | Ga0068853_100106594 | 3300005539 | Bacteria | 2484 |
| 83 | Ga0068853_102021580 | 3300005539 | Bacteria | 559 |
| 84 | Ga0070672_100025342 | 3300005543 | Bacteria | 4397 |
| 85 | Ga0070672_100448674 | 3300005543 | Bacteria | 1111 |
| 86 | Ga0070686_100094482 | 3300005544 | Bacteria | 2007 |
| 87 | Ga0070693_100349127 | 3300005547 | Bacteria | 1012 |
| 88 | Ga0070693_100652772 | 3300005547 | Bacteria | 765 |
| 89 | Ga0070693_100689407 | 3300005547 | Bacteria | 747 |
| 90 | Ga0070665_100830823 | 3300005548 | Bacteria | 937 |
| 91 | Ga0070665_101452953 | 3300005548 | Bacteria | 694 |
| 92 | Ga0070665_101880714 | 3300005548 | Bacteria | 604 |
| 93 | Ga0068855_100020255 | 3300005563 | Bacteria | 7984 |
| 94 | Ga0068855_100020651 | 3300005563 | Bacteria | 7898 |
| 95 | Ga0068855_100024639 | 3300005563 | Bacteria | 7197 |
| 96 | Ga0070664_100199805 | 3300005564 | Bacteria | 1784 |
| 97 | Ga0070664_100392479 | 3300005564 | Bacteria | 1268 |
| 98 | Ga0068857_100010911 | 3300005577 | Bacteria | 7909 |
| 99 | Ga0068857_100073096 | 3300005577 | Bacteria | 3055 |
| 100 | Ga0068857_100185123 | 3300005577 | Bacteria | 1896 |
| 101 | Ga0068854_100057575 | 3300005578 | Bacteria | 2804 |
| 102 | Ga0068854_100206793 | 3300005578 | Bacteria | 1546 |
| 103 | Ga0068854_102057572 | 3300005578 | Bacteria | 527 |
| 104 | Ga0068856_100013826 | 3300005614 | Bacteria | 7803 |
| 105 | Ga0070702_100370414 | 3300005615 | Bacteria | 1015 |
| 106 | Ga0068852_100275230 | 3300005616 | Bacteria | 1621 |
| 107 | Ga0068852_100674898 | 3300005616 | Bacteria | 1042 |
| 108 | Ga0068852_101989409 | 3300005616 | Unclassified | 603 |
| 109 | Ga0068852_102210537 | 3300005616 | Bacteria | 572 |
| 110 | Ga0068859_100298992 | 3300005617 | Bacteria | 1703 |
| 111 | Ga0068859_102089109 | 3300005617 | Unclassified | 625 |
| 112 | Ga0068866_10389442 | 3300005718 | Bacteria | 896 |
| 113 | Ga0068851_10242155 | 3300005834 | Bacteria | 1020 |
| 114 | Ga0068851_10434412 | 3300005834 | Bacteria | 777 |
| 115 | Ga0068851_11044693 | 3300005834 | Bacteria | 517 |
| 116 | Ga0068863_100835384 | 3300005841 | Bacteria | 919 |
| 117 | Ga0068863_100902150 | 3300005841 | Bacteria | 884 |
| 118 | Ga0068858_100177733 | 3300005842 | Bacteria | 2009 |
| 119 | Ga0068858_100226200 | 3300005842 | Bacteria | 1773 |
| 120 | Ga0068858_101093175 | 3300005842 | Unclassified | 783 |
| 121 | Ga0068860_100993774 | 3300005843 | Bacteria | 857 |
| 122 | Ga0068860_101243427 | 3300005843 | Bacteria | 765 |
| 123 | Ga0081455_10035923 | 3300005937 | Bacteria | 4419 |
| 124 | Ga0070717_10067381 | 3300006028 | Bacteria | 2978 |
| 125 | Ga0070717_10179047 | 3300006028 | Bacteria | 1847 |
| 126 | Ga0070717_10392678 | 3300006028 | Bacteria | 1245 |
| 127 | Ga0070717_11596520 | 3300006028 | Bacteria | 591 |
| 128 | Ga0075365_10138058 | 3300006038 | Bacteria | 1691 |
| 129 | Ga0075365_10400926 | 3300006038 | Bacteria | 968 |
| 130 | Ga0075365_11322186 | 3300006038 | Bacteria | 506 |
| 131 | Ga0075364_10183994 | 3300006051 | Bacteria | 1414 |
| 132 | Ga0070715_10003754 | 3300006163 | Bacteria | 4892 |
| 133 | Ga0070715_10094890 | 3300006163 | Bacteria | 1380 |
| 134 | Ga0070716_100055242 | 3300006173 | Bacteria | 2271 |
| 135 | Ga0070716_100117844 | 3300006173 | Bacteria | 1657 |
| 136 | Ga0070716_100498210 | 3300006173 | Bacteria | 898 |
| 137 | Ga0070716_101024157 | 3300006173 | Bacteria | 654 |
| 138 | Ga0070712_100009607 | 3300006175 | Bacteria | 6098 |
| 139 | Ga0070712_100039813 | 3300006175 | Bacteria | 3218 |
| 140 | Ga0070712_100405534 | 3300006175 | Bacteria | 1127 |
| 141 | Ga0075367_10206761 | 3300006178 | Bacteria | 1227 |
| 142 | Ga0075367_10268677 | 3300006178 | Unclassified | 1071 |
| 143 | Ga0075369_10654701 | 3300006186 | Bacteria | 504 |
| 144 | Ga0097621_100225663 | 3300006237 | Bacteria | 1634 |
| 145 | Ga0097621_100815406 | 3300006237 | Bacteria | 865 |
| 146 | Ga0097621_102323818 | 3300006237 | Bacteria | 513 |
| 147 | Ga0097621_102335592 | 3300006237 | Bacteria | 512 |
| 148 | Ga0068865_100338136 | 3300006881 | Bacteria | 1216 |
| 149 | Ga0097620_100298996 | 3300006931 | Bacteria | 1703 |
| 150 | Ga0097620_102089854 | 3300006931 | Unclassified | 625 |
| 151 | Ga0099794_10585178 | 3300007265 | Bacteria | 591 |
| 152 | Ga0099794_10671529 | 3300007265 | Unclassified | 551 |
| 153 | Ga0099794_10726870 | 3300007265 | Bacteria | 529 |
| 154 | Ga0099794_10730020 | 3300007265 | Bacteria | 528 |
| 155 | Ga0099795_10021022 | 3300007788 | Bacteria | 2135 |
| 156 | Ga0099795_10027813 | 3300007788 | Bacteria | 1916 |
| 157 | Ga0099795_10148003 | 3300007788 | Bacteria | 960 |
| 158 | Ga0099795_10654860 | 3300007788 | Bacteria | 503 |
| 159 | Ga0105240_10031140 | 3300009093 | Bacteria | 6922 |
| 160 | Ga0105240_10035863 | 3300009093 | Bacteria | 6387 |
| 161 | Ga0105240_10197718 | 3300009093 | Bacteria | 2358 |
| 162 | Ga0105240_10398156 | 3300009093 | Bacteria | 1551 |
| 163 | Ga0105240_10402848 | 3300009093 | Bacteria | 1540 |
| 164 | Ga0105240_10523887 | 3300009093 | Bacteria | 1315 |
| 165 | Ga0105247_10158870 | 3300009101 | Bacteria | 1495 |
| 166 | Ga0105247_10287949 | 3300009101 | Bacteria | 1135 |
| 167 | Ga0105247_10448835 | 3300009101 | Bacteria | 929 |
| 168 | Ga0105247_11862777 | 3300009101 | Bacteria | 502 |
| 169 | Ga0105243_10370078 | 3300009148 | Bacteria | 1322 |
| 170 | Ga0105243_11257933 | 3300009148 | Bacteria | 755 |
| 171 | Ga0105241_10055041 | 3300009174 | Bacteria | 3047 |
| 172 | Ga0105241_10200352 | 3300009174 | Bacteria | 1667 |
| 173 | Ga0105241_11454213 | 3300009174 | Unclassified | 658 |
| 174 | Ga0105241_11601032 | 3300009174 | Bacteria | 630 |
| 175 | Ga0105242_10630021 | 3300009176 | Bacteria | 1040 |
| 176 | Ga0105248_10025081 | 3300009177 | Bacteria | 6629 |
| 177 | Ga0105248_10305891 | 3300009177 | Bacteria | 1790 |
| 178 | Ga0105248_12988661 | 3300009177 | Bacteria | 539 |
| 179 | Ga0105237_10009459 | 3300009545 | Bacteria | 10438 |
| 180 | Ga0105237_10009470 | 3300009545 | Bacteria | 10433 |
| 181 | Ga0105237_10123402 | 3300009545 | Bacteria | 2584 |
| 182 | Ga0105237_10255007 | 3300009545 | Bacteria | 1756 |
| 183 | Ga0105237_10275301 | 3300009545 | Bacteria | 1686 |
| 184 | Ga0105237_10758847 | 3300009545 | Bacteria | 977 |
| 185 | Ga0105237_11182669 | 3300009545 | Bacteria | 771 |
| 186 | Ga0105237_11723665 | 3300009545 | Unclassified | 634 |
| 187 | Ga0105238_10009011 | 3300009551 | Bacteria | 9983 |
| 188 | Ga0105238_10017548 | 3300009551 | Bacteria | 7278 |
| 189 | Ga0105238_10156359 | 3300009551 | Bacteria | 2255 |
| 190 | Ga0105238_10390752 | 3300009551 | Bacteria | 1383 |
| 191 | Ga0105249_10219056 | 3300009553 | Bacteria | 1872 |
| 192 | Ga0105249_10251662 | 3300009553 | Bacteria | 1752 |
| 193 | Ga0099796_10075009 | 3300010159 | Bacteria | 1229 |
| 194 | Ga0099796_10160526 | 3300010159 | Bacteria | 891 |
| 195 | Ga0099796_10308289 | 3300010159 | Bacteria | 672 |
| 196 | Ga0105239_10015132 | 3300010375 | Bacteria | 8551 |
| 197 | Ga0105239_10027064 | 3300010375 | Bacteria | 6313 |
| 198 | Ga0105239_10149385 | 3300010375 | Bacteria | 2607 |
| 199 | Ga0105239_10253658 | 3300010375 | Bacteria | 1976 |
| 200 | Ga0105239_10464963 | 3300010375 | Bacteria | 1436 |
| 201 | Ga0105239_11447518 | 3300010375 | Bacteria | 793 |
| 202 | Ga0105239_12527561 | 3300010375 | Bacteria | 599 |
| 203 | Ga0105246_10331686 | 3300011119 | Bacteria | 1240 |
| 204 | Ga0105246_10488858 | 3300011119 | Bacteria | 1043 |
| 205 | Ga0105246_10805062 | 3300011119 | Bacteria | 834 |
| 206 | Ga0105246_12329422 | 3300011119 | Bacteria | 524 |
| 207 | Ga0157370_10033076 | 3300013104 | Bacteria | 5042 |
| 208 | Ga0157369_10020222 | 3300013105 | Bacteria | 7443 |
| 209 | Ga0157369_12204306 | 3300013105 | Bacteria | 559 |
| 210 | Ga0157374_10460966 | 3300013296 | Bacteria | 1273 |
| 211 | Ga0157374_11793989 | 3300013296 | Bacteria | 639 |
| 212 | Ga0163162_10484505 | 3300013306 | Bacteria | 1368 |
| 213 | Ga0157372_10166903 | 3300013307 | Bacteria | 2546 |
| 214 | Ga0157375_12882046 | 3300013308 | Bacteria | 575 |
| 215 | Ga0163163_10963761 | 3300014325 | Unclassified | 916 |
| 216 | Ga0163163_11128721 | 3300014325 | Bacteria | 847 |
| 217 | Ga0163163_11673690 | 3300014325 | Unclassified | 697 |
| 218 | Ga0163163_12214358 | 3300014325 | Unclassified | 609 |
| 219 | Ga0157380_13161504 | 3300014326 | Bacteria | 526 |
| 220 | Ga0182008_10110458 | 3300014497 | Bacteria | 1362 |
| 221 | Ga0157377_10281129 | 3300014745 | Bacteria | 1091 |
| 222 | Ga0157379_10209148 | 3300014968 | Bacteria | 1766 |
| 223 | Ga0157379_10939541 | 3300014968 | Bacteria | 822 |
| 224 | Ga0157376_10319065 | 3300014969 | Bacteria | 1477 |
| 225 | Ga0157376_12611199 | 3300014969 | Bacteria | 545 |
| 226 | Ga0163161_10095370 | 3300017792 | Bacteria | 2207 |
| 227 | Ga0163161_11457037 | 3300017792 | Bacteria | 600 |
| 228 | Ga0209758_1004067 | 3300025297 | Bacteria | 12592 |
| 229 | Ga0207697_10007283 | 3300025315 | Bacteria | 4942 |
| 230 | Ga0207656_10083290 | 3300025321 | Bacteria | 1441 |
| 231 | Ga0207656_10216650 | 3300025321 | Bacteria | 929 |
| 232 | Ga0207692_10032424 | 3300025898 | Bacteria | 2511 |
| 233 | Ga0207692_10129017 | 3300025898 | Bacteria | 1425 |
| 234 | Ga0207710_10473186 | 3300025900 | Unclassified | 648 |
| 235 | Ga0207710_10549819 | 3300025900 | Bacteria | 601 |
| 236 | Ga0207688_10149914 | 3300025901 | Bacteria | 1377 |
| 237 | Ga0207647_10006000 | 3300025904 | Bacteria | 8850 |
| 238 | Ga0207647_10022741 | 3300025904 | Bacteria | 4160 |
| 239 | Ga0207647_10156001 | 3300025904 | Bacteria | 1333 |
| 240 | Ga0207647_10344404 | 3300025904 | Bacteria | 844 |
| 241 | Ga0207685_10027964 | 3300025905 | Bacteria | 1980 |
| 242 | Ga0207699_10018080 | 3300025906 | Bacteria | 3728 |
| 243 | Ga0207699_10030363 | 3300025906 | Bacteria | 3023 |
| 244 | Ga0207699_10172022 | 3300025906 | Bacteria | 1450 |
| 245 | Ga0207699_10713003 | 3300025906 | Unclassified | 735 |
| 246 | Ga0207705_10295032 | 3300025909 | Bacteria | 1243 |
| 247 | Ga0207684_10568814 | 3300025910 | Bacteria | 969 |
| 248 | Ga0207654_10876709 | 3300025911 | Bacteria | 650 |
| 249 | Ga0207707_10005343 | 3300025912 | Bacteria | 11225 |
| 250 | Ga0207707_10051455 | 3300025912 | Bacteria | 3587 |
| 251 | Ga0207707_10088161 | 3300025912 | Bacteria | 2710 |
| 252 | Ga0207695_10047109 | 3300025913 | Bacteria | 4565 |
| 253 | Ga0207695_10096550 | 3300025913 | Bacteria | 2957 |
| 254 | Ga0207695_10223701 | 3300025913 | Bacteria | 1789 |
| 255 | Ga0207695_10252428 | 3300025913 | Bacteria | 1663 |
| 256 | Ga0207695_10299191 | 3300025913 | Bacteria | 1500 |
| 257 | Ga0207695_10475279 | 3300025913 | Bacteria | 1132 |
| 258 | Ga0207695_10883556 | 3300025913 | Bacteria | 773 |
| 259 | Ga0207671_10084211 | 3300025914 | Bacteria | 2388 |
| 260 | Ga0207671_10126647 | 3300025914 | Bacteria | 1957 |
| 261 | Ga0207671_10723876 | 3300025914 | Bacteria | 791 |
| 262 | Ga0207671_10776972 | 3300025914 | Bacteria | 760 |
| 263 | Ga0207671_11437910 | 3300025914 | Unclassified | 534 |
| 264 | Ga0207693_10015799 | 3300025915 | Bacteria | 6048 |
| 265 | Ga0207693_10184408 | 3300025915 | Bacteria | 1643 |
| 266 | Ga0207693_10233469 | 3300025915 | Bacteria | 1444 |
| 267 | Ga0207663_10055078 | 3300025916 | Bacteria | 2494 |
| 268 | Ga0207663_10212756 | 3300025916 | Bacteria | 1402 |
| 269 | Ga0207663_10300981 | 3300025916 | Bacteria | 1198 |
| 270 | Ga0207663_10349887 | 3300025916 | Bacteria | 1118 |
| 271 | Ga0207660_10018171 | 3300025917 | Bacteria | 4682 |
| 272 | Ga0207660_10053074 | 3300025917 | Bacteria | 2888 |
| 273 | Ga0207662_10941031 | 3300025918 | Bacteria | 612 |
| 274 | Ga0207657_10006315 | 3300025919 | Bacteria | 12312 |
| 275 | Ga0207657_11238234 | 3300025919 | Bacteria | 566 |
| 276 | Ga0207649_10125903 | 3300025920 | Bacteria | 1734 |
| 277 | Ga0207649_11688191 | 3300025920 | Bacteria | 501 |
| 278 | Ga0207652_10116431 | 3300025921 | Bacteria | 2374 |
| 279 | Ga0207652_10145273 | 3300025921 | Bacteria | 2122 |
| 280 | Ga0207652_10857866 | 3300025921 | Bacteria | 804 |
| 281 | Ga0207694_10043027 | 3300025924 | Bacteria | 3485 |
| 282 | Ga0207694_10105853 | 3300025924 | Bacteria | 2234 |
| 283 | Ga0207694_10118535 | 3300025924 | Bacteria | 2112 |
| 284 | Ga0207694_10415166 | 3300025924 | Bacteria | 1120 |
| 285 | Ga0207659_10724391 | 3300025926 | Bacteria | 852 |
| 286 | Ga0207700_10003371 | 3300025928 | Bacteria | 9275 |
| 287 | Ga0207700_10056874 | 3300025928 | Bacteria | 2947 |
| 288 | Ga0207700_10090527 | 3300025928 | Bacteria | 2415 |
| 289 | Ga0207664_10020128 | 3300025929 | Bacteria | 4941 |
| 290 | Ga0207664_10146209 | 3300025929 | Bacteria | 2005 |
| 291 | Ga0207664_10548180 | 3300025929 | Bacteria | 1037 |
| 292 | Ga0207690_10080187 | 3300025932 | Bacteria | 2277 |
| 293 | Ga0207690_11675302 | 3300025932 | Bacteria | 531 |
| 294 | Ga0207706_10101488 | 3300025933 | Bacteria | 2531 |
| 295 | Ga0207706_10229253 | 3300025933 | Bacteria | 1625 |
| 296 | Ga0207686_10586344 | 3300025934 | Bacteria | 876 |
| 297 | Ga0207686_11329049 | 3300025934 | Bacteria | 591 |
| 298 | Ga0207709_11047440 | 3300025935 | Bacteria | 668 |
| 299 | Ga0207670_10180841 | 3300025936 | Bacteria | 1588 |
| 300 | Ga0207669_10419467 | 3300025937 | Bacteria | 1053 |
| 301 | Ga0207669_11132619 | 3300025937 | Bacteria | 661 |
| 302 | Ga0207669_11622139 | 3300025937 | Bacteria | 552 |
| 303 | Ga0207665_10033272 | 3300025939 | Bacteria | 3416 |
| 304 | Ga0207665_10938287 | 3300025939 | Bacteria | 687 |
| 305 | Ga0207711_10109583 | 3300025941 | Bacteria | 2454 |
| 306 | Ga0207711_10324839 | 3300025941 | Bacteria | 1422 |
| 307 | Ga0207711_10911551 | 3300025941 | Bacteria | 817 |
| 308 | Ga0207661_10032322 | 3300025944 | Bacteria | 4052 |
| 309 | Ga0207661_10051711 | 3300025944 | Bacteria | 3279 |
| 310 | Ga0207661_11155184 | 3300025944 | Bacteria | 713 |
| 311 | Ga0207661_11311935 | 3300025944 | Bacteria | 665 |
| 312 | Ga0207667_10014461 | 3300025949 | Bacteria | 8997 |
| 313 | Ga0207667_10023959 | 3300025949 | Bacteria | 6715 |
| 314 | Ga0207667_10044250 | 3300025949 | Bacteria | 4719 |
| 315 | Ga0207667_10867583 | 3300025949 | Bacteria | 896 |
| 316 | Ga0207667_10878231 | 3300025949 | Bacteria | 890 |
| 317 | Ga0207712_10375695 | 3300025961 | Bacteria | 1188 |
| 318 | Ga0207712_10873808 | 3300025961 | Bacteria | 793 |
| 319 | Ga0207712_11090285 | 3300025961 | Bacteria | 710 |
| 320 | Ga0207640_10015094 | 3300025981 | Bacteria | 4464 |
| 321 | Ga0207640_10420404 | 3300025981 | Bacteria | 1094 |
| 322 | Ga0207640_12017685 | 3300025981 | Bacteria | 523 |
| 323 | Ga0207658_10807077 | 3300025986 | Bacteria | 852 |
| 324 | Ga0207703_10371248 | 3300026035 | Bacteria | 1321 |
| 325 | Ga0207703_12133922 | 3300026035 | Bacteria | 536 |
| 326 | Ga0207639_10031182 | 3300026041 | Bacteria | 3916 |
| 327 | Ga0207639_10088708 | 3300026041 | Bacteria | 2469 |
| 328 | Ga0207639_10134662 | 3300026041 | Bacteria | 2050 |
| 329 | Ga0207639_10656871 | 3300026041 | Bacteria | 970 |
| 330 | Ga0207639_10702688 | 3300026041 | Bacteria | 938 |
| 331 | Ga0207639_11961514 | 3300026041 | Bacteria | 546 |
| 332 | Ga0207678_10135485 | 3300026067 | Bacteria | 2101 |
| 333 | Ga0207678_10510941 | 3300026067 | Bacteria | 1048 |
| 334 | Ga0207678_10535077 | 3300026067 | Bacteria | 1024 |
| 335 | Ga0207702_10026782 | 3300026078 | Bacteria | 4787 |
| 336 | Ga0207702_10693403 | 3300026078 | Bacteria | 1003 |
| 337 | Ga0207641_10265154 | 3300026088 | Bacteria | 1610 |
| 338 | Ga0207641_10405586 | 3300026088 | Bacteria | 1310 |
| 339 | Ga0207674_10006945 | 3300026116 | Bacteria | 13259 |
| 340 | Ga0207674_10017516 | 3300026116 | Bacteria | 7815 |
| 341 | Ga0207674_10078005 | 3300026116 | Bacteria | 3318 |
| 342 | Ga0207675_101843607 | 3300026118 | Bacteria | 624 |
| 343 | Ga0207683_10351773 | 3300026121 | Bacteria | 1352 |
| 344 | Ga0207683_11201608 | 3300026121 | Bacteria | 703 |
| 345 | Ga0207698_10139373 | 3300026142 | Bacteria | 2087 |
| 346 | Ga0207698_10355981 | 3300026142 | Bacteria | 1384 |
| 347 | Ga0207698_10885328 | 3300026142 | Bacteria | 899 |
| 348 | Ga0209179_1019280 | 3300027512 | Bacteria | 1312 |
| 349 | Ga0209179_1058124 | 3300027512 | Bacteria | 837 |
| 350 | Ga0209179_1074138 | 3300027512 | Bacteria | 747 |
| 351 | Ga0209179_1093384 | 3300027512 | Bacteria | 668 |
| 352 | Ga0209588_1079305 | 3300027671 | Bacteria | 1061 |
| 353 | Ga0209813_10323648 | 3300027866 | Unclassified | 604 |
| 354 | Ga0268266_11795174 | 3300028379 | Bacteria | 588 |
| 355 | Ga0268264_11223208 | 3300028381 | Bacteria | 761 |
| 356 | Ga0268264_11249358 | 3300028381 | Bacteria | 753 |
| 357 | Ga0265334_10066879 | 3300028573 | Bacteria | 1344 |
| 358 | Ga0307517_10000483 | 3300028786 | Bacteria | 68332 |
| 359 | Ga0307517_10544396 | 3300028786 | Bacteria | 581 |
| 360 | Ga0307515_10035400 | 3300028794 | Bacteria | 8125 |
| 361 | Ga0307515_10393518 | 3300028794 | Bacteria | 1014 |
| 362 | Ga0307515_10867000 | 3300028794 | Bacteria | 531 |
| 363 | Ga0265762_1015148 | 3300030760 | Bacteria | 1395 |
| 364 | Ga0265763_1011726 | 3300030763 | Bacteria | 827 |
| 365 | Ga0265760_10052842 | 3300031090 | Bacteria | 1225 |
| 366 | Ga0265330_10003310 | 3300031235 | Bacteria | 8474 |
| 367 | Ga0265330_10020070 | 3300031235 | Bacteria | 3055 |
| 368 | Ga0265330_10056010 | 3300031235 | Bacteria | 1721 |
| 369 | Ga0265330_10173653 | 3300031235 | Bacteria | 913 |
| 370 | Ga0265332_10329663 | 3300031238 | Bacteria | 630 |
| 371 | Ga0265328_10260667 | 3300031239 | Bacteria | 665 |
| 372 | Ga0265325_10066080 | 3300031241 | Bacteria | 1824 |
| 373 | Ga0265340_10000504 | 3300031247 | Bacteria | 21438 |
| 374 | Ga0265340_10044772 | 3300031247 | Bacteria | 2165 |
| 375 | Ga0265331_10289362 | 3300031250 | Bacteria | 734 |
| 376 | Ga0265316_10134732 | 3300031344 | Bacteria | 1859 |
| 377 | Ga0265316_10324436 | 3300031344 | Bacteria | 1118 |
| 378 | Ga0307513_10211720 | 3300031456 | Bacteria | 1769 |
| 379 | Ga0307408_100433661 | 3300031548 | Bacteria | 1136 |
| 380 | Ga0307408_100800787 | 3300031548 | Bacteria | 855 |
| 381 | Ga0265313_10053565 | 3300031595 | Bacteria | 1920 |
| 382 | Ga0307508_10091451 | 3300031616 | Bacteria | 2631 |
| 383 | Ga0307508_10124169 | 3300031616 | Bacteria | 2184 |
| 384 | Ga0307508_10179322 | 3300031616 | Bacteria | 1721 |
| 385 | Ga0265314_10005362 | 3300031711 | Bacteria | 11590 |
| 386 | Ga0265342_10087734 | 3300031712 | Bacteria | 1787 |
| 387 | Ga0265342_10160817 | 3300031712 | Bacteria | 1241 |
| 388 | Ga0307516_10032161 | 3300031730 | Bacteria | 5284 |
| 389 | Ga0307516_10195303 | 3300031730 | Bacteria | 1747 |
| 390 | Ga0307516_10620178 | 3300031730 | Bacteria | 736 |
| 391 | Ga0307516_10990182 | 3300031730 | Bacteria | 512 |
| 392 | Ga0307405_10710768 | 3300031731 | Bacteria | 833 |
| 393 | Ga0307413_10679583 | 3300031824 | Bacteria | 853 |
| 394 | Ga0307406_10090174 | 3300031901 | Bacteria | 2062 |
| 395 | Ga0307412_10635582 | 3300031911 | Bacteria | 908 |
| 396 | Ga0307416_100340528 | 3300032002 | Bacteria | 1512 |
| 397 | Ga0307416_100984081 | 3300032002 | Bacteria | 946 |
| 398 | Ga0307411_10409545 | 3300032005 | Bacteria | 1123 |
| 399 | Ga0307411_10523279 | 3300032005 | Bacteria | 1007 |
| 400 | Ga0307411_12120760 | 3300032005 | Bacteria | 526 |
| 401 | Ga0307415_102017136 | 3300032126 | Bacteria | 562 |
| 402 | Ga0373930_0029012 | 3300034816 | Bacteria | 1129 |
| 403 | Ga0373948_0070034 | 3300034817 | Bacteria | 785 |
| 404 | Ga0373958_0202952 | 3300034819 | Bacteria | 520 |
| 405 | Ga0373929_0129057 | 3300035085 | Bacteria | 661 |
| 406 | Ga0373934_0018773 | 3300035086 | Bacteria | 2649 |
| 407 | Ga0373952_0009417 | 3300035092 | Bacteria | 1870 |
| 408 | Ga0373923_0026612 | 3300035111 | Bacteria | 2302 |
| 409 | Ga0373932_0428040 | 3300035112 | Bacteria | 516 |
| 410 | Ga0373936_0089798 | 3300035113 | Bacteria | 1287 |
| 411 | Ga0373939_0225005 | 3300035114 | Bacteria | 720 |
| 412 | Ga0373939_0468383 | 3300035114 | Bacteria | 533 |
| 413 | Ga0373941_0019211 | 3300035115 | Bacteria | 1899 |
| 414 | Ga0373953_0036598 | 3300035117 | Bacteria | 1934 |
| 415 | Ga0373954_0000167 | 3300035118 | Bacteria | 23536 |
| 416 | Ga0373954_0010236 | 3300035118 | Bacteria | 4135 |
| 417 | Ga0373956_0008200 | 3300035119 | Bacteria | 4228 |
| 418 | Ga0373957_0010346 | 3300035120 | Bacteria | 3081 |
| 419 | Ga0373943_0514682 | 3300035170 | Bacteria | 700 |
| 420 | Ga0373946_0121518 | 3300035171 | Bacteria | 1193 |
| 421 | Ga0373955_0036864 | 3300035172 | Bacteria | 2598 |
| 422 | Ga0373942_0252111 | 3300035207 | Bacteria | 600 |
| 423 | Ga0373961_0340611 | 3300035241 | Bacteria | 563 |
| 424 | Ga0373931_0046226 | 3300035691 | Bacteria | 2300 |
| 425 | Ga0373931_1031291 | 3300035691 | Bacteria | 558 |
| 426 | Ga0373935_0064843 | 3300035692 | Bacteria | 2343 |
| 427 | Ga0373935_0189332 | 3300035692 | Bacteria | 1416 |
| 428 | Ga0373927_0030244 | 3300035695 | Bacteria | 3534 |
| 429 | Ga0373927_0054833 | 3300035695 | Bacteria | 2578 |
| 430 | Ga0373927_0137605 | 3300035695 | Bacteria | 1596 |
| 431 | Ga0373933_0000007 | 3300035724 | Bacteria | 123599 |
| 432 | Ga0373933_0167420 | 3300035724 | Bacteria | 1397 |
| 433 | Ga0373933_0813823 | 3300035724 | Bacteria | 615 |
| 434 | Ga0373947_0007264 | 3300035725 | Bacteria | 6418 |
| 435 | Ga0373947_0026147 | 3300035725 | Bacteria | 3408 |
| 436 | Ga0373947_0315040 | 3300035725 | Bacteria | 1045 |
| 437 | Ga0373937_0109431 | 3300036401 | Bacteria | 2569 |
| 438 | Ga0373937_1354069 | 3300036401 | Bacteria | 660 |
| 439 | Ga0373925_0054927 | 3300037068 | Bacteria | 2980 |
| 440 | Ga0373925_0321310 | 3300037068 | Bacteria | 1252 |
| 441 | Ga0373925_0406969 | 3300037068 | Bacteria | 1110 |
| 442 | Ga0373925_0853740 | 3300037068 | Bacteria | 750 |
| 443 | Ga0395905_0108267 | 3300037471 | Bacteria | 2609 |
| 444 | Ga0439465_0164620 | 3300041413 | Bacteria | 797 |
| 445 | Ga0451797_0927315 | 3300041453 | Bacteria | 620 |
| 446 | Ga0451807_0729203 | 3300041486 | Bacteria | 539 |
| 447 | Ga0451807_2732070 | 3300041486 | Bacteria | 751 |
| 448 | Ga0451843_1558469 | 3300041509 | Bacteria | 569 |
| 449 | Ga0451853_1829236 | 3300041512 | Bacteria | 547 |
| 450 | Ga0451853_3880663 | 3300041512 | Bacteria | 1037 |
| 451 | Ga0495592_0098584 | 3300046454 | Bacteria | 2085 |
| 452 | Ga0495592_0347980 | 3300046454 | Bacteria | 951 |
| 453 | Ga0495603_0044822 | 3300046455 | Bacteria | 2639 |
| 454 | Ga0495603_0182585 | 3300046455 | Bacteria | 1214 |
| 455 | Ga0495603_0203838 | 3300046455 | Bacteria | 1143 |
| 456 | Ga0495629_0007517 | 3300046459 | Bacteria | 8035 |
| 457 | Ga0495629_0598971 | 3300046459 | Bacteria | 737 |
| 458 | Ga0495638_0146764 | 3300046460 | Bacteria | 1372 |
| 459 | Ga0495638_0206863 | 3300046460 | Bacteria | 1104 |
| 460 | Ga0495641_0276798 | 3300046461 | Bacteria | 755 |
| 461 | Ga0495651_0070399 | 3300046462 | Bacteria | 2661 |
| 462 | Ga0495651_0237577 | 3300046462 | Bacteria | 1251 |
| 463 | Ga0495651_0396542 | 3300046462 | Bacteria | 902 |
| 464 | Ga0495653_0046964 | 3300046463 | Bacteria | 3341 |
| 465 | Ga0495580_0380064 | 3300046472 | Bacteria | 954 |
| 466 | Ga0495582_0821511 | 3300046473 | Bacteria | 538 |
| 467 | Ga0495639_0219630 | 3300046475 | Bacteria | 934 |
| 468 | Ga0495639_0418016 | 3300046475 | Bacteria | 679 |
| 469 | Ga0495664_0141838 | 3300046477 | Bacteria | 1457 |
| 470 | Ga0495585_0195454 | 3300046492 | Bacteria | 1033 |
| 471 | Ga0495594_0179064 | 3300046499 | Bacteria | 1207 |
| 472 | Ga0495608_0020550 | 3300046511 | Bacteria | 4538 |
| 473 | Ga0495608_0356938 | 3300046511 | Bacteria | 899 |
| 474 | Ga0495618_0099410 | 3300046514 | Bacteria | 1862 |
| 475 | Ga0495618_0468346 | 3300046514 | Bacteria | 763 |
| 476 | Ga0495628_0075427 | 3300046516 | Bacteria | 2626 |
| 477 | Ga0495628_0948014 | 3300046516 | Bacteria | 595 |
| 478 | Ga0495628_1202165 | 3300046516 | Bacteria | 514 |
| 479 | Ga0495630_0111792 | 3300046517 | Bacteria | 2069 |
| 480 | Ga0495630_1082726 | 3300046517 | Bacteria | 608 |
| 481 | Ga0495631_0200633 | 3300046518 | Bacteria | 853 |
| 482 | Ga0495632_0146203 | 3300046519 | Bacteria | 1094 |
| 483 | Ga0495652_0519930 | 3300046529 | Bacteria | 823 |
| 484 | Ga0495652_0678237 | 3300046529 | Bacteria | 695 |
| 485 | Ga0495652_1108562 | 3300046529 | Bacteria | 513 |
| 486 | Ga0495640_0478595 | 3300046533 | Bacteria | 759 |
| 487 | Ga0495640_0806888 | 3300046533 | Bacteria | 559 |
| 488 | Ga0495640_0809797 | 3300046533 | Bacteria | 558 |
| 489 | Ga0495587_0091601 | 3300046536 | Bacteria | 1755 |
| 490 | Ga0495587_0746320 | 3300046536 | Bacteria | 535 |
| 491 | Ga0495609_0140149 | 3300046538 | Bacteria | 1032 |
| 492 | Ga0495645_0010229 | 3300046543 | Bacteria | 6573 |
| 493 | Ga0495633_0163374 | 3300046558 | Bacteria | 1027 |
| 494 | Ga0495667_0526317 | 3300046559 | Bacteria | 739 |
| 495 | Ga0495668_0063371 | 3300046616 | Bacteria | 2036 |
| 496 | Ga0495668_0208938 | 3300046616 | Bacteria | 1069 |
| 497 | Ga0495668_0293011 | 3300046616 | Bacteria | 892 |
| 498 | Ga0495668_0369223 | 3300046616 | Bacteria | 788 |
| 499 | Ga0495634_0014308 | 3300046642 | Bacteria | 5724 |
| 500 | Ga0495625_0281457 | 3300046660 | Bacteria | 1070 |
| 501 | Ga0495625_0455891 | 3300046660 | Bacteria | 789 |
| 502 | Ga0495635_0003274 | 3300046663 | Bacteria | 11179 |
| 503 | Ga0495635_0995604 | 3300046663 | Bacteria | 534 |
| 504 | Ga0495588_0089468 | 3300046674 | Bacteria | 1612 |
| 505 | Ga0495657_0080130 | 3300046675 | Bacteria | 2113 |
| 506 | Ga0495657_0282121 | 3300046675 | Bacteria | 994 |
| 507 | Ga0495599_0151751 | 3300046678 | Bacteria | 1434 |
| 508 | Ga0495623_0030686 | 3300046679 | Bacteria | 3457 |
| 509 | Ga0495623_0257122 | 3300046679 | Bacteria | 980 |
| 510 | Ga0495646_0056840 | 3300046680 | Bacteria | 2344 |
| 511 | Ga0495658_0342121 | 3300046683 | Bacteria | 950 |
| 512 | Ga0495669_0144623 | 3300046684 | Bacteria | 1123 |
| 513 | Ga0495613_0434284 | 3300046689 | Bacteria | 892 |
| 514 | Ga0495613_0485165 | 3300046689 | Bacteria | 834 |
| 515 | Ga0495624_0157474 | 3300046690 | Bacteria | 1388 |
| 516 | Ga0495624_0480984 | 3300046690 | Bacteria | 743 |
| 517 | Ga0495600_0277534 | 3300046809 | Bacteria | 1061 |
| 518 | Ga0495600_0408815 | 3300046809 | Bacteria | 843 |
| 519 | Ga0495581_0197796 | 3300047315 | Bacteria | 1176 |
| 520 | Ga0495604_0336399 | 3300047317 | Bacteria | 1006 |
| 521 | Ga0495604_0443849 | 3300047317 | Bacteria | 848 |
| 522 | Ga0495604_0743782 | 3300047317 | Bacteria | 621 |
| 523 | Ga0495674_0059246 | 3300047319 | Bacteria | 3345 |
| 524 | Ga0495674_0693374 | 3300047319 | Bacteria | 800 |
| 525 | Ga0495674_1244652 | 3300047319 | Bacteria | 561 |
| 526 | Ga0495672_0043133 | 3300047320 | Bacteria | 2714 |
| 527 | Ga0495672_0051539 | 3300047320 | Bacteria | 2423 |
| 528 | Ga0495680_0628819 | 3300047322 | Bacteria | 715 |
| 529 | Ga0495680_0727409 | 3300047322 | Bacteria | 653 |
| 530 | Ga0495683_0457694 | 3300047323 | Unclassified | 523 |
| 531 | Ga0495675_0336293 | 3300047444 | Bacteria | 890 |
| 532 | Ga0495675_0812056 | 3300047444 | Unclassified | 517 |
| 533 | Ga0495684_0004169 | 3300047471 | Bacteria | 11285 |
| 534 | Ga0495684_0488731 | 3300047471 | Bacteria | 849 |
| 535 | Ga0495686_0684323 | 3300047472 | Bacteria | 524 |
| 536 | Ga0495593_0000677 | 3300047673 | Bacteria | 19636 |
| 537 | Ga0495602_0128374 | 3300048088 | Bacteria | 2027 |
| 538 | Ga0495602_0165923 | 3300048088 | Bacteria | 1719 |
| 539 | Ga0496100_0121130 | 3300048903 | Bacteria | 1830 |
| 540 | Ga0496100_0777672 | 3300048903 | Bacteria | 749 |
| 541 | Ga0496101_0351167 | 3300048904 | Bacteria | 1159 |
| 542 | Ga0496101_0553801 | 3300048904 | Bacteria | 909 |
| 543 | Ga0496101_0800897 | 3300048904 | Bacteria | 743 |
| 544 | Ga0496102_0041504 | 3300048905 | Bacteria | 4166 |
| 545 | Ga0496102_0886682 | 3300048905 | Bacteria | 814 |
| 546 | Ga0496102_1048929 | 3300048905 | Bacteria | 735 |
| 547 | Ga0496103_0044738 | 3300048906 | Bacteria | 2729 |
| 548 | Ga0496103_0682323 | 3300048906 | Unclassified | 652 |
| 549 | Ga0496103_0782969 | 3300048906 | Bacteria | 602 |
| 550 | Ga0496104_0049725 | 3300048907 | Bacteria | 3953 |
| 551 | Ga0496104_0796277 | 3300048907 | Bacteria | 851 |
| 552 | Ga0496105_0279096 | 3300048908 | Bacteria | 1347 |
| 553 | Ga0496105_0624893 | 3300048908 | Unclassified | 834 |
| 554 | Ga0496106_0037402 | 3300048909 | Bacteria | 3631 |
| 555 | Ga0496106_0427881 | 3300048909 | Bacteria | 1064 |
| 556 | Ga0496106_0469218 | 3300048909 | Bacteria | 1011 |
| 557 | Ga0496107_0018511 | 3300048910 | Bacteria | 4905 |
| 558 | Ga0496108_0183820 | 3300048911 | Bacteria | 1811 |
| 559 | Ga0496108_0226278 | 3300048911 | Bacteria | 1626 |
| 560 | Ga0496108_0813113 | 3300048911 | Unclassified | 806 |
| 561 | Ga0496109_0043350 | 3300048912 | Bacteria | 4078 |
| 562 | Ga0496110_0042751 | 3300048913 | Bacteria | 3955 |
| 563 | Ga0496110_0189253 | 3300048913 | Bacteria | 1869 |
| 564 | Ga0496110_0326242 | 3300048913 | Bacteria | 1398 |
| 565 | Ga0496110_0753317 | 3300048913 | Unclassified | 877 |
| 566 | Ga0496110_1255030 | 3300048913 | Unclassified | 650 |
| 567 | Ga0496111_0260331 | 3300048914 | Bacteria | 1287 |
| 568 | Ga0496112_0163417 | 3300048915 | Bacteria | 2192 |
| 569 | Ga0496112_0166716 | 3300048915 | Bacteria | 2168 |
| 570 | Ga0496112_0205865 | 3300048915 | Bacteria | 1926 |
| 571 | Ga0496112_0324303 | 3300048915 | Bacteria | 1484 |
| 572 | Ga0496113_0411753 | 3300048916 | Bacteria | 1086 |
| 573 | Ga0496113_0508110 | 3300048916 | Bacteria | 967 |
| 574 | Ga0496114_0042890 | 3300048917 | Bacteria | 3750 |
| 575 | Ga0496114_0114398 | 3300048917 | Bacteria | 2314 |
| 576 | Ga0496114_0196302 | 3300048917 | Bacteria | 1767 |
| 577 | Ga0496115_0043376 | 3300048918 | Bacteria | 3587 |
| 578 | Ga0496115_0097503 | 3300048918 | Bacteria | 2407 |
| 579 | Ga0496115_0300779 | 3300048918 | Bacteria | 1315 |
| 580 | Ga0496115_0418620 | 3300048918 | Bacteria | 1085 |
| 581 | Ga0496115_0511437 | 3300048918 | Bacteria | 964 |
| 582 | Ga0496115_0913531 | 3300048918 | Bacteria | 676 |
| 583 | Ga0496115_1069548 | 3300048918 | Bacteria | 613 |
| 584 | Ga0496116_0294912 | 3300048919 | Bacteria | 776 |
| 585 | Ga0496117_0162709 | 3300048920 | Bacteria | 1305 |
| 586 | Ga0496118_0027432 | 3300048921 | Bacteria | 4819 |
| 587 | Ga0496118_0551070 | 3300048921 | Bacteria | 562 |
| 588 | Ga0496119_0059502 | 3300048922 | Bacteria | 2294 |
| 589 | Ga0496119_0062748 | 3300048922 | Bacteria | 2213 |
| 590 | Ga0496119_0167090 | 3300048922 | Bacteria | 1165 |
| 591 | Ga0496121_0000214 | 3300048924 | Bacteria | 127349 |
| 592 | Ga0496121_0004032 | 3300048924 | Bacteria | 20180 |
| 593 | Ga0496121_0258443 | 3300048924 | Bacteria | 1204 |
| 594 | Ga0496121_0288958 | 3300048924 | Bacteria | 1118 |
| 595 | Ga0496121_0296884 | 3300048924 | Bacteria | 1098 |
| 596 | Ga0496121_0823307 | 3300048924 | Bacteria | 543 |
| 597 | Ga0496124_0416664 | 3300048927 | Bacteria | 927 |
| 598 | Ga0496124_0507151 | 3300048927 | Bacteria | 807 |
| 599 | Ga0496124_0893796 | 3300048927 | Bacteria | 540 |
| 600 | Ga0496125_0104958 | 3300048928 | Bacteria | 2067 |
| 601 | Ga0496125_0559300 | 3300048928 | Bacteria | 632 |
| 602 | Ga0496126_0007566 | 3300048929 | Bacteria | 11875 |
| 603 | Ga0496126_0072520 | 3300048929 | Bacteria | 3063 |
| 604 | Ga0496126_0087634 | 3300048929 | Bacteria | 2743 |
| 605 | Ga0496126_0269056 | 3300048929 | Bacteria | 1415 |
| 606 | Ga0496126_0291012 | 3300048929 | Bacteria | 1351 |
| 607 | Ga0496126_0577425 | 3300048929 | Bacteria | 888 |
| 608 | Ga0496126_0664367 | 3300048929 | Bacteria | 814 |
| 609 | Ga0496126_0880732 | 3300048929 | Bacteria | 680 |
| 610 | Ga0496126_1198702 | 3300048929 | Bacteria | 558 |
| 611 | Ga0496126_1298660 | 3300048929 | Bacteria | 530 |
| 612 | Ga0495682_0191647 | 3300049460 | Bacteria | 726 |
| 613 | nmdc:mga00v17_664988_c1 | 3300050491 | Bacteria | 669 |
| 614 | nmdc:mga0yw44_285726_c1 | 3300050492 | Bacteria | 1103 |
| 615 | nmdc:mga0yw44_652479_c1 | 3300050492 | Bacteria | 715 |
| 616 | nmdc:mga0yw44_937617_c1 | 3300050492 | Bacteria | 587 |
| 617 | nmdc:mga06z11_30105_c1 | 3300050494 | Bacteria | 2623 |
| 618 | nmdc:mga06z11_96577_c1 | 3300050494 | Bacteria | 1614 |
| 619 | nmdc:mga04h51_356935_c1 | 3300050495 | Unclassified | 605 |
| 620 | nmdc:mga07m45_680025_c1 | 3300050496 | Bacteria | 592 |
| 621 | nmdc:mga0n895_1083211_c1 | 3300050512 | Bacteria | 779 |
| 622 | nmdc:mga0sz30_428918_c1 | 3300050516 | Bacteria | 593 |
| 623 | Ga0495601_0084762 | 3300053077 | Bacteria | 2036 |
| 624 | Ga0495601_0108481 | 3300053077 | Bacteria | 1796 |
| 625 | Ga0495601_0616018 | 3300053077 | Bacteria | 696 |
| 626 | Ga0495612_0390829 | 3300053078 | Bacteria | 631 |
| 627 | Ga0495655_0201406 | 3300053083 | Bacteria | 651 |
| 628 | Ga0495595_0002075 | 3300053084 | Bacteria | 7796 |
| 629 | Ga0495595_0091768 | 3300053084 | Bacteria | 1458 |
| 630 | Ga0495595_0211033 | 3300053084 | Bacteria | 968 |
| 631 | Ga0495619_0224410 | 3300053085 | Bacteria | 1301 |
| 632 | Ga0495619_0732760 | 3300053085 | Bacteria | 671 |
| 633 | Ga0495619_1211703 | 3300053085 | Bacteria | 500 |
| 634 | Ga0500578_0341153 | 3300053086 | Bacteria | 878 |
| 635 | Ga0500647_0058237 | 3300053091 | Bacteria | 1858 |
| 636 | Ga0500583_0231463 | 3300053092 | Bacteria | 915 |
| 637 | Ga0500651_0012431 | 3300053093 | Bacteria | 5160 |
| 638 | Ga0500651_0583040 | 3300053093 | Bacteria | 608 |
| 639 | Ga0500566_0002356 | 3300053094 | Bacteria | 11186 |
| 640 | Ga0500640_045834 | 3300053095 | Bacteria | 1916 |
| 641 | Ga0500641_0385284 | 3300053096 | Bacteria | 555 |
| 642 | Ga0500648_277890 | 3300053097 | Bacteria | 758 |
| 643 | Ga0500556_0202273 | 3300053104 | Bacteria | 785 |
| 644 | Ga0500572_003525 | 3300053111 | Bacteria | 3567 |
| 645 | Ga0500591_110324 | 3300053115 | Bacteria | 1154 |
| 646 | Ga0500595_000750 | 3300053119 | Bacteria | 19098 |
| 647 | Ga0500595_050019 | 3300053119 | Bacteria | 1299 |
| 648 | Ga0500595_076672 | 3300053119 | Bacteria | 984 |
| 649 | Ga0500595_124352 | 3300053119 | Bacteria | 728 |
| 650 | Ga0500614_007597 | 3300053123 | Bacteria | 2288 |
| 651 | Ga0500642_0191408 | 3300053130 | Bacteria | 954 |
| 652 | Ga0500559_0034525 | 3300053136 | Bacteria | 2181 |
| 653 | Ga0500559_0360938 | 3300053136 | Bacteria | 679 |
| 654 | Ga0500568_0027565 | 3300053139 | Bacteria | 2374 |
| 655 | Ga0500568_0249295 | 3300053139 | Bacteria | 647 |
| 656 | Ga0500588_0361290 | 3300053146 | Bacteria | 552 |
| 657 | Ga0500603_008356 | 3300053150 | Bacteria | 2293 |
| 658 | Ga0500620_075241 | 3300053155 | Bacteria | 1165 |
| 659 | Ga0500622_0198884 | 3300053156 | Bacteria | 913 |
| 660 | Ga0500627_0072588 | 3300053158 | Bacteria | 1526 |
| 661 | Ga0500630_008710 | 3300053159 | Bacteria | 4982 |
| 662 | Ga0500638_005430 | 3300053162 | Bacteria | 5075 |
| 663 | Ga0500639_002312 | 3300053163 | Bacteria | 9561 |
| 664 | Ga0500636_0017300 | 3300053177 | Bacteria | 4256 |
| 665 | Ga0500636_0116518 | 3300053177 | Bacteria | 1503 |
| 666 | Ga0500637_0020670 | 3300053178 | Bacteria | 3569 |
| 667 | Ga0500576_150756 | 3300053725 | Bacteria | 869 |
| 668 | Ga0500611_044358 | 3300053727 | Bacteria | 991 |
| 669 | Ga0500609_016984 | 3300053731 | Bacteria | 988 |
| 670 | Ga0500596_002233 | 3300053735 | Bacteria | 3841 |
| 671 | Ga0500601_010962 | 3300053737 | Bacteria | 1017 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005547 | Ga0070693_100652772 | Ga0070693_1006527722 | 56 |
| 2 | 3300025913 | Ga0207695_10475279 | Ga0207695_104752792 | 56 |
| 3 | 3300035112 | Ga0373932_0428040 | Ga0373932_0428040_226_426 | 56 |
| 4 | 3300005293 | Ga0065715_10120325 | Ga0065715_101203254 | 57 |
| 5 | 3300005329 | Ga0070683_100783139 | Ga0070683_1007831393 | 57 |
| 6 | 3300005334 | Ga0068869_100966370 | Ga0068869_1009663702 | 57 |
| 7 | 3300005337 | Ga0070682_100865885 | Ga0070682_1008658852 | 57 |
| 8 | 3300005343 | Ga0070687_101187946 | Ga0070687_1011879462 | 57 |
| 9 | 3300005367 | Ga0070667_100317816 | Ga0070667_1003178164 | 57 |
| 10 | 3300005459 | Ga0068867_100523272 | Ga0068867_1005232722 | 57 |
| 11 | 3300005535 | Ga0070684_101301882 | Ga0070684_1013018822 | 57 |
| 12 | 3300005539 | Ga0068853_102021580 | Ga0068853_1020215802 | 57 |
| 13 | 3300005544 | Ga0070686_100094482 | Ga0070686_1000944823 | 57 |
| 14 | 3300005547 | Ga0070693_100349127 | Ga0070693_1003491272 | 57 |
| 15 | 3300005617 | Ga0068859_100298992 | Ga0068859_1002989922 | 57 |
| 16 | 3300005718 | Ga0068866_10389442 | Ga0068866_103894422 | 57 |
| 17 | 3300005841 | Ga0068863_100902150 | Ga0068863_1009021502 | 57 |
| 18 | 3300005842 | Ga0068858_100226200 | Ga0068858_1002262004 | 57 |
| 19 | 3300005843 | Ga0068860_100993774 | Ga0068860_1009937742 | 57 |
| 20 | 3300006237 | Ga0097621_102335592 | Ga0097621_1023355922 | 57 |
| 21 | 3300006881 | Ga0068865_100338136 | Ga0068865_1003381362 | 57 |
| 22 | 3300006931 | Ga0097620_100298996 | Ga0097620_1002989964 | 57 |
| 23 | 3300009101 | Ga0105247_10448835 | Ga0105247_104488351 | 57 |
| 24 | 3300009174 | Ga0105241_10055041 | Ga0105241_100550416 | 57 |
| 25 | 3300009177 | Ga0105248_10305891 | Ga0105248_103058914 | 57 |
| 26 | 3300009545 | Ga0105237_10758847 | Ga0105237_107588473 | 57 |
| 27 | 3300010375 | Ga0105239_10015132 | Ga0105239_100151327 | 57 |
| 28 | 3300011119 | Ga0105246_10331686 | Ga0105246_103316863 | 57 |
| 29 | 3300031730 | Ga0307516_10032161 | Ga0307516_100321612 | 57 |
| 30 | 3300035170 | Ga0373943_0514682 | Ga0373943_0514682_212_385 | 57 |
| 31 | 3300035695 | Ga0373927_0137605 | Ga0373927_0137605_306_479 | 57 |
| 32 | 3300035724 | Ga0373933_0813823 | Ga0373933_0813823_379_552 | 57 |
| 33 | 3300035725 | Ga0373947_0007264 | Ga0373947_0007264_5115_5288 | 57 |
| 34 | 3300037068 | Ga0373925_0321310 | Ga0373925_0321310_257_430 | 57 |
| 35 | 3300041486 | Ga0451807_0729203 | Ga0451807_0729203_107_298 | 57 |
| 36 | 3300046472 | Ga0495580_0380064 | Ga0495580_0380064_473_646 | 57 |
| 37 | 3300046473 | Ga0495582_0821511 | Ga0495582_0821511_16_189 | 57 |
| 38 | 3300046475 | Ga0495639_0219630 | Ga0495639_0219630_412_585 | 57 |
| 39 | 3300046517 | Ga0495630_0111792 | Ga0495630_0111792_652_825 | 57 |
| 40 | 3300046533 | Ga0495640_0809797 | Ga0495640_0809797_283_456 | 57 |
| 41 | 3300046663 | Ga0495635_0995604 | Ga0495635_0995604_136_309 | 57 |
| 42 | 3300046689 | Ga0495613_0434284 | Ga0495613_0434284_627_800 | 57 |
| 43 | 3300047315 | Ga0495581_0197796 | Ga0495581_0197796_892_1065 | 57 |
| 44 | 3300047471 | Ga0495684_0488731 | Ga0495684_0488731_640_813 | 57 |
| 45 | 3300005329 | Ga0070683_102313892 | Ga0070683_1023138921 | 58 |
| 46 | 3300005334 | Ga0068869_100636811 | Ga0068869_1006368113 | 58 |
| 47 | 3300005336 | Ga0070680_100906893 | Ga0070680_1009068931 | 58 |
| 48 | 3300005338 | Ga0068868_100897588 | Ga0068868_1008975882 | 58 |
| 49 | 3300005338 | Ga0068868_101109224 | Ga0068868_1011092242 | 58 |
| 50 | 3300005364 | Ga0070673_101832984 | Ga0070673_1018329842 | 58 |
| 51 | 3300005366 | Ga0070659_100258064 | Ga0070659_1002580644 | 58 |
| 52 | 3300005434 | Ga0070709_10353795 | Ga0070709_103537952 | 58 |
| 53 | 3300005435 | Ga0070714_101925400 | Ga0070714_1019254001 | 58 |
| 54 | 3300005436 | Ga0070713_100251769 | Ga0070713_1002517693 | 58 |
| 55 | 3300005439 | Ga0070711_100025335 | Ga0070711_1000253354 | 58 |
| 56 | 3300005439 | Ga0070711_101446452 | Ga0070711_1014464522 | 58 |
| 57 | 3300005439 | Ga0070711_101569920 | Ga0070711_1015699202 | 58 |
| 58 | 3300005455 | Ga0070663_101074072 | Ga0070663_1010740721 | 58 |
| 59 | 3300005458 | Ga0070681_10010223 | Ga0070681_1001022310 | 58 |
| 60 | 3300005530 | Ga0070679_101021125 | Ga0070679_1010211252 | 58 |
| 61 | 3300005616 | Ga0068852_101989409 | Ga0068852_1019894091 | 58 |
| 62 | 3300005843 | Ga0068860_101243427 | Ga0068860_1012434272 | 58 |
| 63 | 3300005937 | Ga0081455_10035923 | Ga0081455_100359234 | 58 |
| 64 | 3300006028 | Ga0070717_10179047 | Ga0070717_101790472 | 58 |
| 65 | 3300006038 | Ga0075365_10138058 | Ga0075365_101380582 | 58 |
| 66 | 3300006038 | Ga0075365_10400926 | Ga0075365_104009262 | 58 |
| 67 | 3300006173 | Ga0070716_100498210 | Ga0070716_1004982102 | 58 |
| 68 | 3300006173 | Ga0070716_101024157 | Ga0070716_1010241572 | 58 |
| 69 | 3300006175 | Ga0070712_100405534 | Ga0070712_1004055342 | 58 |
| 70 | 3300006186 | Ga0075369_10654701 | Ga0075369_106547012 | 58 |
| 71 | 3300006237 | Ga0097621_100815406 | Ga0097621_1008154061 | 58 |
| 72 | 3300006237 | Ga0097621_102323818 | Ga0097621_1023238182 | 58 |
| 73 | 3300009101 | Ga0105247_10158870 | Ga0105247_101588703 | 58 |
| 74 | 3300009174 | Ga0105241_11454213 | Ga0105241_114542133 | 58 |
| 75 | 3300009176 | Ga0105242_10630021 | Ga0105242_106300212 | 58 |
| 76 | 3300009177 | Ga0105248_12988661 | Ga0105248_129886612 | 58 |
| 77 | 3300009545 | Ga0105237_10255007 | Ga0105237_102550074 | 58 |
| 78 | 3300009553 | Ga0105249_10219056 | Ga0105249_102190564 | 58 |
| 79 | 3300010159 | Ga0099796_10075009 | Ga0099796_100750093 | 58 |
| 80 | 3300010375 | Ga0105239_11447518 | Ga0105239_114475183 | 58 |
| 81 | 3300011119 | Ga0105246_10488858 | Ga0105246_104888583 | 58 |
| 82 | 3300013105 | Ga0157369_12204306 | Ga0157369_122043061 | 58 |
| 83 | 3300013306 | Ga0163162_10484505 | Ga0163162_104845053 | 58 |
| 84 | 3300014745 | Ga0157377_10281129 | Ga0157377_102811293 | 58 |
| 85 | 3300014969 | Ga0157376_10319065 | Ga0157376_103190654 | 58 |
| 86 | 3300014969 | Ga0157376_12611199 | Ga0157376_126111992 | 58 |
| 87 | 3300017792 | Ga0163161_10095370 | Ga0163161_100953704 | 58 |
| 88 | 3300025900 | Ga0207710_10549819 | Ga0207710_105498192 | 58 |
| 89 | 3300025904 | Ga0207647_10344404 | Ga0207647_103444042 | 58 |
| 90 | 3300025906 | Ga0207699_10713003 | Ga0207699_107130032 | 58 |
| 91 | 3300025912 | Ga0207707_10005343 | Ga0207707_100053439 | 58 |
| 92 | 3300025915 | Ga0207693_10233469 | Ga0207693_102334692 | 58 |
| 93 | 3300025916 | Ga0207663_10055078 | Ga0207663_100550782 | 58 |
| 94 | 3300025918 | Ga0207662_10941031 | Ga0207662_109410312 | 58 |
| 95 | 3300025921 | Ga0207652_10857866 | Ga0207652_108578662 | 58 |
| 96 | 3300025932 | Ga0207690_11675302 | Ga0207690_116753022 | 58 |
| 97 | 3300025934 | Ga0207686_10586344 | Ga0207686_105863442 | 58 |
| 98 | 3300025936 | Ga0207670_10180841 | Ga0207670_101808414 | 58 |
| 99 | 3300025939 | Ga0207665_10938287 | Ga0207665_109382872 | 58 |
| 100 | 3300025941 | Ga0207711_10324839 | Ga0207711_103248392 | 58 |
| 101 | 3300025944 | Ga0207661_11155184 | Ga0207661_111551844 | 58 |
| 102 | 3300025944 | Ga0207661_11311935 | Ga0207661_113119352 | 58 |
| 103 | 3300025961 | Ga0207712_10375695 | Ga0207712_103756952 | 58 |
| 104 | 3300025961 | Ga0207712_11090285 | Ga0207712_110902851 | 58 |
| 105 | 3300026035 | Ga0207703_12133922 | Ga0207703_121339222 | 58 |
| 106 | 3300026067 | Ga0207678_10510941 | Ga0207678_105109413 | 58 |
| 107 | 3300026088 | Ga0207641_10405586 | Ga0207641_104055863 | 58 |
| 108 | 3300026121 | Ga0207683_11201608 | Ga0207683_112016082 | 58 |
| 109 | 3300027512 | Ga0209179_1058124 | Ga0209179_10581242 | 58 |
| 110 | 3300028381 | Ga0268264_11223208 | Ga0268264_112232082 | 58 |
| 111 | 3300028381 | Ga0268264_11249358 | Ga0268264_112493582 | 58 |
| 112 | 3300030760 | Ga0265762_1015148 | Ga0265762_10151482 | 58 |
| 113 | 3300030763 | Ga0265763_1011726 | Ga0265763_10117262 | 58 |
| 114 | 3300031090 | Ga0265760_10052842 | Ga0265760_100528423 | 58 |
| 115 | 3300031548 | Ga0307408_100800787 | Ga0307408_1008007872 | 58 |
| 116 | 3300031901 | Ga0307406_10090174 | Ga0307406_100901743 | 58 |
| 117 | 3300032002 | Ga0307416_100984081 | Ga0307416_1009840812 | 58 |
| 118 | 3300032005 | Ga0307411_12120760 | Ga0307411_121207602 | 58 |
| 119 | 3300034816 | Ga0373930_0029012 | Ga0373930_0029012_325_516 | 58 |
| 120 | 3300034817 | Ga0373948_0070034 | Ga0373948_0070034_425_616 | 58 |
| 121 | 3300034819 | Ga0373958_0202952 | Ga0373958_0202952_65_256 | 58 |
| 122 | 3300035085 | Ga0373929_0129057 | Ga0373929_0129057_436_627 | 58 |
| 123 | 3300035092 | Ga0373952_0009417 | Ga0373952_0009417_142_333 | 58 |
| 124 | 3300035114 | Ga0373939_0225005 | Ga0373939_0225005_356_532 | 58 |
| 125 | 3300035114 | Ga0373939_0468383 | Ga0373939_0468383_298_489 | 58 |
| 126 | 3300035115 | Ga0373941_0019211 | Ga0373941_0019211_1368_1559 | 58 |
| 127 | 3300035207 | Ga0373942_0252111 | Ga0373942_0252111_245_436 | 58 |
| 128 | 3300035241 | Ga0373961_0340611 | Ga0373961_0340611_316_507 | 58 |
| 129 | 3300035691 | Ga0373931_0046226 | Ga0373931_0046226_1950_2141 | 58 |
| 130 | 3300035692 | Ga0373935_0064843 | Ga0373935_0064843_1097_1288 | 58 |
| 131 | 3300035695 | Ga0373927_0030244 | Ga0373927_0030244_1191_1382 | 58 |
| 132 | 3300035724 | Ga0373933_0000007 | Ga0373933_0000007_82116_82292 | 58 |
| 133 | 3300035725 | Ga0373947_0315040 | Ga0373947_0315040_330_521 | 58 |
| 134 | 3300037068 | Ga0373925_0853740 | Ga0373925_0853740_229_420 | 58 |
| 135 | 3300037471 | Ga0395905_0108267 | Ga0395905_0108267_689_865 | 58 |
| 136 | 3300041413 | Ga0439465_0164620 | Ga0439465_0164620_291_467 | 58 |
| 137 | 3300041512 | Ga0451853_3880663 | Ga0451853_3880663_592_780 | 58 |
| 138 | 3300046460 | Ga0495638_0146764 | Ga0495638_0146764_166_342 | 58 |
| 139 | 3300046475 | Ga0495639_0418016 | Ga0495639_0418016_120_296 | 58 |
| 140 | 3300046477 | Ga0495664_0141838 | Ga0495664_0141838_34_210 | 58 |
| 141 | 3300046516 | Ga0495628_1202165 | Ga0495628_1202165_86_262 | 58 |
| 142 | 3300046533 | Ga0495640_0478595 | Ga0495640_0478595_447_623 | 58 |
| 143 | 3300046616 | Ga0495668_0369223 | Ga0495668_0369223_385_561 | 58 |
| 144 | 3300047472 | Ga0495686_0684323 | Ga0495686_0684323_86_262 | 58 |
| 145 | 3300048903 | Ga0496100_0121130 | Ga0496100_0121130_229_420 | 58 |
| 146 | 3300048903 | Ga0496100_0777672 | Ga0496100_0777672_256_432 | 58 |
| 147 | 3300048904 | Ga0496101_0351167 | Ga0496101_0351167_14_190 | 58 |
| 148 | 3300048904 | Ga0496101_0553801 | Ga0496101_0553801_380_571 | 58 |
| 149 | 3300048905 | Ga0496102_0041504 | Ga0496102_0041504_2008_2199 | 58 |
| 150 | 3300048905 | Ga0496102_0886682 | Ga0496102_0886682_589_765 | 58 |
| 151 | 3300048905 | Ga0496102_1048929 | Ga0496102_1048929_518_694 | 58 |
| 152 | 3300048906 | Ga0496103_0044738 | Ga0496103_0044738_852_1043 | 58 |
| 153 | 3300048907 | Ga0496104_0049725 | Ga0496104_0049725_515_706 | 58 |
| 154 | 3300048907 | Ga0496104_0796277 | Ga0496104_0796277_341_517 | 58 |
| 155 | 3300048908 | Ga0496105_0279096 | Ga0496105_0279096_840_1031 | 58 |
| 156 | 3300048909 | Ga0496106_0037402 | Ga0496106_0037402_1066_1257 | 58 |
| 157 | 3300048909 | Ga0496106_0427881 | Ga0496106_0427881_326_502 | 58 |
| 158 | 3300048910 | Ga0496107_0018511 | Ga0496107_0018511_2334_2525 | 58 |
| 159 | 3300048911 | Ga0496108_0183820 | Ga0496108_0183820_1531_1707 | 58 |
| 160 | 3300048912 | Ga0496109_0043350 | Ga0496109_0043350_1538_1729 | 58 |
| 161 | 3300048913 | Ga0496110_0042751 | Ga0496110_0042751_3259_3450 | 58 |
| 162 | 3300048913 | Ga0496110_1255030 | Ga0496110_1255030_50_226 | 58 |
| 163 | 3300048914 | Ga0496111_0260331 | Ga0496111_0260331_784_960 | 58 |
| 164 | 3300048915 | Ga0496112_0163417 | Ga0496112_0163417_1870_2061 | 58 |
| 165 | 3300048915 | Ga0496112_0205865 | Ga0496112_0205865_106_282 | 58 |
| 166 | 3300048916 | Ga0496113_0411753 | Ga0496113_0411753_784_960 | 58 |
| 167 | 3300048916 | Ga0496113_0508110 | Ga0496113_0508110_189_380 | 58 |
| 168 | 3300048917 | Ga0496114_0042890 | Ga0496114_0042890_1042_1233 | 58 |
| 169 | 3300048917 | Ga0496114_0196302 | Ga0496114_0196302_669_845 | 58 |
| 170 | 3300048918 | Ga0496115_0097503 | Ga0496115_0097503_907_1098 | 58 |
| 171 | 3300048918 | Ga0496115_0511437 | Ga0496115_0511437_710_886 | 58 |
| 172 | 3300048918 | Ga0496115_0913531 | Ga0496115_0913531_36_212 | 58 |
| 173 | 3300048918 | Ga0496115_1069548 | Ga0496115_1069548_252_428 | 58 |
| 174 | 3300048919 | Ga0496116_0294912 | Ga0496116_0294912_449_625 | 58 |
| 175 | 3300048920 | Ga0496117_0162709 | Ga0496117_0162709_951_1127 | 58 |
| 176 | 3300048921 | Ga0496118_0027432 | Ga0496118_0027432_3269_3445 | 58 |
| 177 | 3300048921 | Ga0496118_0551070 | Ga0496118_0551070_63_239 | 58 |
| 178 | 3300048922 | Ga0496119_0059502 | Ga0496119_0059502_384_560 | 58 |
| 179 | 3300048922 | Ga0496119_0062748 | Ga0496119_0062748_979_1155 | 58 |
| 180 | 3300048924 | Ga0496121_0004032 | Ga0496121_0004032_18587_18763 | 58 |
| 181 | 3300048924 | Ga0496121_0288958 | Ga0496121_0288958_489_665 | 58 |
| 182 | 3300048927 | Ga0496124_0416664 | Ga0496124_0416664_52_240 | 58 |
| 183 | 3300048927 | Ga0496124_0893796 | Ga0496124_0893796_339_515 | 58 |
| 184 | 3300048928 | Ga0496125_0559300 | Ga0496125_0559300_307_483 | 58 |
| 185 | 3300048929 | Ga0496126_0007566 | Ga0496126_0007566_5750_5926 | 58 |
| 186 | 3300048929 | Ga0496126_0269056 | Ga0496126_0269056_216_392 | 58 |
| 187 | 3300048929 | Ga0496126_0577425 | Ga0496126_0577425_570_746 | 58 |
| 188 | 3300048929 | Ga0496126_1298660 | Ga0496126_1298660_304_480 | 58 |
| 189 | 3300049460 | Ga0495682_0191647 | Ga0495682_0191647_197_373 | 58 |
| 190 | 3300050492 | nmdc:mga0yw44_652479_c1 | nmdc:mga0yw44_652479_c1_95_271 | 58 |
| 191 | 3300050512 | nmdc:mga0n895_1083211_c1 | nmdc:mga0n895_1083211_c1_26_202 | 58 |
| 192 | 3300050516 | nmdc:mga0sz30_428918_c1 | nmdc:mga0sz30_428918_c1_214_390 | 58 |
| 193 | 3300053077 | Ga0495601_0084762 | Ga0495601_0084762_751_927 | 58 |
| 194 | 3300053077 | Ga0495601_0616018 | Ga0495601_0616018_179_370 | 58 |
| 195 | 3300053086 | Ga0500578_0341153 | Ga0500578_0341153_19_195 | 58 |
| 196 | 3300053092 | Ga0500583_0231463 | Ga0500583_0231463_729_905 | 58 |
| 197 | 3300053093 | Ga0500651_0012431 | Ga0500651_0012431_2174_2350 | 58 |
| 198 | 3300053093 | Ga0500651_0583040 | Ga0500651_0583040_113_289 | 58 |
| 199 | 3300053096 | Ga0500641_0385284 | Ga0500641_0385284_54_230 | 58 |
| 200 | 3300053119 | Ga0500595_000750 | Ga0500595_000750_1768_1944 | 58 |
| 201 | 3300053119 | Ga0500595_050019 | Ga0500595_050019_191_367 | 58 |
| 202 | 3300053119 | Ga0500595_076672 | Ga0500595_076672_83_259 | 58 |
| 203 | 3300053130 | Ga0500642_0191408 | Ga0500642_0191408_20_196 | 58 |
| 204 | 3300053139 | Ga0500568_0249295 | Ga0500568_0249295_385_561 | 58 |
| 205 | 3300053146 | Ga0500588_0361290 | Ga0500588_0361290_92_268 | 58 |
| 206 | 3300053156 | Ga0500622_0198884 | Ga0500622_0198884_588_764 | 58 |
| 207 | 3300053158 | Ga0500627_0072588 | Ga0500627_0072588_459_635 | 58 |
| 208 | 3300053177 | Ga0500636_0017300 | Ga0500636_0017300_838_1014 | 58 |
| 209 | 3300053731 | Ga0500609_016984 | Ga0500609_016984_143_319 | 58 |
| 210 | 3300005327 | Ga0070658_10306872 | Ga0070658_103068721 | 59 |
| 211 | 3300005329 | Ga0070683_100050223 | Ga0070683_1000502233 | 59 |
| 212 | 3300005336 | Ga0070680_100361631 | Ga0070680_1003616312 | 59 |
| 213 | 3300005339 | Ga0070660_100003722 | Ga0070660_1000037223 | 59 |
| 214 | 3300005344 | Ga0070661_100315525 | Ga0070661_1003155252 | 59 |
| 215 | 3300005347 | Ga0070668_101119995 | Ga0070668_1011199952 | 59 |
| 216 | 3300005366 | Ga0070659_100233334 | Ga0070659_1002333342 | 59 |
| 217 | 3300005435 | Ga0070714_100636630 | Ga0070714_1006366303 | 59 |
| 218 | 3300005439 | Ga0070711_100289792 | Ga0070711_1002897922 | 59 |
| 219 | 3300005458 | Ga0070681_10469730 | Ga0070681_104697303 | 59 |
| 220 | 3300005467 | Ga0070706_100612872 | Ga0070706_1006128722 | 59 |
| 221 | 3300005518 | Ga0070699_101641184 | Ga0070699_1016411842 | 59 |
| 222 | 3300005535 | Ga0070684_100212619 | Ga0070684_1002126192 | 59 |
| 223 | 3300005535 | Ga0070684_100218336 | Ga0070684_1002183362 | 59 |
| 224 | 3300005536 | Ga0070697_100008732 | Ga0070697_1000087326 | 59 |
| 225 | 3300005539 | Ga0068853_100011965 | Ga0068853_10001196512 | 59 |
| 226 | 3300005539 | Ga0068853_100106594 | Ga0068853_1001065946 | 59 |
| 227 | 3300005547 | Ga0070693_100689407 | Ga0070693_1006894072 | 59 |
| 228 | 3300005548 | Ga0070665_100830823 | Ga0070665_1008308232 | 59 |
| 229 | 3300005564 | Ga0070664_100199805 | Ga0070664_1001998053 | 59 |
| 230 | 3300005577 | Ga0068857_100073096 | Ga0068857_1000730965 | 59 |
| 231 | 3300005578 | Ga0068854_102057572 | Ga0068854_1020575721 | 59 |
| 232 | 3300005616 | Ga0068852_100674898 | Ga0068852_1006748981 | 59 |
| 233 | 3300005616 | Ga0068852_102210537 | Ga0068852_1022105371 | 59 |
| 234 | 3300005834 | Ga0068851_10434412 | Ga0068851_104344122 | 59 |
| 235 | 3300005834 | Ga0068851_11044693 | Ga0068851_110446931 | 59 |
| 236 | 3300005841 | Ga0068863_100835384 | Ga0068863_1008353841 | 59 |
| 237 | 3300005842 | Ga0068858_100177733 | Ga0068858_1001777332 | 59 |
| 238 | 3300006028 | Ga0070717_11596520 | Ga0070717_115965201 | 59 |
| 239 | 3300007265 | Ga0099794_10585178 | Ga0099794_105851781 | 59 |
| 240 | 3300007265 | Ga0099794_10726870 | Ga0099794_107268702 | 59 |
| 241 | 3300007265 | Ga0099794_10730020 | Ga0099794_107300202 | 59 |
| 242 | 3300007788 | Ga0099795_10021022 | Ga0099795_100210223 | 59 |
| 243 | 3300007788 | Ga0099795_10148003 | Ga0099795_101480033 | 59 |
| 244 | 3300009093 | Ga0105240_10197718 | Ga0105240_101977183 | 59 |
| 245 | 3300009093 | Ga0105240_10523887 | Ga0105240_105238873 | 59 |
| 246 | 3300009101 | Ga0105247_11862777 | Ga0105247_118627771 | 59 |
| 247 | 3300009177 | Ga0105248_10025081 | Ga0105248_100250818 | 59 |
| 248 | 3300009545 | Ga0105237_10009459 | Ga0105237_100094596 | 59 |
| 249 | 3300009545 | Ga0105237_11182669 | Ga0105237_111826693 | 59 |
| 250 | 3300009551 | Ga0105238_10009011 | Ga0105238_100090112 | 59 |
| 251 | 3300010159 | Ga0099796_10160526 | Ga0099796_101605262 | 59 |
| 252 | 3300010375 | Ga0105239_10253658 | Ga0105239_102536583 | 59 |
| 253 | 3300010375 | Ga0105239_10464963 | Ga0105239_104649632 | 59 |
| 254 | 3300013104 | Ga0157370_10033076 | Ga0157370_100330768 | 59 |
| 255 | 3300013105 | Ga0157369_10020222 | Ga0157369_100202221 | 59 |
| 256 | 3300013296 | Ga0157374_11793989 | Ga0157374_117939892 | 59 |
| 257 | 3300013307 | Ga0157372_10166903 | Ga0157372_101669032 | 59 |
| 258 | 3300014325 | Ga0163163_11673690 | Ga0163163_116736902 | 59 |
| 259 | 3300014968 | Ga0157379_10209148 | Ga0157379_102091484 | 59 |
| 260 | 3300025321 | Ga0207656_10083290 | Ga0207656_100832901 | 59 |
| 261 | 3300025900 | Ga0207710_10473186 | Ga0207710_104731862 | 59 |
| 262 | 3300025909 | Ga0207705_10295032 | Ga0207705_102950323 | 59 |
| 263 | 3300025910 | Ga0207684_10568814 | Ga0207684_105688142 | 59 |
| 264 | 3300025912 | Ga0207707_10088161 | Ga0207707_100881614 | 59 |
| 265 | 3300025913 | Ga0207695_10096550 | Ga0207695_100965502 | 59 |
| 266 | 3300025914 | Ga0207671_10084211 | Ga0207671_100842112 | 59 |
| 267 | 3300025915 | Ga0207693_10184408 | Ga0207693_101844082 | 59 |
| 268 | 3300025916 | Ga0207663_10349887 | Ga0207663_103498873 | 59 |
| 269 | 3300025917 | Ga0207660_10018171 | Ga0207660_100181712 | 59 |
| 270 | 3300025919 | Ga0207657_10006315 | Ga0207657_100063153 | 59 |
| 271 | 3300025920 | Ga0207649_10125903 | Ga0207649_101259032 | 59 |
| 272 | 3300025921 | Ga0207652_10116431 | Ga0207652_101164313 | 59 |
| 273 | 3300025924 | Ga0207694_10043027 | Ga0207694_100430272 | 59 |
| 274 | 3300025924 | Ga0207694_10415166 | Ga0207694_104151662 | 59 |
| 275 | 3300025928 | Ga0207700_10056874 | Ga0207700_100568743 | 59 |
| 276 | 3300025929 | Ga0207664_10548180 | Ga0207664_105481803 | 59 |
| 277 | 3300025932 | Ga0207690_10080187 | Ga0207690_100801872 | 59 |
| 278 | 3300025941 | Ga0207711_10109583 | Ga0207711_101095833 | 59 |
| 279 | 3300025941 | Ga0207711_10911551 | Ga0207711_109115512 | 59 |
| 280 | 3300025944 | Ga0207661_10032322 | Ga0207661_100323226 | 59 |
| 281 | 3300025944 | Ga0207661_10051711 | Ga0207661_100517112 | 59 |
| 282 | 3300025949 | Ga0207667_10014461 | Ga0207667_100144612 | 59 |
| 283 | 3300025981 | Ga0207640_12017685 | Ga0207640_120176852 | 59 |
| 284 | 3300026041 | Ga0207639_10031182 | Ga0207639_100311826 | 59 |
| 285 | 3300026041 | Ga0207639_10656871 | Ga0207639_106568711 | 59 |
| 286 | 3300026088 | Ga0207641_10265154 | Ga0207641_102651543 | 59 |
| 287 | 3300026116 | Ga0207674_10078005 | Ga0207674_100780055 | 59 |
| 288 | 3300026142 | Ga0207698_10355981 | Ga0207698_103559813 | 59 |
| 289 | 3300027512 | Ga0209179_1019280 | Ga0209179_10192802 | 59 |
| 290 | 3300027512 | Ga0209179_1074138 | Ga0209179_10741382 | 59 |
| 291 | 3300027671 | Ga0209588_1079305 | Ga0209588_10793052 | 59 |
| 292 | 3300028794 | Ga0307515_10393518 | Ga0307515_103935181 | 59 |
| 293 | 3300031239 | Ga0265328_10260667 | Ga0265328_102606672 | 59 |
| 294 | 3300031616 | Ga0307508_10091451 | Ga0307508_100914512 | 59 |
| 295 | 3300031616 | Ga0307508_10124169 | Ga0307508_101241693 | 59 |
| 296 | 3300035113 | Ga0373936_0089798 | Ga0373936_0089798_146_349 | 59 |
| 297 | 3300035118 | Ga0373954_0010236 | Ga0373954_0010236_1663_1887 | 59 |
| 298 | 3300035171 | Ga0373946_0121518 | Ga0373946_0121518_510_692 | 59 |
| 299 | 3300035691 | Ga0373931_1031291 | Ga0373931_1031291_38_217 | 59 |
| 300 | 3300035692 | Ga0373935_0189332 | Ga0373935_0189332_642_824 | 59 |
| 301 | 3300035695 | Ga0373927_0054833 | Ga0373927_0054833_735_917 | 59 |
| 302 | 3300035725 | Ga0373947_0026147 | Ga0373947_0026147_1161_1343 | 59 |
| 303 | 3300036401 | Ga0373937_1354069 | Ga0373937_1354069_134_313 | 59 |
| 304 | 3300037068 | Ga0373925_0054927 | Ga0373925_0054927_695_877 | 59 |
| 305 | 3300037068 | Ga0373925_0406969 | Ga0373925_0406969_482_661 | 59 |
| 306 | 3300041486 | Ga0451807_2732070 | Ga0451807_2732070_497_676 | 59 |
| 307 | 3300046455 | Ga0495603_0044822 | Ga0495603_0044822_1586_1768 | 59 |
| 308 | 3300046455 | Ga0495603_0182585 | Ga0495603_0182585_349_528 | 59 |
| 309 | 3300046459 | Ga0495629_0598971 | Ga0495629_0598971_185_364 | 59 |
| 310 | 3300046461 | Ga0495641_0276798 | Ga0495641_0276798_204_386 | 59 |
| 311 | 3300046492 | Ga0495585_0195454 | Ga0495585_0195454_725_907 | 59 |
| 312 | 3300046499 | Ga0495594_0179064 | Ga0495594_0179064_592_774 | 59 |
| 313 | 3300046511 | Ga0495608_0356938 | Ga0495608_0356938_122_301 | 59 |
| 314 | 3300046529 | Ga0495652_0678237 | Ga0495652_0678237_466_645 | 59 |
| 315 | 3300046558 | Ga0495633_0163374 | Ga0495633_0163374_351_533 | 59 |
| 316 | 3300046616 | Ga0495668_0293011 | Ga0495668_0293011_14_196 | 59 |
| 317 | 3300046674 | Ga0495588_0089468 | Ga0495588_0089468_913_1095 | 59 |
| 318 | 3300046675 | Ga0495657_0282121 | Ga0495657_0282121_84_263 | 59 |
| 319 | 3300046679 | Ga0495623_0257122 | Ga0495623_0257122_756_935 | 59 |
| 320 | 3300046683 | Ga0495658_0342121 | Ga0495658_0342121_494_676 | 59 |
| 321 | 3300046690 | Ga0495624_0157474 | Ga0495624_0157474_461_643 | 59 |
| 322 | 3300046690 | Ga0495624_0480984 | Ga0495624_0480984_31_210 | 59 |
| 323 | 3300047317 | Ga0495604_0743782 | Ga0495604_0743782_18_197 | 59 |
| 324 | 3300047319 | Ga0495674_1244652 | Ga0495674_1244652_244_423 | 59 |
| 325 | 3300047320 | Ga0495672_0043133 | Ga0495672_0043133_1053_1232 | 59 |
| 326 | 3300047322 | Ga0495680_0727409 | Ga0495680_0727409_88_267 | 59 |
| 327 | 3300048088 | Ga0495602_0128374 | Ga0495602_0128374_637_816 | 59 |
| 328 | 3300048911 | Ga0496108_0813113 | Ga0496108_0813113_308_487 | 59 |
| 329 | 3300048918 | Ga0496115_0043376 | Ga0496115_0043376_3373_3552 | 59 |
| 330 | 3300048924 | Ga0496121_0000214 | Ga0496121_0000214_35933_36112 | 59 |
| 331 | 3300048924 | Ga0496121_0296884 | Ga0496121_0296884_782_961 | 59 |
| 332 | 3300048927 | Ga0496124_0507151 | Ga0496124_0507151_434_613 | 59 |
| 333 | 3300048928 | Ga0496125_0104958 | Ga0496125_0104958_1437_1616 | 59 |
| 334 | 3300048929 | Ga0496126_0072520 | Ga0496126_0072520_87_266 | 59 |
| 335 | 3300048929 | Ga0496126_0087634 | Ga0496126_0087634_733_912 | 59 |
| 336 | 3300048929 | Ga0496126_0291012 | Ga0496126_0291012_757_936 | 59 |
| 337 | 3300048929 | Ga0496126_1198702 | Ga0496126_1198702_311_493 | 59 |
| 338 | 3300053083 | Ga0495655_0201406 | Ga0495655_0201406_179_361 | 59 |
| 339 | 3300053084 | Ga0495595_0091768 | Ga0495595_0091768_1068_1247 | 59 |
| 340 | 3300053085 | Ga0495619_0732760 | Ga0495619_0732760_257_436 | 59 |
| 341 | 3300053085 | Ga0495619_1211703 | Ga0495619_1211703_35_214 | 59 |
| 342 | 3300053091 | Ga0500647_0058237 | Ga0500647_0058237_1474_1677 | 59 |
| 343 | 3300053094 | Ga0500566_0002356 | Ga0500566_0002356_3639_3842 | 59 |
| 344 | 3300053095 | Ga0500640_045834 | Ga0500640_045834_1551_1754 | 59 |
| 345 | 3300053097 | Ga0500648_277890 | Ga0500648_277890_119_322 | 59 |
| 346 | 3300053104 | Ga0500556_0202273 | Ga0500556_0202273_433_612 | 59 |
| 347 | 3300053111 | Ga0500572_003525 | Ga0500572_003525_2472_2675 | 59 |
| 348 | 3300053115 | Ga0500591_110324 | Ga0500591_110324_59_262 | 59 |
| 349 | 3300053123 | Ga0500614_007597 | Ga0500614_007597_1841_2044 | 59 |
| 350 | 3300053136 | Ga0500559_0034525 | Ga0500559_0034525_926_1129 | 59 |
| 351 | 3300053136 | Ga0500559_0360938 | Ga0500559_0360938_401_580 | 59 |
| 352 | 3300053139 | Ga0500568_0027565 | Ga0500568_0027565_1286_1465 | 59 |
| 353 | 3300053150 | Ga0500603_008356 | Ga0500603_008356_162_365 | 59 |
| 354 | 3300053159 | Ga0500630_008710 | Ga0500630_008710_1915_2118 | 59 |
| 355 | 3300053162 | Ga0500638_005430 | Ga0500638_005430_3174_3377 | 59 |
| 356 | 3300053163 | Ga0500639_002312 | Ga0500639_002312_3254_3457 | 59 |
| 357 | 3300053177 | Ga0500636_0116518 | Ga0500636_0116518_752_931 | 59 |
| 358 | 3300053725 | Ga0500576_150756 | Ga0500576_150756_582_785 | 59 |
| 359 | 3300053735 | Ga0500596_002233 | Ga0500596_002233_660_863 | 59 |
| 360 | 3300053737 | Ga0500601_010962 | Ga0500601_010962_438_641 | 59 |
| 361 | 3300001989 | JGI24739J22299_10020547 | JGI24739J22299_100205473 | 60 |
| 362 | 3300001990 | JGI24737J22298_10009616 | JGI24737J22298_100096167 | 60 |
| 363 | 3300003215 | JGI25153J46596_10059817 | JGI25153J46596_100598173 | 60 |
| 364 | 3300005344 | Ga0070661_100271222 | Ga0070661_1002712223 | 60 |
| 365 | 3300005347 | Ga0070668_101130424 | Ga0070668_1011304243 | 60 |
| 366 | 3300005366 | Ga0070659_101784772 | Ga0070659_1017847722 | 60 |
| 367 | 3300005436 | Ga0070713_100002594 | Ga0070713_1000025945 | 60 |
| 368 | 3300005455 | Ga0070663_100017501 | Ga0070663_1000175013 | 60 |
| 369 | 3300005467 | Ga0070706_100330359 | Ga0070706_1003303593 | 60 |
| 370 | 3300005468 | Ga0070707_100106096 | Ga0070707_1001060965 | 60 |
| 371 | 3300005471 | Ga0070698_100842729 | Ga0070698_1008427291 | 60 |
| 372 | 3300005536 | Ga0070697_101111451 | Ga0070697_1011114511 | 60 |
| 373 | 3300005539 | Ga0068853_100058719 | Ga0068853_1000587196 | 60 |
| 374 | 3300005563 | Ga0068855_100024639 | Ga0068855_1000246394 | 60 |
| 375 | 3300005564 | Ga0070664_100392479 | Ga0070664_1003924792 | 60 |
| 376 | 3300005577 | Ga0068857_100185123 | Ga0068857_1001851232 | 60 |
| 377 | 3300005578 | Ga0068854_100206793 | Ga0068854_1002067933 | 60 |
| 378 | 3300006028 | Ga0070717_10067381 | Ga0070717_100673815 | 60 |
| 379 | 3300006051 | Ga0075364_10183994 | Ga0075364_101839942 | 60 |
| 380 | 3300006178 | Ga0075367_10206761 | Ga0075367_102067613 | 60 |
| 381 | 3300006178 | Ga0075367_10268677 | Ga0075367_102686773 | 60 |
| 382 | 3300009093 | Ga0105240_10035863 | Ga0105240_100358631 | 60 |
| 383 | 3300009093 | Ga0105240_10402848 | Ga0105240_104028483 | 60 |
| 384 | 3300009148 | Ga0105243_11257933 | Ga0105243_112579333 | 60 |
| 385 | 3300009174 | Ga0105241_10200352 | Ga0105241_102003523 | 60 |
| 386 | 3300009545 | Ga0105237_10009470 | Ga0105237_100094709 | 60 |
| 387 | 3300009551 | Ga0105238_10156359 | Ga0105238_101563595 | 60 |
| 388 | 3300009551 | Ga0105238_10390752 | Ga0105238_103907522 | 60 |
| 389 | 3300009553 | Ga0105249_10251662 | Ga0105249_102516622 | 60 |
| 390 | 3300010375 | Ga0105239_10149385 | Ga0105239_101493854 | 60 |
| 391 | 3300010375 | Ga0105239_12527561 | Ga0105239_125275612 | 60 |
| 392 | 3300011119 | Ga0105246_10805062 | Ga0105246_108050622 | 60 |
| 393 | 3300014325 | Ga0163163_10963761 | Ga0163163_109637612 | 60 |
| 394 | 3300014968 | Ga0157379_10939541 | Ga0157379_109395412 | 60 |
| 395 | 3300025297 | Ga0209758_1004067 | Ga0209758_10040673 | 60 |
| 396 | 3300025904 | Ga0207647_10006000 | Ga0207647_1000600012 | 60 |
| 397 | 3300025906 | Ga0207699_10172022 | Ga0207699_101720222 | 60 |
| 398 | 3300025913 | Ga0207695_10223701 | Ga0207695_102237013 | 60 |
| 399 | 3300025913 | Ga0207695_10883556 | Ga0207695_108835562 | 60 |
| 400 | 3300025920 | Ga0207649_11688191 | Ga0207649_116881912 | 60 |
| 401 | 3300025924 | Ga0207694_10105853 | Ga0207694_101058534 | 60 |
| 402 | 3300025928 | Ga0207700_10003371 | Ga0207700_100033716 | 60 |
| 403 | 3300025929 | Ga0207664_10020128 | Ga0207664_100201285 | 60 |
| 404 | 3300025933 | Ga0207706_10101488 | Ga0207706_101014883 | 60 |
| 405 | 3300025949 | Ga0207667_10867583 | Ga0207667_108675831 | 60 |
| 406 | 3300025961 | Ga0207712_10873808 | Ga0207712_108738083 | 60 |
| 407 | 3300025981 | Ga0207640_10420404 | Ga0207640_104204042 | 60 |
| 408 | 3300026041 | Ga0207639_11961514 | Ga0207639_119615142 | 60 |
| 409 | 3300026067 | Ga0207678_10135485 | Ga0207678_101354854 | 60 |
| 410 | 3300026078 | Ga0207702_10693403 | Ga0207702_106934032 | 60 |
| 411 | 3300026116 | Ga0207674_10006945 | Ga0207674_1000694512 | 60 |
| 412 | 3300026118 | Ga0207675_101843607 | Ga0207675_1018436072 | 60 |
| 413 | 3300026142 | Ga0207698_10139373 | Ga0207698_101393732 | 60 |
| 414 | 3300027866 | Ga0209813_10323648 | Ga0209813_103236482 | 60 |
| 415 | 3300031711 | Ga0265314_10005362 | Ga0265314_100053627 | 60 |
| 416 | 3300048904 | Ga0496101_0800897 | Ga0496101_0800897_456_638 | 60 |
| 417 | 3300048906 | Ga0496103_0782969 | Ga0496103_0782969_251_433 | 60 |
| 418 | 3300048909 | Ga0496106_0469218 | Ga0496106_0469218_729_911 | 60 |
| 419 | 3300048911 | Ga0496108_0226278 | Ga0496108_0226278_1069_1251 | 60 |
| 420 | 3300048913 | Ga0496110_0189253 | Ga0496110_0189253_375_557 | 60 |
| 421 | 3300048917 | Ga0496114_0114398 | Ga0496114_0114398_804_986 | 60 |
| 422 | 3300050491 | nmdc:mga00v17_664988_c1 | nmdc:mga00v17_664988_c1_384_566 | 60 |
| 423 | 3300050492 | nmdc:mga0yw44_285726_c1 | nmdc:mga0yw44_285726_c1_407_589 | 60 |
| 424 | 3300050492 | nmdc:mga0yw44_937617_c1 | nmdc:mga0yw44_937617_c1_260_442 | 60 |
| 425 | 3300050494 | nmdc:mga06z11_30105_c1 | nmdc:mga06z11_30105_c1_584_769 | 60 |
| 426 | 3300050494 | nmdc:mga06z11_96577_c1 | nmdc:mga06z11_96577_c1_540_746 | 60 |
| 427 | 3300050495 | nmdc:mga04h51_356935_c1 | nmdc:mga04h51_356935_c1_17_202 | 60 |
| 428 | 3300005347 | Ga0070668_101829452 | Ga0070668_1018294521 | 61 |
| 429 | 3300005434 | Ga0070709_10097254 | Ga0070709_100972543 | 61 |
| 430 | 3300005435 | Ga0070714_100507205 | Ga0070714_1005072052 | 61 |
| 431 | 3300005436 | Ga0070713_100111204 | Ga0070713_1001112043 | 61 |
| 432 | 3300005437 | Ga0070710_10043834 | Ga0070710_100438343 | 61 |
| 433 | 3300005543 | Ga0070672_100025342 | Ga0070672_1000253421 | 61 |
| 434 | 3300006163 | Ga0070715_10094890 | Ga0070715_100948901 | 61 |
| 435 | 3300006173 | Ga0070716_100117844 | Ga0070716_1001178443 | 61 |
| 436 | 3300006175 | Ga0070712_100009607 | Ga0070712_1000096074 | 61 |
| 437 | 3300025898 | Ga0207692_10129017 | Ga0207692_101290171 | 61 |
| 438 | 3300025905 | Ga0207685_10027964 | Ga0207685_100279643 | 61 |
| 439 | 3300025906 | Ga0207699_10018080 | Ga0207699_100180803 | 61 |
| 440 | 3300025915 | Ga0207693_10015799 | Ga0207693_100157995 | 61 |
| 441 | 3300025916 | Ga0207663_10300981 | Ga0207663_103009813 | 61 |
| 442 | 3300025929 | Ga0207664_10146209 | Ga0207664_101462092 | 61 |
| 443 | 3300025934 | Ga0207686_11329049 | Ga0207686_113290491 | 61 |
| 444 | 3300025939 | Ga0207665_10033272 | Ga0207665_100332721 | 61 |
| 445 | 3300041453 | Ga0451797_0927315 | Ga0451797_0927315_424_609 | 61 |
| 446 | 3300041512 | Ga0451853_1829236 | Ga0451853_1829236_76_261 | 61 |
| 447 | 3300046460 | Ga0495638_0206863 | Ga0495638_0206863_425_610 | 61 |
| 448 | 3300046514 | Ga0495618_0468346 | Ga0495618_0468346_437_622 | 61 |
| 449 | 3300046517 | Ga0495630_1082726 | Ga0495630_1082726_99_284 | 61 |
| 450 | 3300046529 | Ga0495652_0519930 | Ga0495652_0519930_254_439 | 61 |
| 451 | 3300047317 | Ga0495604_0336399 | Ga0495604_0336399_357_542 | 61 |
| 452 | 3300047319 | Ga0495674_0693374 | Ga0495674_0693374_282_467 | 61 |
| 453 | 3300048924 | Ga0496121_0258443 | Ga0496121_0258443_116_301 | 61 |
| 454 | 3300048929 | Ga0496126_0880732 | Ga0496126_0880732_457_642 | 61 |
| 455 | 3300053119 | Ga0500595_124352 | Ga0500595_124352_61_246 | 61 |
| 456 | 3300053178 | Ga0500637_0020670 | Ga0500637_0020670_1772_1975 | 61 |
| 457 | 3300005356 | Ga0070674_101619814 | Ga0070674_1016198142 | 62 |
| 458 | 3300005455 | Ga0070663_101588143 | Ga0070663_1015881431 | 62 |
| 459 | 3300005548 | Ga0070665_101452953 | Ga0070665_1014529532 | 62 |
| 460 | 3300005548 | Ga0070665_101880714 | Ga0070665_1018807142 | 62 |
| 461 | 3300005617 | Ga0068859_102089109 | Ga0068859_1020891092 | 62 |
| 462 | 3300005842 | Ga0068858_101093175 | Ga0068858_1010931752 | 62 |
| 463 | 3300006931 | Ga0097620_102089854 | Ga0097620_1020898541 | 62 |
| 464 | 3300007788 | Ga0099795_10027813 | Ga0099795_100278133 | 62 |
| 465 | 3300009101 | Ga0105247_10287949 | Ga0105247_102879492 | 62 |
| 466 | 3300009148 | Ga0105243_10370078 | Ga0105243_103700782 | 62 |
| 467 | 3300009545 | Ga0105237_11723665 | Ga0105237_117236652 | 62 |
| 468 | 3300010159 | Ga0099796_10308289 | Ga0099796_103082892 | 62 |
| 469 | 3300013296 | Ga0157374_10460966 | Ga0157374_104609662 | 62 |
| 470 | 3300014326 | Ga0157380_13161504 | Ga0157380_131615041 | 62 |
| 471 | 3300017792 | Ga0163161_11457037 | Ga0163161_114570372 | 62 |
| 472 | 3300025315 | Ga0207697_10007283 | Ga0207697_100072831 | 62 |
| 473 | 3300025904 | Ga0207647_10156001 | Ga0207647_101560015 | 62 |
| 474 | 3300025913 | Ga0207695_10299191 | Ga0207695_102991911 | 62 |
| 475 | 3300025914 | Ga0207671_10776972 | Ga0207671_107769722 | 62 |
| 476 | 3300025914 | Ga0207671_11437910 | Ga0207671_114379101 | 62 |
| 477 | 3300025935 | Ga0207709_11047440 | Ga0207709_110474401 | 62 |
| 478 | 3300025937 | Ga0207669_11622139 | Ga0207669_116221392 | 62 |
| 479 | 3300026035 | Ga0207703_10371248 | Ga0207703_103712481 | 62 |
| 480 | 3300026041 | Ga0207639_10702688 | Ga0207639_107026882 | 62 |
| 481 | 3300027512 | Ga0209179_1093384 | Ga0209179_10933842 | 62 |
| 482 | 3300028786 | Ga0307517_10000483 | Ga0307517_1000048345 | 62 |
| 483 | 3300028786 | Ga0307517_10544396 | Ga0307517_105443962 | 62 |
| 484 | 3300028794 | Ga0307515_10035400 | Ga0307515_100354009 | 62 |
| 485 | 3300028794 | Ga0307515_10867000 | Ga0307515_108670002 | 62 |
| 486 | 3300031456 | Ga0307513_10211720 | Ga0307513_102117204 | 62 |
| 487 | 3300031548 | Ga0307408_100433661 | Ga0307408_1004336613 | 62 |
| 488 | 3300031616 | Ga0307508_10179322 | Ga0307508_101793222 | 62 |
| 489 | 3300031730 | Ga0307516_10620178 | Ga0307516_106201783 | 62 |
| 490 | 3300031731 | Ga0307405_10710768 | Ga0307405_107107682 | 62 |
| 491 | 3300031824 | Ga0307413_10679583 | Ga0307413_106795832 | 62 |
| 492 | 3300031911 | Ga0307412_10635582 | Ga0307412_106355821 | 62 |
| 493 | 3300032002 | Ga0307416_100340528 | Ga0307416_1003405284 | 62 |
| 494 | 3300032005 | Ga0307411_10409545 | Ga0307411_104095453 | 62 |
| 495 | 3300032005 | Ga0307411_10523279 | Ga0307411_105232792 | 62 |
| 496 | 3300046455 | Ga0495603_0203838 | Ga0495603_0203838_694_882 | 62 |
| 497 | 3300046518 | Ga0495631_0200633 | Ga0495631_0200633_368_556 | 62 |
| 498 | 3300046519 | Ga0495632_0146203 | Ga0495632_0146203_808_996 | 62 |
| 499 | 3300046538 | Ga0495609_0140149 | Ga0495609_0140149_254_442 | 62 |
| 500 | 3300046616 | Ga0495668_0063371 | Ga0495668_0063371_803_991 | 62 |
| 501 | 3300046660 | Ga0495625_0281457 | Ga0495625_0281457_607_795 | 62 |
| 502 | 3300046684 | Ga0495669_0144623 | Ga0495669_0144623_454_642 | 62 |
| 503 | 3300047320 | Ga0495672_0051539 | Ga0495672_0051539_1800_1988 | 62 |
| 504 | 3300047323 | Ga0495683_0457694 | Ga0495683_0457694_203_391 | 62 |
| 505 | 3300048906 | Ga0496103_0682323 | Ga0496103_0682323_46_237 | 62 |
| 506 | 3300048908 | Ga0496105_0624893 | Ga0496105_0624893_533_724 | 62 |
| 507 | 3300048913 | Ga0496110_0753317 | Ga0496110_0753317_403_594 | 62 |
| 508 | 3300048915 | Ga0496112_0324303 | Ga0496112_0324303_1103_1294 | 62 |
| 509 | 3300048918 | Ga0496115_0418620 | Ga0496115_0418620_125_319 | 62 |
| 510 | 3300048929 | Ga0496126_0664367 | Ga0496126_0664367_456_644 | 62 |
| 511 | 3300050496 | nmdc:mga07m45_680025_c1 | nmdc:mga07m45_680025_c1_266_454 | 62 |
| 512 | 3300053727 | Ga0500611_044358 | Ga0500611_044358_473_661 | 62 |
| 513 | 3300001904 | JGI24736J21556_1031737 | JGI24736J21556_10317371 | 63 |
| 514 | 3300001989 | JGI24739J22299_10000994 | JGI24739J22299_100009949 | 63 |
| 515 | 3300001990 | JGI24737J22298_10002808 | JGI24737J22298_100028084 | 63 |
| 516 | 3300002067 | JGI24735J21928_10006210 | JGI24735J21928_100062104 | 63 |
| 517 | 3300005333 | Ga0070677_10507936 | Ga0070677_105079361 | 63 |
| 518 | 3300005338 | Ga0068868_101963200 | Ga0068868_1019632002 | 63 |
| 519 | 3300005339 | Ga0070660_100256463 | Ga0070660_1002564633 | 63 |
| 520 | 3300005339 | Ga0070660_101547230 | Ga0070660_1015472302 | 63 |
| 521 | 3300005354 | Ga0070675_100602962 | Ga0070675_1006029622 | 63 |
| 522 | 3300005434 | Ga0070709_10003383 | Ga0070709_100033838 | 63 |
| 523 | 3300005437 | Ga0070710_10005449 | Ga0070710_100054493 | 63 |
| 524 | 3300005439 | Ga0070711_100023046 | Ga0070711_1000230463 | 63 |
| 525 | 3300005455 | Ga0070663_101365250 | Ga0070663_1013652501 | 63 |
| 526 | 3300005456 | Ga0070678_100079467 | Ga0070678_1000794673 | 63 |
| 527 | 3300005457 | Ga0070662_100075193 | Ga0070662_1000751932 | 63 |
| 528 | 3300005458 | Ga0070681_10057793 | Ga0070681_100577933 | 63 |
| 529 | 3300005530 | Ga0070679_100004045 | Ga0070679_1000040453 | 63 |
| 530 | 3300005535 | Ga0070684_100684088 | Ga0070684_1006840881 | 63 |
| 531 | 3300005536 | Ga0070697_100424487 | Ga0070697_1004244873 | 63 |
| 532 | 3300005539 | Ga0068853_100044352 | Ga0068853_1000443524 | 63 |
| 533 | 3300005539 | Ga0068853_100078277 | Ga0068853_1000782773 | 63 |
| 534 | 3300005543 | Ga0070672_100448674 | Ga0070672_1004486741 | 63 |
| 535 | 3300005563 | Ga0068855_100020255 | Ga0068855_1000202558 | 63 |
| 536 | 3300005563 | Ga0068855_100020651 | Ga0068855_1000206513 | 63 |
| 537 | 3300005577 | Ga0068857_100010911 | Ga0068857_1000109117 | 63 |
| 538 | 3300005578 | Ga0068854_100057575 | Ga0068854_1000575753 | 63 |
| 539 | 3300005614 | Ga0068856_100013826 | Ga0068856_1000138267 | 63 |
| 540 | 3300005615 | Ga0070702_100370414 | Ga0070702_1003704143 | 63 |
| 541 | 3300005616 | Ga0068852_100275230 | Ga0068852_1002752303 | 63 |
| 542 | 3300005834 | Ga0068851_10242155 | Ga0068851_102421553 | 63 |
| 543 | 3300006028 | Ga0070717_10392678 | Ga0070717_103926783 | 63 |
| 544 | 3300006038 | Ga0075365_11322186 | Ga0075365_113221862 | 63 |
| 545 | 3300006163 | Ga0070715_10003754 | Ga0070715_100037544 | 63 |
| 546 | 3300006173 | Ga0070716_100055242 | Ga0070716_1000552424 | 63 |
| 547 | 3300006175 | Ga0070712_100039813 | Ga0070712_1000398133 | 63 |
| 548 | 3300006237 | Ga0097621_100225663 | Ga0097621_1002256632 | 63 |
| 549 | 3300007265 | Ga0099794_10671529 | Ga0099794_106715292 | 63 |
| 550 | 3300007788 | Ga0099795_10654860 | Ga0099795_106548602 | 63 |
| 551 | 3300009093 | Ga0105240_10031140 | Ga0105240_100311406 | 63 |
| 552 | 3300009093 | Ga0105240_10398156 | Ga0105240_103981563 | 63 |
| 553 | 3300009174 | Ga0105241_11601032 | Ga0105241_116010322 | 63 |
| 554 | 3300009545 | Ga0105237_10123402 | Ga0105237_101234024 | 63 |
| 555 | 3300009545 | Ga0105237_10275301 | Ga0105237_102753013 | 63 |
| 556 | 3300009551 | Ga0105238_10017548 | Ga0105238_100175487 | 63 |
| 557 | 3300010375 | Ga0105239_10027064 | Ga0105239_100270647 | 63 |
| 558 | 3300011119 | Ga0105246_12329422 | Ga0105246_123294222 | 63 |
| 559 | 3300013308 | Ga0157375_12882046 | Ga0157375_128820462 | 63 |
| 560 | 3300014325 | Ga0163163_11128721 | Ga0163163_111287211 | 63 |
| 561 | 3300014325 | Ga0163163_12214358 | Ga0163163_122143581 | 63 |
| 562 | 3300014497 | Ga0182008_10110458 | Ga0182008_101104584 | 63 |
| 563 | 3300025321 | Ga0207656_10216650 | Ga0207656_102166501 | 63 |
| 564 | 3300025898 | Ga0207692_10032424 | Ga0207692_100324243 | 63 |
| 565 | 3300025901 | Ga0207688_10149914 | Ga0207688_101499141 | 63 |
| 566 | 3300025904 | Ga0207647_10022741 | Ga0207647_100227414 | 63 |
| 567 | 3300025906 | Ga0207699_10030363 | Ga0207699_100303633 | 63 |
| 568 | 3300025911 | Ga0207654_10876709 | Ga0207654_108767092 | 63 |
| 569 | 3300025912 | Ga0207707_10051455 | Ga0207707_100514553 | 63 |
| 570 | 3300025913 | Ga0207695_10047109 | Ga0207695_100471093 | 63 |
| 571 | 3300025913 | Ga0207695_10252428 | Ga0207695_102524283 | 63 |
| 572 | 3300025914 | Ga0207671_10126647 | Ga0207671_101266472 | 63 |
| 573 | 3300025914 | Ga0207671_10723876 | Ga0207671_107238763 | 63 |
| 574 | 3300025916 | Ga0207663_10212756 | Ga0207663_102127563 | 63 |
| 575 | 3300025917 | Ga0207660_10053074 | Ga0207660_100530744 | 63 |
| 576 | 3300025919 | Ga0207657_11238234 | Ga0207657_112382342 | 63 |
| 577 | 3300025921 | Ga0207652_10145273 | Ga0207652_101452733 | 63 |
| 578 | 3300025924 | Ga0207694_10118535 | Ga0207694_101185351 | 63 |
| 579 | 3300025926 | Ga0207659_10724391 | Ga0207659_107243913 | 63 |
| 580 | 3300025928 | Ga0207700_10090527 | Ga0207700_100905273 | 63 |
| 581 | 3300025933 | Ga0207706_10229253 | Ga0207706_102292532 | 63 |
| 582 | 3300025937 | Ga0207669_10419467 | Ga0207669_104194673 | 63 |
| 583 | 3300025937 | Ga0207669_11132619 | Ga0207669_111326192 | 63 |
| 584 | 3300025949 | Ga0207667_10023959 | Ga0207667_100239598 | 63 |
| 585 | 3300025949 | Ga0207667_10044250 | Ga0207667_100442503 | 63 |
| 586 | 3300025949 | Ga0207667_10878231 | Ga0207667_108782311 | 63 |
| 587 | 3300025981 | Ga0207640_10015094 | Ga0207640_100150948 | 63 |
| 588 | 3300025986 | Ga0207658_10807077 | Ga0207658_108070772 | 63 |
| 589 | 3300026041 | Ga0207639_10088708 | Ga0207639_100887083 | 63 |
| 590 | 3300026041 | Ga0207639_10134662 | Ga0207639_101346624 | 63 |
| 591 | 3300026067 | Ga0207678_10535077 | Ga0207678_105350772 | 63 |
| 592 | 3300026078 | Ga0207702_10026782 | Ga0207702_100267824 | 63 |
| 593 | 3300026116 | Ga0207674_10017516 | Ga0207674_100175167 | 63 |
| 594 | 3300026121 | Ga0207683_10351773 | Ga0207683_103517732 | 63 |
| 595 | 3300026142 | Ga0207698_10885328 | Ga0207698_108853283 | 63 |
| 596 | 3300028379 | Ga0268266_11795174 | Ga0268266_117951742 | 63 |
| 597 | 3300028573 | Ga0265334_10066879 | Ga0265334_100668793 | 63 |
| 598 | 3300031235 | Ga0265330_10003310 | Ga0265330_100033104 | 63 |
| 599 | 3300031235 | Ga0265330_10020070 | Ga0265330_100200706 | 63 |
| 600 | 3300031235 | Ga0265330_10056010 | Ga0265330_100560103 | 63 |
| 601 | 3300031235 | Ga0265330_10173653 | Ga0265330_101736532 | 63 |
| 602 | 3300031238 | Ga0265332_10329663 | Ga0265332_103296631 | 63 |
| 603 | 3300031241 | Ga0265325_10066080 | Ga0265325_100660804 | 63 |
| 604 | 3300031247 | Ga0265340_10000504 | Ga0265340_100005046 | 63 |
| 605 | 3300031247 | Ga0265340_10044772 | Ga0265340_100447722 | 63 |
| 606 | 3300031250 | Ga0265331_10289362 | Ga0265331_102893622 | 63 |
| 607 | 3300031344 | Ga0265316_10134732 | Ga0265316_101347324 | 63 |
| 608 | 3300031344 | Ga0265316_10324436 | Ga0265316_103244363 | 63 |
| 609 | 3300031595 | Ga0265313_10053565 | Ga0265313_100535652 | 63 |
| 610 | 3300031712 | Ga0265342_10087734 | Ga0265342_100877344 | 63 |
| 611 | 3300031712 | Ga0265342_10160817 | Ga0265342_101608174 | 63 |
| 612 | 3300031730 | Ga0307516_10195303 | Ga0307516_101953032 | 63 |
| 613 | 3300031730 | Ga0307516_10990182 | Ga0307516_109901822 | 63 |
| 614 | 3300032126 | Ga0307415_102017136 | Ga0307415_1020171362 | 63 |
| 615 | 3300035086 | Ga0373934_0018773 | Ga0373934_0018773_1876_2070 | 63 |
| 616 | 3300035111 | Ga0373923_0026612 | Ga0373923_0026612_1117_1311 | 63 |
| 617 | 3300035117 | Ga0373953_0036598 | Ga0373953_0036598_1357_1551 | 63 |
| 618 | 3300035118 | Ga0373954_0000167 | Ga0373954_0000167_21199_21393 | 63 |
| 619 | 3300035119 | Ga0373956_0008200 | Ga0373956_0008200_3071_3265 | 63 |
| 620 | 3300035120 | Ga0373957_0010346 | Ga0373957_0010346_2527_2721 | 63 |
| 621 | 3300035172 | Ga0373955_0036864 | Ga0373955_0036864_2228_2422 | 63 |
| 622 | 3300035724 | Ga0373933_0167420 | Ga0373933_0167420_421_615 | 63 |
| 623 | 3300036401 | Ga0373937_0109431 | Ga0373937_0109431_554_748 | 63 |
| 624 | 3300041509 | Ga0451843_1558469 | Ga0451843_1558469_19_210 | 63 |
| 625 | 3300046454 | Ga0495592_0098584 | Ga0495592_0098584_687_881 | 63 |
| 626 | 3300046454 | Ga0495592_0347980 | Ga0495592_0347980_405_596 | 63 |
| 627 | 3300046459 | Ga0495629_0007517 | Ga0495629_0007517_4640_4834 | 63 |
| 628 | 3300046462 | Ga0495651_0070399 | Ga0495651_0070399_225_419 | 63 |
| 629 | 3300046462 | Ga0495651_0237577 | Ga0495651_0237577_78_272 | 63 |
| 630 | 3300046462 | Ga0495651_0396542 | Ga0495651_0396542_49_240 | 63 |
| 631 | 3300046463 | Ga0495653_0046964 | Ga0495653_0046964_1562_1756 | 63 |
| 632 | 3300046511 | Ga0495608_0020550 | Ga0495608_0020550_1374_1568 | 63 |
| 633 | 3300046514 | Ga0495618_0099410 | Ga0495618_0099410_1513_1707 | 63 |
| 634 | 3300046516 | Ga0495628_0075427 | Ga0495628_0075427_759_953 | 63 |
| 635 | 3300046516 | Ga0495628_0948014 | Ga0495628_0948014_97_288 | 63 |
| 636 | 3300046529 | Ga0495652_1108562 | Ga0495652_1108562_168_362 | 63 |
| 637 | 3300046533 | Ga0495640_0806888 | Ga0495640_0806888_95_289 | 63 |
| 638 | 3300046536 | Ga0495587_0091601 | Ga0495587_0091601_1178_1372 | 63 |
| 639 | 3300046536 | Ga0495587_0746320 | Ga0495587_0746320_70_264 | 63 |
| 640 | 3300046543 | Ga0495645_0010229 | Ga0495645_0010229_5157_5351 | 63 |
| 641 | 3300046559 | Ga0495667_0526317 | Ga0495667_0526317_125_319 | 63 |
| 642 | 3300046616 | Ga0495668_0208938 | Ga0495668_0208938_338_529 | 63 |
| 643 | 3300046642 | Ga0495634_0014308 | Ga0495634_0014308_5382_5576 | 63 |
| 644 | 3300046660 | Ga0495625_0455891 | Ga0495625_0455891_348_539 | 63 |
| 645 | 3300046663 | Ga0495635_0003274 | Ga0495635_0003274_9245_9439 | 63 |
| 646 | 3300046675 | Ga0495657_0080130 | Ga0495657_0080130_179_373 | 63 |
| 647 | 3300046678 | Ga0495599_0151751 | Ga0495599_0151751_272_466 | 63 |
| 648 | 3300046679 | Ga0495623_0030686 | Ga0495623_0030686_421_615 | 63 |
| 649 | 3300046680 | Ga0495646_0056840 | Ga0495646_0056840_1720_1914 | 63 |
| 650 | 3300046689 | Ga0495613_0485165 | Ga0495613_0485165_100_294 | 63 |
| 651 | 3300046809 | Ga0495600_0277534 | Ga0495600_0277534_235_426 | 63 |
| 652 | 3300046809 | Ga0495600_0408815 | Ga0495600_0408815_271_465 | 63 |
| 653 | 3300047317 | Ga0495604_0443849 | Ga0495604_0443849_554_748 | 63 |
| 654 | 3300047319 | Ga0495674_0059246 | Ga0495674_0059246_1827_2021 | 63 |
| 655 | 3300047322 | Ga0495680_0628819 | Ga0495680_0628819_384_578 | 63 |
| 656 | 3300047444 | Ga0495675_0336293 | Ga0495675_0336293_421_615 | 63 |
| 657 | 3300047444 | Ga0495675_0812056 | Ga0495675_0812056_115_309 | 63 |
| 658 | 3300047471 | Ga0495684_0004169 | Ga0495684_0004169_10520_10714 | 63 |
| 659 | 3300047673 | Ga0495593_0000677 | Ga0495593_0000677_4324_4518 | 63 |
| 660 | 3300048088 | Ga0495602_0165923 | Ga0495602_0165923_515_709 | 63 |
| 661 | 3300048913 | Ga0496110_0326242 | Ga0496110_0326242_430_624 | 63 |
| 662 | 3300048915 | Ga0496112_0166716 | Ga0496112_0166716_288_482 | 63 |
| 663 | 3300048918 | Ga0496115_0300779 | Ga0496115_0300779_64_258 | 63 |
| 664 | 3300048922 | Ga0496119_0167090 | Ga0496119_0167090_564_755 | 63 |
| 665 | 3300048924 | Ga0496121_0823307 | Ga0496121_0823307_152_343 | 63 |
| 666 | 3300053077 | Ga0495601_0108481 | Ga0495601_0108481_599_793 | 63 |
| 667 | 3300053078 | Ga0495612_0390829 | Ga0495612_0390829_63_257 | 63 |
| 668 | 3300053084 | Ga0495595_0002075 | Ga0495595_0002075_5168_5362 | 63 |
| 669 | 3300053084 | Ga0495595_0211033 | Ga0495595_0211033_41_232 | 63 |
| 670 | 3300053085 | Ga0495619_0224410 | Ga0495619_0224410_687_881 | 63 |
| 671 | 3300053155 | Ga0500620_075241 | Ga0500620_075241_686_877 | 63 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gqo-assembly1.cif.gz_A | solution nmr structure of vaccinia virus protein a28: an entry-fusion complex component | 0.5661 | 2 | 49 |
| 7aoi-assembly1.cif.gz_AY | trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate | 0.5496 | 1 | 40 |
| 6tgv-assembly1.cif.gz_A-3 | crystal structure of mycobacterium smegmatis coabc in complex with ctp and fmn | 0.5465 | 24 | 50 |
| 5xfa-assembly2.cif.gz_H | crystal structure of nad+-reducing [nife]-hydrogenase in the h2-reduced state | 0.5395 | 1 | 38 |
| 5int-assembly1.cif.gz_A | crystal structure of the c-terminal domain of coenzyme a biosynthesis bifunctional protein coabc | 0.5346 | 21 | 50 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8QCJ3_2_77_2.60.40.60 | Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins | 0.6495 | 22 | 39 | 2.60.40.60 |
| af_Q4W5T0_135_269_3.30.980.10 | Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 | 0.6241 | 2 | 38 | 3.30.980.10 |
| 1nrwA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.6152 | 12 | 50 | 3.40.50.1000 |
| 3fkfD00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.5461 | 9 | 51 | 3.40.30.10 |
| af_G5ECV3_236_352_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.5406 | 9 | 50 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537L3Y8-F1-model_v4 | Uncharacterized protein | 1.002 | 1 | 50 |
|
| AF-A0A2V5XVS4-F1-model_v4 | Uncharacterized protein | 0.9567 | 1 | 58 |
|
| AF-A0A7Z0TRP6-F1-model_v4 | DUF2188 domain-containing protein | 0.9465 | 1 | 58 |
|
| AF-A0A6N6ZMF4-F1-model_v4 | deleted | 0.9431 | 2 | 50 |
|
| AF-A0A537PXX7-F1-model_v4 | Uncharacterized protein | 0.9424 | 1 | 61 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar