F474169
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 671 | 290 | 671 | 390 |
Family's Representative Sequence
| Representative Sequence | 3300031251|Ga0265327_10005655|Ga0265327_100056553 |
| Length | 430 |
| Sequence | MSKGMKYGILAVVVMAIGGVVAVTMQKNNNKSTEVRIESVEKRDLVSSVTASGQVRPHTKVDLSSDISGKIVKLSVKEGDYVKQGQFLLQIDPLTYESAVQQAEAQLSNQKAAQAQTQANLVQAQNNYRRSLEIRQSNPNLVAADQLEQLKTAVEVNTAMLEAAKHNVEQAQASVKTQKLNLDKTTIYAPMAGRVTRLVVENGETAVPGTFNKDAATLLTISDMSVLETKVKVDETDVSRIHLGDSTIVQLDAFPDTTFIGKVVEISNSSVKGTTTSTGDQAIDYEVTVRLLNPPKDTKPDFSATAKIITDSRTKVLSIPIIALTVRENEALASADTAQRPGAKQQNAKQVGKKDVEGVFVVGTDNKVTFKPVKVGIAGEKHFEVLSGLKEGDKIVAGTYQAIRELKDGTLVREAKQPDKKPGTPGSTKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 211 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.89 |
| Rhizosphere | 98.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1004512 | 3300000549 | Bacteria | 1808 |
| 2 | Ga0065712_10090873 | 3300005290 | Bacteria | 2400 |
| 3 | Ga0065712_10118316 | 3300005290 | Bacteria | 1708 |
| 4 | Ga0065712_10121264 | 3300005290 | Bacteria | 1667 |
| 5 | Ga0065715_10002581 | 3300005293 | Bacteria | 6107 |
| 6 | Ga0065707_10083638 | 3300005295 | Bacteria | 8568 |
| 7 | Ga0065707_10110315 | 3300005295 | Bacteria | 2435 |
| 8 | Ga0065707_10149842 | 3300005295 | Unclassified | 1671 |
| 9 | Ga0070658_10001116 | 3300005327 | Bacteria | 22923 |
| 10 | Ga0070658_10001610 | 3300005327 | Bacteria | 19101 |
| 11 | Ga0070658_10003927 | 3300005327 | Bacteria | 12192 |
| 12 | Ga0070658_10009239 | 3300005327 | Bacteria | 7925 |
| 13 | Ga0070676_10006200 | 3300005328 | Bacteria | 6385 |
| 14 | Ga0070676_10069492 | 3300005328 | Bacteria | 2111 |
| 15 | Ga0070676_10084717 | 3300005328 | Bacteria | 1930 |
| 16 | Ga0070683_100000591 | 3300005329 | Bacteria | 25943 |
| 17 | Ga0070683_100001864 | 3300005329 | Bacteria | 16460 |
| 18 | Ga0070683_100003631 | 3300005329 | Bacteria | 12573 |
| 19 | Ga0070683_100017066 | 3300005329 | Bacteria | 6408 |
| 20 | Ga0070683_100022900 | 3300005329 | Bacteria | 5585 |
| 21 | Ga0070683_100023285 | 3300005329 | Bacteria | 5539 |
| 22 | Ga0070683_100027246 | 3300005329 | Bacteria | 5152 |
| 23 | Ga0070683_100162718 | 3300005329 | Bacteria | 2117 |
| 24 | Ga0070670_100011628 | 3300005331 | Bacteria | 7527 |
| 25 | Ga0070670_100017014 | 3300005331 | Bacteria | 6240 |
| 26 | Ga0070670_100024459 | 3300005331 | Bacteria | 5193 |
| 27 | Ga0070670_100106425 | 3300005331 | Bacteria | 2417 |
| 28 | Ga0070677_10046335 | 3300005333 | Bacteria | 1738 |
| 29 | Ga0068869_100014965 | 3300005334 | Bacteria | 5188 |
| 30 | Ga0070666_10113029 | 3300005335 | Unclassified | 1879 |
| 31 | Ga0070666_10193435 | 3300005335 | Bacteria | 1430 |
| 32 | Ga0070680_100000354 | 3300005336 | Bacteria | 30834 |
| 33 | Ga0070680_100000936 | 3300005336 | Bacteria | 20644 |
| 34 | Ga0070680_100005427 | 3300005336 | Bacteria | 9656 |
| 35 | Ga0070680_100035186 | 3300005336 | Bacteria | 4042 |
| 36 | Ga0070680_100076451 | 3300005336 | Bacteria | 2756 |
| 37 | Ga0070680_100122335 | 3300005336 | Bacteria | 2173 |
| 38 | Ga0070682_100000603 | 3300005337 | Bacteria | 21874 |
| 39 | Ga0070682_100001339 | 3300005337 | Bacteria | 13916 |
| 40 | Ga0070682_100001650 | 3300005337 | Bacteria | 12403 |
| 41 | Ga0068868_100007265 | 3300005338 | Bacteria | 7880 |
| 42 | Ga0070660_100023520 | 3300005339 | Bacteria | 4564 |
| 43 | Ga0070660_100024997 | 3300005339 | Bacteria | 4436 |
| 44 | Ga0070660_100185224 | 3300005339 | Unclassified | 1685 |
| 45 | Ga0070689_100000673 | 3300005340 | Bacteria | 20688 |
| 46 | Ga0070689_100045006 | 3300005340 | Bacteria | 3397 |
| 47 | Ga0070689_100056709 | 3300005340 | Bacteria | 3038 |
| 48 | Ga0070687_100026118 | 3300005343 | Bacteria | 2809 |
| 49 | Ga0070661_100001410 | 3300005344 | Bacteria | 16773 |
| 50 | Ga0070661_100059075 | 3300005344 | Bacteria | 2811 |
| 51 | Ga0070661_100129498 | 3300005344 | Bacteria | 1894 |
| 52 | Ga0070692_10014594 | 3300005345 | Bacteria | 3695 |
| 53 | Ga0070692_10032194 | 3300005345 | Bacteria | 2635 |
| 54 | Ga0070668_100035536 | 3300005347 | Bacteria | 3800 |
| 55 | Ga0070668_100185610 | 3300005347 | Bacteria | 1701 |
| 56 | Ga0070669_100009719 | 3300005353 | Bacteria | 6852 |
| 57 | Ga0070669_100014947 | 3300005353 | Bacteria | 5531 |
| 58 | Ga0070669_100061493 | 3300005353 | Bacteria | 2760 |
| 59 | Ga0070675_100007252 | 3300005354 | Bacteria | 8552 |
| 60 | Ga0070675_100030544 | 3300005354 | Bacteria | 4350 |
| 61 | Ga0070675_100046839 | 3300005354 | Bacteria | 3542 |
| 62 | Ga0070675_100098687 | 3300005354 | Bacteria | 2457 |
| 63 | Ga0070671_100062509 | 3300005355 | Bacteria | 3100 |
| 64 | Ga0070671_100139835 | 3300005355 | Bacteria | 2043 |
| 65 | Ga0070674_100027116 | 3300005356 | Bacteria | 3751 |
| 66 | Ga0070674_100194195 | 3300005356 | Bacteria | 1563 |
| 67 | Ga0070673_100055404 | 3300005364 | Bacteria | 3124 |
| 68 | Ga0070688_100005942 | 3300005365 | Bacteria | 6467 |
| 69 | Ga0070688_100010144 | 3300005365 | Bacteria | 5182 |
| 70 | Ga0070659_100005487 | 3300005366 | Bacteria | 9113 |
| 71 | Ga0070659_100011079 | 3300005366 | Bacteria | 6661 |
| 72 | Ga0070667_100055906 | 3300005367 | Bacteria | 3333 |
| 73 | Ga0070667_100062461 | 3300005367 | Bacteria | 3155 |
| 74 | Ga0070667_100200725 | 3300005367 | Bacteria | 1770 |
| 75 | Ga0070667_100270132 | 3300005367 | Bacteria | 1524 |
| 76 | Ga0070709_10003594 | 3300005434 | Bacteria | 8328 |
| 77 | Ga0070709_10081114 | 3300005434 | Bacteria | 2116 |
| 78 | Ga0070714_100004689 | 3300005435 | Bacteria | 10333 |
| 79 | Ga0070714_100044819 | 3300005435 | Bacteria | 3745 |
| 80 | Ga0070713_100004613 | 3300005436 | Bacteria | 9292 |
| 81 | Ga0070710_10128664 | 3300005437 | Bacteria | 1541 |
| 82 | Ga0070701_10004493 | 3300005438 | Bacteria | 5660 |
| 83 | Ga0070700_100011573 | 3300005441 | Bacteria | 4890 |
| 84 | Ga0070700_100017080 | 3300005441 | Bacteria | 4143 |
| 85 | Ga0070700_100019789 | 3300005441 | Bacteria | 3890 |
| 86 | Ga0070700_100081208 | 3300005441 | Bacteria | 2094 |
| 87 | Ga0070694_100190379 | 3300005444 | Unclassified | 1523 |
| 88 | Ga0070708_100000006 | 3300005445 | Bacteria | 150596 |
| 89 | Ga0070708_100000557 | 3300005445 | Bacteria | 27909 |
| 90 | Ga0070662_100010334 | 3300005457 | Bacteria | 6119 |
| 91 | Ga0070662_100019195 | 3300005457 | Bacteria | 4638 |
| 92 | Ga0070681_10001240 | 3300005458 | Bacteria | 22205 |
| 93 | Ga0070681_10001953 | 3300005458 | Bacteria | 18621 |
| 94 | Ga0070681_10003137 | 3300005458 | Bacteria | 15352 |
| 95 | Ga0070681_10006631 | 3300005458 | Bacteria | 11274 |
| 96 | Ga0070681_10006664 | 3300005458 | Bacteria | 11240 |
| 97 | Ga0070681_10007450 | 3300005458 | Bacteria | 10696 |
| 98 | Ga0070681_10034647 | 3300005458 | Bacteria | 5070 |
| 99 | Ga0070681_10055099 | 3300005458 | Bacteria | 3961 |
| 100 | Ga0070681_10290222 | 3300005458 | Bacteria | 1546 |
| 101 | Ga0068867_100018001 | 3300005459 | Bacteria | 5020 |
| 102 | Ga0068867_100059685 | 3300005459 | Bacteria | 2827 |
| 103 | Ga0068867_100118367 | 3300005459 | Bacteria | 2043 |
| 104 | Ga0070685_10026695 | 3300005466 | Bacteria | 3185 |
| 105 | Ga0070707_100011264 | 3300005468 | Bacteria | 8336 |
| 106 | Ga0070707_100033032 | 3300005468 | Bacteria | 4932 |
| 107 | Ga0070698_100003289 | 3300005471 | Bacteria | 17769 |
| 108 | Ga0070698_100034805 | 3300005471 | Bacteria | 5211 |
| 109 | Ga0070699_100006387 | 3300005518 | Bacteria | 10270 |
| 110 | Ga0070679_100000377 | 3300005530 | Bacteria | 37955 |
| 111 | Ga0070679_100001015 | 3300005530 | Bacteria | 24474 |
| 112 | Ga0070679_100011373 | 3300005530 | Bacteria | 8478 |
| 113 | Ga0070679_100015185 | 3300005530 | Bacteria | 7399 |
| 114 | Ga0070679_100016129 | 3300005530 | Bacteria | 7198 |
| 115 | Ga0070679_100049893 | 3300005530 | Unclassified | 4168 |
| 116 | Ga0070679_100071411 | 3300005530 | Bacteria | 3463 |
| 117 | Ga0070679_100090680 | 3300005530 | Bacteria | 3045 |
| 118 | Ga0070679_100091733 | 3300005530 | Bacteria | 3025 |
| 119 | Ga0070684_100003431 | 3300005535 | Bacteria | 11901 |
| 120 | Ga0070684_100010316 | 3300005535 | Bacteria | 7397 |
| 121 | Ga0070684_100037605 | 3300005535 | Bacteria | 4153 |
| 122 | Ga0070684_100057726 | 3300005535 | Bacteria | 3390 |
| 123 | Ga0070684_100128845 | 3300005535 | Bacteria | 2282 |
| 124 | Ga0070684_100145941 | 3300005535 | Bacteria | 2142 |
| 125 | Ga0070697_100050303 | 3300005536 | Bacteria | 3382 |
| 126 | Ga0068853_100018830 | 3300005539 | Bacteria | 5717 |
| 127 | Ga0068853_100046309 | 3300005539 | Bacteria | 3729 |
| 128 | Ga0068853_100049463 | 3300005539 | Bacteria | 3613 |
| 129 | Ga0068853_100069589 | 3300005539 | Bacteria | 3062 |
| 130 | Ga0070672_100002581 | 3300005543 | Bacteria | 11562 |
| 131 | Ga0070672_100002781 | 3300005543 | Bacteria | 11217 |
| 132 | Ga0070672_100019241 | 3300005543 | Bacteria | 4953 |
| 133 | Ga0070672_100019911 | 3300005543 | Bacteria | 4882 |
| 134 | Ga0070672_100168701 | 3300005543 | Bacteria | 1819 |
| 135 | Ga0070686_100014493 | 3300005544 | Bacteria | 4547 |
| 136 | Ga0070695_100000817 | 3300005545 | Bacteria | 16786 |
| 137 | Ga0070695_100025834 | 3300005545 | Bacteria | 3629 |
| 138 | Ga0070696_100000381 | 3300005546 | Bacteria | 27159 |
| 139 | Ga0070696_100006093 | 3300005546 | Bacteria | 8054 |
| 140 | Ga0070696_100076638 | 3300005546 | Bacteria | 2361 |
| 141 | Ga0070693_100040148 | 3300005547 | Bacteria | 2626 |
| 142 | Ga0070665_100171105 | 3300005548 | Bacteria | 2173 |
| 143 | Ga0070665_100223932 | 3300005548 | Unclassified | 1882 |
| 144 | Ga0068855_100002065 | 3300005563 | Bacteria | 24885 |
| 145 | Ga0068855_100113345 | 3300005563 | Bacteria | 3111 |
| 146 | Ga0068855_100334178 | 3300005563 | Bacteria | 1672 |
| 147 | Ga0070664_100030867 | 3300005564 | Bacteria | 4473 |
| 148 | Ga0070664_100040888 | 3300005564 | Bacteria | 3911 |
| 149 | Ga0070664_100086142 | 3300005564 | Bacteria | 2714 |
| 150 | Ga0070664_100237191 | 3300005564 | Bacteria | 1636 |
| 151 | Ga0068857_100006817 | 3300005577 | Bacteria | 9833 |
| 152 | Ga0068857_100023658 | 3300005577 | Bacteria | 5409 |
| 153 | Ga0068857_100166097 | 3300005577 | Bacteria | 2004 |
| 154 | Ga0068854_100004227 | 3300005578 | Bacteria | 9039 |
| 155 | Ga0068854_100069469 | 3300005578 | Bacteria | 2572 |
| 156 | Ga0068856_100005156 | 3300005614 | Bacteria | 12897 |
| 157 | Ga0068856_100159215 | 3300005614 | Bacteria | 2268 |
| 158 | Ga0070702_100101001 | 3300005615 | Unclassified | 1769 |
| 159 | Ga0068852_100003906 | 3300005616 | Bacteria | 10471 |
| 160 | Ga0068852_100011168 | 3300005616 | Bacteria | 6746 |
| 161 | Ga0068852_100024462 | 3300005616 | Bacteria | 4881 |
| 162 | Ga0068852_100145427 | 3300005616 | Bacteria | 2198 |
| 163 | Ga0068852_100157233 | 3300005616 | Bacteria | 2119 |
| 164 | Ga0068852_100169300 | 3300005616 | Bacteria | 2046 |
| 165 | Ga0068859_100010691 | 3300005617 | Bacteria | 9239 |
| 166 | Ga0068864_100018057 | 3300005618 | Bacteria | 5887 |
| 167 | Ga0068864_100053047 | 3300005618 | Bacteria | 3496 |
| 168 | Ga0068861_100003917 | 3300005719 | Bacteria | 9952 |
| 169 | Ga0068861_100215266 | 3300005719 | Unclassified | 1621 |
| 170 | Ga0068851_10012953 | 3300005834 | Bacteria | 3939 |
| 171 | Ga0068851_10022605 | 3300005834 | Bacteria | 3067 |
| 172 | Ga0068851_10030572 | 3300005834 | Bacteria | 2671 |
| 173 | Ga0068851_10032374 | 3300005834 | Unclassified | 2602 |
| 174 | Ga0068870_10059539 | 3300005840 | Bacteria | 2047 |
| 175 | Ga0068863_100018014 | 3300005841 | Bacteria | 6760 |
| 176 | Ga0068863_100042253 | 3300005841 | Bacteria | 4332 |
| 177 | Ga0068858_100022669 | 3300005842 | Bacteria | 5857 |
| 178 | Ga0068860_100008551 | 3300005843 | Bacteria | 10201 |
| 179 | Ga0068860_100091863 | 3300005843 | Bacteria | 2892 |
| 180 | Ga0068862_100034981 | 3300005844 | Bacteria | 4252 |
| 181 | Ga0068862_100173579 | 3300005844 | Bacteria | 1931 |
| 182 | Ga0081539_10000807 | 3300005985 | Bacteria | 60932 |
| 183 | Ga0070717_10000852 | 3300006028 | Bacteria | 20225 |
| 184 | Ga0070716_100001023 | 3300006173 | Bacteria | 12231 |
| 185 | Ga0097621_100025099 | 3300006237 | Bacteria | 4661 |
| 186 | Ga0068871_100005320 | 3300006358 | Bacteria | 9019 |
| 187 | Ga0075428_100002736 | 3300006844 | Bacteria | 19192 |
| 188 | Ga0075430_100000259 | 3300006846 | Bacteria | 37106 |
| 189 | Ga0075430_100015905 | 3300006846 | Bacteria | 6407 |
| 190 | Ga0075431_100010472 | 3300006847 | Bacteria | 9325 |
| 191 | Ga0075431_100019818 | 3300006847 | Bacteria | 6867 |
| 192 | Ga0075431_100092265 | 3300006847 | Bacteria | 3126 |
| 193 | Ga0075433_10035407 | 3300006852 | Bacteria | 4293 |
| 194 | Ga0075434_100049838 | 3300006871 | Bacteria | 4159 |
| 195 | Ga0075434_100069023 | 3300006871 | Bacteria | 3523 |
| 196 | Ga0075429_100024903 | 3300006880 | Bacteria | 5194 |
| 197 | Ga0075429_100049453 | 3300006880 | Bacteria | 3656 |
| 198 | Ga0068865_100004921 | 3300006881 | Bacteria | 8075 |
| 199 | Ga0068865_100013641 | 3300006881 | Bacteria | 5144 |
| 200 | Ga0075436_100001320 | 3300006914 | Bacteria | 16853 |
| 201 | Ga0075436_100010070 | 3300006914 | Bacteria | 6468 |
| 202 | Ga0097620_100010691 | 3300006931 | Bacteria | 9239 |
| 203 | Ga0105240_10001901 | 3300009093 | Bacteria | 34675 |
| 204 | Ga0105240_10003398 | 3300009093 | Bacteria | 24750 |
| 205 | Ga0105240_10221102 | 3300009093 | Bacteria | 2206 |
| 206 | Ga0111539_10001571 | 3300009094 | Bacteria | 30396 |
| 207 | Ga0111539_10028076 | 3300009094 | Bacteria | 6870 |
| 208 | Ga0111539_10110728 | 3300009094 | Bacteria | 3222 |
| 209 | Ga0105245_10019074 | 3300009098 | Bacteria | 6004 |
| 210 | Ga0105245_10073359 | 3300009098 | Bacteria | 3112 |
| 211 | Ga0114129_10148828 | 3300009147 | Bacteria | 3205 |
| 212 | Ga0114129_10206297 | 3300009147 | Bacteria | 2659 |
| 213 | Ga0105241_10000038 | 3300009174 | Bacteria | 115211 |
| 214 | Ga0105241_10031703 | 3300009174 | Bacteria | 3958 |
| 215 | Ga0105242_10107419 | 3300009176 | Bacteria | 2374 |
| 216 | Ga0105248_10003532 | 3300009177 | Bacteria | 17338 |
| 217 | Ga0105248_10015072 | 3300009177 | Bacteria | 8512 |
| 218 | Ga0105248_10036024 | 3300009177 | Bacteria | 5534 |
| 219 | Ga0105248_10208359 | 3300009177 | Bacteria | 2203 |
| 220 | Ga0105248_10250434 | 3300009177 | Bacteria | 1994 |
| 221 | Ga0105248_10273841 | 3300009177 | Bacteria | 1901 |
| 222 | Ga0105238_10028857 | 3300009551 | Bacteria | 5651 |
| 223 | Ga0105249_10000131 | 3300009553 | Bacteria | 99448 |
| 224 | Ga0105249_10013612 | 3300009553 | Bacteria | 7184 |
| 225 | Ga0105249_10124839 | 3300009553 | Bacteria | 2450 |
| 226 | Ga0099796_10010200 | 3300010159 | Bacteria | 2574 |
| 227 | Ga0105239_10004555 | 3300010375 | Bacteria | 16518 |
| 228 | Ga0105239_10009555 | 3300010375 | Bacteria | 10914 |
| 229 | Ga0105246_10001101 | 3300011119 | Bacteria | 15683 |
| 230 | Ga0157373_10000902 | 3300013100 | Bacteria | 23019 |
| 231 | Ga0157373_10080658 | 3300013100 | Bacteria | 2294 |
| 232 | Ga0157371_10002858 | 3300013102 | Bacteria | 16135 |
| 233 | Ga0157371_10005201 | 3300013102 | Bacteria | 11063 |
| 234 | Ga0157371_10014535 | 3300013102 | Bacteria | 5938 |
| 235 | Ga0157371_10029869 | 3300013102 | Bacteria | 3935 |
| 236 | Ga0157370_10004753 | 3300013104 | Bacteria | 15461 |
| 237 | Ga0157370_10025087 | 3300013104 | Bacteria | 5901 |
| 238 | Ga0157369_10002628 | 3300013105 | Bacteria | 21471 |
| 239 | Ga0157369_10023239 | 3300013105 | Bacteria | 6908 |
| 240 | Ga0157369_10067494 | 3300013105 | Bacteria | 3845 |
| 241 | Ga0157374_10010387 | 3300013296 | Bacteria | 8008 |
| 242 | Ga0157374_10188367 | 3300013296 | Bacteria | 2018 |
| 243 | Ga0157378_10012398 | 3300013297 | Bacteria | 7463 |
| 244 | Ga0157378_10039374 | 3300013297 | Bacteria | 4192 |
| 245 | Ga0163162_10005796 | 3300013306 | Bacteria | 11954 |
| 246 | Ga0163162_10177202 | 3300013306 | Bacteria | 2257 |
| 247 | Ga0163162_10186244 | 3300013306 | Bacteria | 2203 |
| 248 | Ga0157372_10001161 | 3300013307 | Bacteria | 28502 |
| 249 | Ga0157372_10006620 | 3300013307 | Bacteria | 12331 |
| 250 | Ga0157372_10007393 | 3300013307 | Bacteria | 11682 |
| 251 | Ga0157372_10009520 | 3300013307 | Bacteria | 10327 |
| 252 | Ga0157372_10010408 | 3300013307 | Bacteria | 9888 |
| 253 | Ga0157372_10021399 | 3300013307 | Bacteria | 6987 |
| 254 | Ga0157372_10022673 | 3300013307 | Bacteria | 6795 |
| 255 | Ga0157372_10024142 | 3300013307 | Bacteria | 6599 |
| 256 | Ga0157372_10240865 | 3300013307 | Bacteria | 2099 |
| 257 | Ga0157375_10009308 | 3300013308 | Bacteria | 8622 |
| 258 | Ga0157375_10164357 | 3300013308 | Bacteria | 2363 |
| 259 | Ga0157380_10017758 | 3300014326 | Bacteria | 5270 |
| 260 | Ga0157377_10000658 | 3300014745 | Bacteria | 14409 |
| 261 | Ga0157377_10081574 | 3300014745 | Bacteria | 1892 |
| 262 | Ga0157379_10000965 | 3300014968 | Bacteria | 23357 |
| 263 | Ga0157376_10158732 | 3300014969 | Bacteria | 2047 |
| 264 | Ga0163161_10004493 | 3300017792 | Bacteria | 9702 |
| 265 | Ga0206356_11232198 | 3300020070 | Bacteria | 1621 |
| 266 | Ga0213876_10015299 | 3300021384 | Bacteria | 4062 |
| 267 | Ga0207697_10003952 | 3300025315 | Bacteria | 7208 |
| 268 | Ga0207656_10006585 | 3300025321 | Bacteria | 4188 |
| 269 | Ga0207656_10065099 | 3300025321 | Unclassified | 1608 |
| 270 | Ga0207682_10037499 | 3300025893 | Bacteria | 1964 |
| 271 | Ga0207692_10006731 | 3300025898 | Bacteria | 4672 |
| 272 | Ga0207642_10027638 | 3300025899 | Bacteria | 2324 |
| 273 | Ga0207647_10082828 | 3300025904 | Bacteria | 1921 |
| 274 | Ga0207699_10007002 | 3300025906 | Bacteria | 5492 |
| 275 | Ga0207645_10002866 | 3300025907 | Bacteria | 13360 |
| 276 | Ga0207645_10011870 | 3300025907 | Bacteria | 5929 |
| 277 | Ga0207645_10030281 | 3300025907 | Bacteria | 3487 |
| 278 | Ga0207645_10095276 | 3300025907 | Bacteria | 1916 |
| 279 | Ga0207705_10001150 | 3300025909 | Bacteria | 21556 |
| 280 | Ga0207705_10005894 | 3300025909 | Bacteria | 9109 |
| 281 | Ga0207705_10020700 | 3300025909 | Bacteria | 4697 |
| 282 | Ga0207684_10119286 | 3300025910 | Bacteria | 2261 |
| 283 | Ga0207654_10000036 | 3300025911 | Bacteria | 110335 |
| 284 | Ga0207707_10000687 | 3300025912 | Bacteria | 33610 |
| 285 | Ga0207707_10001596 | 3300025912 | Bacteria | 20889 |
| 286 | Ga0207707_10005264 | 3300025912 | Bacteria | 11328 |
| 287 | Ga0207707_10005323 | 3300025912 | Bacteria | 11243 |
| 288 | Ga0207707_10017297 | 3300025912 | Bacteria | 6284 |
| 289 | Ga0207707_10067629 | 3300025912 | Bacteria | 3112 |
| 290 | Ga0207707_10201141 | 3300025912 | Bacteria | 1737 |
| 291 | Ga0207707_10222975 | 3300025912 | Bacteria | 1641 |
| 292 | Ga0207707_10242879 | 3300025912 | Bacteria | 1565 |
| 293 | Ga0207695_10001210 | 3300025913 | Bacteria | 44236 |
| 294 | Ga0207695_10003856 | 3300025913 | Bacteria | 20757 |
| 295 | Ga0207695_10035820 | 3300025913 | Bacteria | 5373 |
| 296 | Ga0207695_10074847 | 3300025913 | Bacteria | 3447 |
| 297 | Ga0207695_10233752 | 3300025913 | Bacteria | 1742 |
| 298 | Ga0207695_10273788 | 3300025913 | Bacteria | 1583 |
| 299 | Ga0207693_10048697 | 3300025915 | Bacteria | 3328 |
| 300 | Ga0207660_10000728 | 3300025917 | Bacteria | 21885 |
| 301 | Ga0207660_10003100 | 3300025917 | Bacteria | 10866 |
| 302 | Ga0207660_10009431 | 3300025917 | Bacteria | 6318 |
| 303 | Ga0207660_10010587 | 3300025917 | Bacteria | 5990 |
| 304 | Ga0207660_10088305 | 3300025917 | Bacteria | 2292 |
| 305 | Ga0207660_10133458 | 3300025917 | Bacteria | 1892 |
| 306 | Ga0207662_10000828 | 3300025918 | Bacteria | 14238 |
| 307 | Ga0207662_10019617 | 3300025918 | Bacteria | 3851 |
| 308 | Ga0207657_10001987 | 3300025919 | Bacteria | 22084 |
| 309 | Ga0207657_10052575 | 3300025919 | Bacteria | 3535 |
| 310 | Ga0207657_10054966 | 3300025919 | Bacteria | 3441 |
| 311 | Ga0207657_10124715 | 3300025919 | Bacteria | 2116 |
| 312 | Ga0207657_10265199 | 3300025919 | Bacteria | 1366 |
| 313 | Ga0207649_10007484 | 3300025920 | Bacteria | 5937 |
| 314 | Ga0207649_10018842 | 3300025920 | Bacteria | 3935 |
| 315 | Ga0207649_10063549 | 3300025920 | Bacteria | 2331 |
| 316 | Ga0207649_10114375 | 3300025920 | Bacteria | 1808 |
| 317 | Ga0207652_10000336 | 3300025921 | Bacteria | 48795 |
| 318 | Ga0207652_10005447 | 3300025921 | Bacteria | 10327 |
| 319 | Ga0207652_10005612 | 3300025921 | Bacteria | 10177 |
| 320 | Ga0207652_10008325 | 3300025921 | Bacteria | 8337 |
| 321 | Ga0207652_10025555 | 3300025921 | Bacteria | 4911 |
| 322 | Ga0207652_10030799 | 3300025921 | Bacteria | 4497 |
| 323 | Ga0207652_10059986 | 3300025921 | Bacteria | 3281 |
| 324 | Ga0207652_10082019 | 3300025921 | Bacteria | 2821 |
| 325 | Ga0207652_10191179 | 3300025921 | Bacteria | 1841 |
| 326 | Ga0207646_10001823 | 3300025922 | Bacteria | 25742 |
| 327 | Ga0207646_10018582 | 3300025922 | Bacteria | 6481 |
| 328 | Ga0207646_10025374 | 3300025922 | Bacteria | 5422 |
| 329 | Ga0207681_10002777 | 3300025923 | Bacteria | 11078 |
| 330 | Ga0207681_10002981 | 3300025923 | Bacteria | 10638 |
| 331 | Ga0207681_10007052 | 3300025923 | Bacteria | 6896 |
| 332 | Ga0207681_10070515 | 3300025923 | Bacteria | 2434 |
| 333 | Ga0207681_10142632 | 3300025923 | Bacteria | 1786 |
| 334 | Ga0207694_10019538 | 3300025924 | Bacteria | 5122 |
| 335 | Ga0207650_10008654 | 3300025925 | Bacteria | 6951 |
| 336 | Ga0207650_10010401 | 3300025925 | Bacteria | 6378 |
| 337 | Ga0207659_10002226 | 3300025926 | Bacteria | 11551 |
| 338 | Ga0207659_10002918 | 3300025926 | Bacteria | 10184 |
| 339 | Ga0207659_10005914 | 3300025926 | Bacteria | 7470 |
| 340 | Ga0207659_10101828 | 3300025926 | Bacteria | 2167 |
| 341 | Ga0207687_10004929 | 3300025927 | Bacteria | 8863 |
| 342 | Ga0207687_10076200 | 3300025927 | Bacteria | 2408 |
| 343 | Ga0207687_10135521 | 3300025927 | Bacteria | 1862 |
| 344 | Ga0207700_10000462 | 3300025928 | Bacteria | 23848 |
| 345 | Ga0207700_10004118 | 3300025928 | Bacteria | 8531 |
| 346 | Ga0207664_10014464 | 3300025929 | Bacteria | 5699 |
| 347 | Ga0207664_10020683 | 3300025929 | Bacteria | 4884 |
| 348 | Ga0207664_10056762 | 3300025929 | Bacteria | 3111 |
| 349 | Ga0207644_10024221 | 3300025931 | Bacteria | 4165 |
| 350 | Ga0207644_10069760 | 3300025931 | Bacteria | 2567 |
| 351 | Ga0207690_10002104 | 3300025932 | Bacteria | 12194 |
| 352 | Ga0207690_10006435 | 3300025932 | Bacteria | 6961 |
| 353 | Ga0207690_10055504 | 3300025932 | Bacteria | 2668 |
| 354 | Ga0207706_10001172 | 3300025933 | Bacteria | 26572 |
| 355 | Ga0207706_10001727 | 3300025933 | Bacteria | 21522 |
| 356 | Ga0207706_10008153 | 3300025933 | Bacteria | 9663 |
| 357 | Ga0207706_10024841 | 3300025933 | Bacteria | 5371 |
| 358 | Ga0207706_10050682 | 3300025933 | Bacteria | 3668 |
| 359 | Ga0207686_10038782 | 3300025934 | Bacteria | 2885 |
| 360 | Ga0207686_10044803 | 3300025934 | Bacteria | 2718 |
| 361 | Ga0207670_10003234 | 3300025936 | Bacteria | 8632 |
| 362 | Ga0207670_10046930 | 3300025936 | Bacteria | 2873 |
| 363 | Ga0207670_10088792 | 3300025936 | Bacteria | 2181 |
| 364 | Ga0207670_10173053 | 3300025936 | Unclassified | 1620 |
| 365 | Ga0207669_10035452 | 3300025937 | Bacteria | 2839 |
| 366 | Ga0207669_10051363 | 3300025937 | Bacteria | 2470 |
| 367 | Ga0207704_10196997 | 3300025938 | Bacteria | 1471 |
| 368 | Ga0207665_10001133 | 3300025939 | Bacteria | 17938 |
| 369 | Ga0207691_10000638 | 3300025940 | Bacteria | 34615 |
| 370 | Ga0207691_10001606 | 3300025940 | Bacteria | 22446 |
| 371 | Ga0207691_10026805 | 3300025940 | Bacteria | 5408 |
| 372 | Ga0207691_10070979 | 3300025940 | Bacteria | 3144 |
| 373 | Ga0207691_10119919 | 3300025940 | Bacteria | 2332 |
| 374 | Ga0207711_10005992 | 3300025941 | Bacteria | 10275 |
| 375 | Ga0207711_10053193 | 3300025941 | Bacteria | 3472 |
| 376 | Ga0207711_10210757 | 3300025941 | Bacteria | 1775 |
| 377 | Ga0207689_10001394 | 3300025942 | Bacteria | 23050 |
| 378 | Ga0207661_10000767 | 3300025944 | Bacteria | 20823 |
| 379 | Ga0207661_10002219 | 3300025944 | Bacteria | 13404 |
| 380 | Ga0207661_10006853 | 3300025944 | Bacteria | 8076 |
| 381 | Ga0207661_10018751 | 3300025944 | Bacteria | 5147 |
| 382 | Ga0207661_10019807 | 3300025944 | Bacteria | 5021 |
| 383 | Ga0207661_10021067 | 3300025944 | Bacteria | 4882 |
| 384 | Ga0207661_10112683 | 3300025944 | Bacteria | 2303 |
| 385 | Ga0207661_10152717 | 3300025944 | Bacteria | 1997 |
| 386 | Ga0207661_10233666 | 3300025944 | Unclassified | 1629 |
| 387 | Ga0207679_10001065 | 3300025945 | Bacteria | 17442 |
| 388 | Ga0207679_10012928 | 3300025945 | Bacteria | 5462 |
| 389 | Ga0207667_10007778 | 3300025949 | Bacteria | 12815 |
| 390 | Ga0207667_10025839 | 3300025949 | Bacteria | 6424 |
| 391 | Ga0207667_10055996 | 3300025949 | Bacteria | 4144 |
| 392 | Ga0207667_10063713 | 3300025949 | Bacteria | 3852 |
| 393 | Ga0207667_10115039 | 3300025949 | Bacteria | 2772 |
| 394 | Ga0207651_10022197 | 3300025960 | Bacteria | 3875 |
| 395 | Ga0207712_10001624 | 3300025961 | Bacteria | 15155 |
| 396 | Ga0207668_10006894 | 3300025972 | Bacteria | 6740 |
| 397 | Ga0207668_10007120 | 3300025972 | Bacteria | 6639 |
| 398 | Ga0207668_10300549 | 3300025972 | Bacteria | 1324 |
| 399 | Ga0207640_10001996 | 3300025981 | Bacteria | 11011 |
| 400 | Ga0207658_10268637 | 3300025986 | Unclassified | 1457 |
| 401 | Ga0207677_10029375 | 3300026023 | Bacteria | 3493 |
| 402 | Ga0207703_10023903 | 3300026035 | Bacteria | 4805 |
| 403 | Ga0207703_10098178 | 3300026035 | Bacteria | 2476 |
| 404 | Ga0207639_10016185 | 3300026041 | Bacteria | 5270 |
| 405 | Ga0207639_10063638 | 3300026041 | Bacteria | 2857 |
| 406 | Ga0207639_10072799 | 3300026041 | Bacteria | 2692 |
| 407 | Ga0207708_10006782 | 3300026075 | Bacteria | 8474 |
| 408 | Ga0207708_10013032 | 3300026075 | Bacteria | 6203 |
| 409 | Ga0207708_10018656 | 3300026075 | Bacteria | 5225 |
| 410 | Ga0207702_10013163 | 3300026078 | Bacteria | 6879 |
| 411 | Ga0207641_10019519 | 3300026088 | Bacteria | 5564 |
| 412 | Ga0207641_10023623 | 3300026088 | Bacteria | 5065 |
| 413 | Ga0207648_10005761 | 3300026089 | Bacteria | 12415 |
| 414 | Ga0207648_10033355 | 3300026089 | Bacteria | 4541 |
| 415 | Ga0207648_10077334 | 3300026089 | Bacteria | 2901 |
| 416 | Ga0207648_10130827 | 3300026089 | Bacteria | 2209 |
| 417 | Ga0207648_10204247 | 3300026089 | Bacteria | 1753 |
| 418 | Ga0207676_10000885 | 3300026095 | Bacteria | 23251 |
| 419 | Ga0207676_10186267 | 3300026095 | Bacteria | 1822 |
| 420 | Ga0207674_10000208 | 3300026116 | Bacteria | 72594 |
| 421 | Ga0207674_10009905 | 3300026116 | Bacteria | 10842 |
| 422 | Ga0207674_10011994 | 3300026116 | Bacteria | 9713 |
| 423 | Ga0207674_10042626 | 3300026116 | Bacteria | 4685 |
| 424 | Ga0207674_10064202 | 3300026116 | Bacteria | 3704 |
| 425 | Ga0207674_10347353 | 3300026116 | Bacteria | 1434 |
| 426 | Ga0207675_100000352 | 3300026118 | Bacteria | 43894 |
| 427 | Ga0207675_100012994 | 3300026118 | Bacteria | 7771 |
| 428 | Ga0207675_100178855 | 3300026118 | Bacteria | 2031 |
| 429 | Ga0207698_10002882 | 3300026142 | Bacteria | 10289 |
| 430 | Ga0207698_10006565 | 3300026142 | Bacteria | 7269 |
| 431 | Ga0207698_10035618 | 3300026142 | Bacteria | 3643 |
| 432 | Ga0207698_10107444 | 3300026142 | Bacteria | 2330 |
| 433 | Ga0207698_10108496 | 3300026142 | Bacteria | 2321 |
| 434 | Ga0207698_10137900 | 3300026142 | Bacteria | 2096 |
| 435 | Ga0268266_10016390 | 3300028379 | Bacteria | 6336 |
| 436 | Ga0268266_10067410 | 3300028379 | Bacteria | 3098 |
| 437 | Ga0268266_10177191 | 3300028379 | Unclassified | 1939 |
| 438 | Ga0268265_10000717 | 3300028380 | Bacteria | 32468 |
| 439 | Ga0268265_10010375 | 3300028380 | Bacteria | 6292 |
| 440 | Ga0268265_10093324 | 3300028380 | Bacteria | 2411 |
| 441 | Ga0268264_10014185 | 3300028381 | Bacteria | 6552 |
| 442 | Ga0268264_10024061 | 3300028381 | Bacteria | 4970 |
| 443 | Ga0265332_10008418 | 3300031238 | Bacteria | 4635 |
| 444 | Ga0265327_10005655 | 3300031251 | Bacteria | 10348 |
| 445 | Ga0307408_100009498 | 3300031548 | Bacteria | 6417 |
| 446 | Ga0307408_100035072 | 3300031548 | Bacteria | 3518 |
| 447 | Ga0307408_100103737 | 3300031548 | Bacteria | 2171 |
| 448 | Ga0307408_100245839 | 3300031548 | Bacteria | 1473 |
| 449 | Ga0265314_10009257 | 3300031711 | Bacteria | 8342 |
| 450 | Ga0307405_10001142 | 3300031731 | Bacteria | 10889 |
| 451 | Ga0307405_10002565 | 3300031731 | Bacteria | 8062 |
| 452 | Ga0307405_10008225 | 3300031731 | Bacteria | 5274 |
| 453 | Ga0307405_10059148 | 3300031731 | Bacteria | 2414 |
| 454 | Ga0307405_10090490 | 3300031731 | Bacteria | 2025 |
| 455 | Ga0307405_10171077 | 3300031731 | Unclassified | 1550 |
| 456 | Ga0307413_10000114 | 3300031824 | Bacteria | 20639 |
| 457 | Ga0307413_10004330 | 3300031824 | Bacteria | 6159 |
| 458 | Ga0307413_10121346 | 3300031824 | Bacteria | 1771 |
| 459 | Ga0307413_10176570 | 3300031824 | Bacteria | 1518 |
| 460 | Ga0307410_10000180 | 3300031852 | Bacteria | 23276 |
| 461 | Ga0307410_10000406 | 3300031852 | Bacteria | 17054 |
| 462 | Ga0307410_10002408 | 3300031852 | Bacteria | 9031 |
| 463 | Ga0307406_10001787 | 3300031901 | Bacteria | 11754 |
| 464 | Ga0307406_10003825 | 3300031901 | Bacteria | 8193 |
| 465 | Ga0307406_10011407 | 3300031901 | Bacteria | 5042 |
| 466 | Ga0307406_10039177 | 3300031901 | Bacteria | 2938 |
| 467 | Ga0307406_10169640 | 3300031901 | Unclassified | 1578 |
| 468 | Ga0307407_10002412 | 3300031903 | Bacteria | 7310 |
| 469 | Ga0307407_10003394 | 3300031903 | Bacteria | 6523 |
| 470 | Ga0307407_10009579 | 3300031903 | Bacteria | 4519 |
| 471 | Ga0307407_10064119 | 3300031903 | Bacteria | 2158 |
| 472 | Ga0307412_10000559 | 3300031911 | Bacteria | 22114 |
| 473 | Ga0307412_10014392 | 3300031911 | Bacteria | 4664 |
| 474 | Ga0307412_10029034 | 3300031911 | Bacteria | 3467 |
| 475 | Ga0307412_10031368 | 3300031911 | Bacteria | 3356 |
| 476 | Ga0307412_10166396 | 3300031911 | Bacteria | 1644 |
| 477 | Ga0307409_100003438 | 3300031995 | Bacteria | 8602 |
| 478 | Ga0307409_100003789 | 3300031995 | Bacteria | 8326 |
| 479 | Ga0307409_100024846 | 3300031995 | Bacteria | 4189 |
| 480 | Ga0307409_100029942 | 3300031995 | Bacteria | 3904 |
| 481 | Ga0307416_100000293 | 3300032002 | Bacteria | 26182 |
| 482 | Ga0307416_100014021 | 3300032002 | Bacteria | 5470 |
| 483 | Ga0307416_100055287 | 3300032002 | Unclassified | 3196 |
| 484 | Ga0307416_100056918 | 3300032002 | Bacteria | 3159 |
| 485 | Ga0307416_100126061 | 3300032002 | Bacteria | 2293 |
| 486 | Ga0307416_100178347 | 3300032002 | Bacteria | 1988 |
| 487 | Ga0307414_10012081 | 3300032004 | Bacteria | 5095 |
| 488 | Ga0307414_10063513 | 3300032004 | Bacteria | 2625 |
| 489 | Ga0307414_10086585 | 3300032004 | Bacteria | 2312 |
| 490 | Ga0307411_10000053 | 3300032005 | Bacteria | 34373 |
| 491 | Ga0307411_10011708 | 3300032005 | Bacteria | 4749 |
| 492 | Ga0307411_10015123 | 3300032005 | Bacteria | 4322 |
| 493 | Ga0307411_10144771 | 3300032005 | Bacteria | 1757 |
| 494 | Ga0307415_100001985 | 3300032126 | Bacteria | 10061 |
| 495 | Ga0373959_0009373 | 3300034820 | Bacteria | 1687 |
| 496 | Ga0373934_0000121 | 3300035086 | Bacteria | 28230 |
| 497 | Ga0373923_0000572 | 3300035111 | Bacteria | 9075 |
| 498 | Ga0373953_0002839 | 3300035117 | Bacteria | 5277 |
| 499 | Ga0373954_0020142 | 3300035118 | Bacteria | 3015 |
| 500 | Ga0373956_0000317 | 3300035119 | Bacteria | 19476 |
| 501 | Ga0373943_0001771 | 3300035170 | Bacteria | 9771 |
| 502 | Ga0373943_0029000 | 3300035170 | Bacteria | 2612 |
| 503 | Ga0373946_0000905 | 3300035171 | Bacteria | 10192 |
| 504 | Ga0373955_0032852 | 3300035172 | Bacteria | 2728 |
| 505 | Ga0373955_0049253 | 3300035172 | Bacteria | 2287 |
| 506 | Ga0373924_0001503 | 3300035410 | Bacteria | 7597 |
| 507 | Ga0373931_0013436 | 3300035691 | Bacteria | 3987 |
| 508 | Ga0373935_0002644 | 3300035692 | Bacteria | 10293 |
| 509 | Ga0373935_0045792 | 3300035692 | Bacteria | 2761 |
| 510 | Ga0373927_0009039 | 3300035695 | Bacteria | 6688 |
| 511 | Ga0373933_0000422 | 3300035724 | Bacteria | 26693 |
| 512 | Ga0373933_0004863 | 3300035724 | Bacteria | 7332 |
| 513 | Ga0373947_0000797 | 3300035725 | Bacteria | 18986 |
| 514 | Ga0373947_0008534 | 3300035725 | Bacteria | 5902 |
| 515 | Ga0373937_0000144 | 3300036401 | Bacteria | 68655 |
| 516 | Ga0373937_0001066 | 3300036401 | Bacteria | 23146 |
| 517 | Ga0373925_0000980 | 3300037068 | Bacteria | 26006 |
| 518 | Ga0395899_0008510 | 3300037312 | Bacteria | 7903 |
| 519 | Ga0395900_0012468 | 3300037418 | Bacteria | 8691 |
| 520 | Ga0395898_0081679 | 3300037466 | Bacteria | 3116 |
| 521 | Ga0395905_0007988 | 3300037471 | Bacteria | 10455 |
| 522 | Ga0395901_0002171 | 3300038443 | Bacteria | 20034 |
| 523 | Ga0436365_1118439 | 3300039437 | Bacteria | 10260 |
| 524 | Ga0439462_0006256 | 3300042015 | Bacteria | 2955 |
| 525 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 526 | Ga0466966_0036617 | 3300044684 | Bacteria | 3168 |
| 527 | Ga0466959_0036359 | 3300045049 | Bacteria | 3639 |
| 528 | Ga0451576_0081376 | 3300045051 | Bacteria | 3368 |
| 529 | Ga0451576_0179464 | 3300045051 | Bacteria | 2211 |
| 530 | Ga0466967_0055508 | 3300045976 | Bacteria | 3489 |
| 531 | Ga0466967_0171003 | 3300045976 | Bacteria | 2044 |
| 532 | Ga0495592_0001066 | 3300046454 | Bacteria | 18965 |
| 533 | Ga0495603_0004967 | 3300046455 | Bacteria | 7959 |
| 534 | Ga0495629_0010738 | 3300046459 | Bacteria | 6662 |
| 535 | Ga0495629_0042012 | 3300046459 | Bacteria | 3214 |
| 536 | Ga0495629_0210501 | 3300046459 | Bacteria | 1343 |
| 537 | Ga0495651_0000208 | 3300046462 | Bacteria | 44905 |
| 538 | Ga0495651_0015258 | 3300046462 | Bacteria | 5939 |
| 539 | Ga0495653_0001721 | 3300046463 | Bacteria | 17240 |
| 540 | Ga0495653_0127111 | 3300046463 | Bacteria | 1808 |
| 541 | Ga0495580_0000874 | 3300046472 | Bacteria | 26072 |
| 542 | Ga0495580_0071117 | 3300046472 | Bacteria | 2430 |
| 543 | Ga0495582_0000142 | 3300046473 | Bacteria | 38514 |
| 544 | Ga0495582_0028268 | 3300046473 | Bacteria | 3077 |
| 545 | Ga0495639_0001161 | 3300046475 | Bacteria | 11913 |
| 546 | Ga0495662_0010984 | 3300046476 | Bacteria | 4427 |
| 547 | Ga0495594_0003350 | 3300046499 | Bacteria | 8281 |
| 548 | Ga0495594_0008663 | 3300046499 | Bacteria | 5242 |
| 549 | Ga0495594_0050773 | 3300046499 | Bacteria | 2282 |
| 550 | Ga0495594_0068855 | 3300046499 | Bacteria | 1966 |
| 551 | Ga0495608_0000316 | 3300046511 | Bacteria | 33956 |
| 552 | Ga0495618_0009104 | 3300046514 | Bacteria | 5991 |
| 553 | Ga0495628_0000414 | 3300046516 | Bacteria | 39218 |
| 554 | Ga0495628_0039563 | 3300046516 | Bacteria | 3771 |
| 555 | Ga0495628_0053572 | 3300046516 | Bacteria | 3183 |
| 556 | Ga0495630_0000689 | 3300046517 | Bacteria | 24229 |
| 557 | Ga0495630_0003388 | 3300046517 | Bacteria | 11104 |
| 558 | Ga0495630_0096316 | 3300046517 | Bacteria | 2237 |
| 559 | Ga0495666_0079901 | 3300046526 | Bacteria | 1548 |
| 560 | Ga0495652_0001020 | 3300046529 | Bacteria | 32048 |
| 561 | Ga0495652_0024962 | 3300046529 | Bacteria | 5289 |
| 562 | Ga0495652_0030742 | 3300046529 | Bacteria | 4706 |
| 563 | Ga0495665_0000009 | 3300046531 | Bacteria | 75094 |
| 564 | Ga0495665_0065760 | 3300046531 | Bacteria | 1914 |
| 565 | Ga0495665_0070948 | 3300046531 | Bacteria | 1835 |
| 566 | Ga0495640_0078971 | 3300046533 | Bacteria | 2191 |
| 567 | Ga0495586_0018355 | 3300046535 | Bacteria | 3725 |
| 568 | Ga0495586_0052387 | 3300046535 | Bacteria | 2209 |
| 569 | Ga0495587_0000166 | 3300046536 | Bacteria | 47900 |
| 570 | Ga0495587_0027064 | 3300046536 | Bacteria | 3492 |
| 571 | Ga0495587_0086894 | 3300046536 | Bacteria | 1810 |
| 572 | Ga0495621_0004550 | 3300046539 | Bacteria | 3912 |
| 573 | Ga0495645_0000316 | 3300046543 | Bacteria | 34637 |
| 574 | Ga0495645_0000741 | 3300046543 | Bacteria | 22298 |
| 575 | Ga0495645_0011529 | 3300046543 | Bacteria | 6223 |
| 576 | Ga0495667_0000444 | 3300046559 | Bacteria | 26487 |
| 577 | Ga0495667_0017754 | 3300046559 | Bacteria | 4805 |
| 578 | Ga0495667_0212674 | 3300046559 | Bacteria | 1235 |
| 579 | Ga0495634_0034358 | 3300046642 | Bacteria | 3480 |
| 580 | Ga0495635_0000614 | 3300046663 | Bacteria | 22955 |
| 581 | Ga0495635_0008883 | 3300046663 | Bacteria | 7014 |
| 582 | Ga0495635_0043978 | 3300046663 | Bacteria | 3081 |
| 583 | Ga0495588_0000811 | 3300046674 | Bacteria | 13971 |
| 584 | Ga0495588_0035742 | 3300046674 | Bacteria | 2519 |
| 585 | Ga0495657_0000359 | 3300046675 | Bacteria | 41984 |
| 586 | Ga0495599_0000571 | 3300046678 | Bacteria | 21026 |
| 587 | Ga0495599_0017660 | 3300046678 | Bacteria | 4437 |
| 588 | Ga0495623_0000312 | 3300046679 | Bacteria | 31331 |
| 589 | Ga0495623_0009840 | 3300046679 | Bacteria | 6195 |
| 590 | Ga0495623_0030808 | 3300046679 | Bacteria | 3451 |
| 591 | Ga0495646_0017409 | 3300046680 | Unclassified | 4558 |
| 592 | Ga0495646_0017980 | 3300046680 | Bacteria | 4479 |
| 593 | Ga0495646_0035527 | 3300046680 | Bacteria | 3091 |
| 594 | Ga0495658_0001023 | 3300046683 | Bacteria | 14794 |
| 595 | Ga0495658_0008175 | 3300046683 | Bacteria | 5184 |
| 596 | Ga0495613_0003686 | 3300046689 | Bacteria | 11483 |
| 597 | Ga0495613_0014782 | 3300046689 | Bacteria | 5793 |
| 598 | Ga0495613_0032083 | 3300046689 | Bacteria | 3902 |
| 599 | Ga0495624_0015111 | 3300046690 | Bacteria | 5222 |
| 600 | Ga0495600_0000131 | 3300046809 | Bacteria | 42268 |
| 601 | Ga0495600_0071453 | 3300046809 | Bacteria | 2267 |
| 602 | Ga0495581_0000601 | 3300047315 | Bacteria | 18827 |
| 603 | Ga0495581_0014446 | 3300047315 | Bacteria | 4579 |
| 604 | Ga0495581_0022142 | 3300047315 | Bacteria | 3683 |
| 605 | Ga0495581_0065905 | 3300047315 | Bacteria | 2094 |
| 606 | Ga0495604_0000992 | 3300047317 | Bacteria | 23588 |
| 607 | Ga0495604_0053445 | 3300047317 | Bacteria | 3121 |
| 608 | Ga0495604_0080500 | 3300047317 | Bacteria | 2440 |
| 609 | Ga0495674_0002567 | 3300047319 | Bacteria | 17701 |
| 610 | Ga0495674_0068466 | 3300047319 | Bacteria | 3072 |
| 611 | Ga0495672_0001021 | 3300047320 | Bacteria | 28772 |
| 612 | Ga0495680_0008762 | 3300047322 | Bacteria | 9164 |
| 613 | Ga0495680_0016948 | 3300047322 | Bacteria | 6239 |
| 614 | Ga0495675_0001641 | 3300047444 | Bacteria | 13430 |
| 615 | Ga0495675_0011414 | 3300047444 | Bacteria | 5577 |
| 616 | Ga0495684_0000476 | 3300047471 | Bacteria | 32788 |
| 617 | Ga0495684_0004844 | 3300047471 | Bacteria | 10506 |
| 618 | Ga0495684_0154156 | 3300047471 | Bacteria | 1716 |
| 619 | Ga0495593_0000040 | 3300047673 | Bacteria | 52326 |
| 620 | Ga0495602_0000161 | 3300048088 | Bacteria | 62393 |
| 621 | Ga0495602_0038925 | 3300048088 | Bacteria | 4387 |
| 622 | Ga0495614_0001591 | 3300048089 | Bacteria | 9860 |
| 623 | Ga0495615_0013186 | 3300048090 | Unclassified | 1722 |
| 624 | Ga0496104_0233546 | 3300048907 | Bacteria | 1751 |
| 625 | Ga0496109_0004616 | 3300048912 | Bacteria | 11500 |
| 626 | Ga0496112_0041965 | 3300048915 | Bacteria | 4476 |
| 627 | Ga0496112_0042974 | 3300048915 | Bacteria | 4423 |
| 628 | Ga0496112_0091036 | 3300048915 | Bacteria | 3019 |
| 629 | Ga0496115_0132833 | 3300048918 | Unclassified | 2052 |
| 630 | Ga0501031_0018939 | 3300049568 | Bacteria | 4482 |
| 631 | Ga0501033_0005194 | 3300049570 | Bacteria | 10345 |
| 632 | Ga0501034_0028051 | 3300049571 | Bacteria | 5726 |
| 633 | Ga0501034_0203830 | 3300049571 | Bacteria | 1935 |
| 634 | Ga0501038_0011267 | 3300049574 | Bacteria | 8164 |
| 635 | Ga0501038_0021849 | 3300049574 | Bacteria | 5739 |
| 636 | Ga0501040_0011687 | 3300049576 | Bacteria | 5746 |
| 637 | Ga0501042_0024925 | 3300049578 | Bacteria | 4198 |
| 638 | Ga0501043_0032922 | 3300049579 | Bacteria | 4077 |
| 639 | Ga0501047_0002061 | 3300049581 | Bacteria | 19214 |
| 640 | Ga0501070_0007886 | 3300049586 | Bacteria | 9021 |
| 641 | Ga0501080_0092247 | 3300049742 | Bacteria | 2813 |
| 642 | Ga0501081_0062751 | 3300049743 | Bacteria | 2578 |
| 643 | Ga0501081_0068983 | 3300049743 | Bacteria | 2462 |
| 644 | Ga0501035_0232737 | 3300049822 | Bacteria | 1570 |
| 645 | Ga0501044_0002752 | 3300049823 | Bacteria | 20012 |
| 646 | Ga0501045_0014345 | 3300049824 | Bacteria | 5615 |
| 647 | nmdc:mga05p37_121331_c1 | 3300050507 | Bacteria | 3211 |
| 648 | nmdc:mga09592_135509_c1 | 3300050508 | Bacteria | 2121 |
| 649 | nmdc:mga09592_21081_c1 | 3300050508 | Bacteria | 5367 |
| 650 | nmdc:mga0qj67_24446_c1 | 3300050509 | Bacteria | 4657 |
| 651 | nmdc:mga0qj67_53748_c1 | 3300050509 | Bacteria | 3189 |
| 652 | nmdc:mga06r32_11221_c1 | 3300050510 | Bacteria | 8072 |
| 653 | nmdc:mga06r32_130402_c1 | 3300050510 | Bacteria | 2486 |
| 654 | nmdc:mga06r32_196984_c1 | 3300050510 | Bacteria | 2002 |
| 655 | nmdc:mga06r32_270345_c1 | 3300050510 | Bacteria | 1687 |
| 656 | nmdc:mga06r32_371657_c1 | 3300050510 | Bacteria | 1413 |
| 657 | nmdc:mga06r32_76361_c1 | 3300050510 | Bacteria | 3253 |
| 658 | nmdc:mga06r32_95931_c1 | 3300050510 | Bacteria | 2903 |
| 659 | nmdc:mga08y16_24875_c1 | 3300050511 | Bacteria | 6316 |
| 660 | nmdc:mga08y16_68878_c1 | 3300050511 | Bacteria | 3689 |
| 661 | nmdc:mga0n895_110268_c1 | 3300050512 | Bacteria | 2768 |
| 662 | nmdc:mga0n895_50160_c1 | 3300050512 | Bacteria | 4091 |
| 663 | nmdc:mga0rr50_156675_c1 | 3300050513 | Unclassified | 1845 |
| 664 | nmdc:mga0rr50_54470_c1 | 3300050513 | Bacteria | 2980 |
| 665 | nmdc:mga08x19_13541_c1 | 3300050514 | Bacteria | 4932 |
| 666 | nmdc:mga0a205_22607_c1 | 3300050515 | Bacteria | 5959 |
| 667 | nmdc:mga0a205_27712_c1 | 3300050515 | Bacteria | 4082 |
| 668 | nmdc:mga0a205_7237_c1 | 3300050515 | Bacteria | 10034 |
| 669 | Ga0495601_0083900 | 3300053077 | Bacteria | 2047 |
| 670 | Ga0495612_0003723 | 3300053078 | Bacteria | 6334 |
| 671 | Ga0495619_0000899 | 3300053085 | Bacteria | 19480 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0210501 | Ga0495629_0210501_16_1107 | 295 |
| 2 | 3300046559 | Ga0495667_0212674 | Ga0495667_0212674_83_1207 | 305 |
| 3 | 3300025972 | Ga0207668_10300549 | Ga0207668_103005492 | 321 |
| 4 | 3300005563 | Ga0068855_100334178 | Ga0068855_1003341782 | 323 |
| 5 | 3300042015 | Ga0439462_0006256 | Ga0439462_0006256_564_1844 | 336 |
| 6 | 3300050508 | nmdc:mga09592_135509_c1 | nmdc:mga09592_135509_c1_356_1537 | 336 |
| 7 | 3300050510 | nmdc:mga06r32_130402_c1 | nmdc:mga06r32_130402_c1_548_1729 | 336 |
| 8 | 3300049570 | Ga0501033_0005194 | Ga0501033_0005194_6321_7601 | 339 |
| 9 | 3300049571 | Ga0501034_0028051 | Ga0501034_0028051_961_2241 | 339 |
| 10 | 3300049574 | Ga0501038_0011267 | Ga0501038_0011267_2403_3683 | 339 |
| 11 | 3300049823 | Ga0501044_0002752 | Ga0501044_0002752_16450_17730 | 339 |
| 12 | 3300053078 | Ga0495612_0003723 | Ga0495612_0003723_72_1349 | 341 |
| 13 | 3300046529 | Ga0495652_0030742 | Ga0495652_0030742_2059_3366 | 342 |
| 14 | 3300035086 | Ga0373934_0000121 | Ga0373934_0000121_16667_17944 | 347 |
| 15 | 3300035111 | Ga0373923_0000572 | Ga0373923_0000572_1595_2872 | 347 |
| 16 | 3300035117 | Ga0373953_0002839 | Ga0373953_0002839_643_1920 | 347 |
| 17 | 3300035118 | Ga0373954_0020142 | Ga0373954_0020142_70_1347 | 347 |
| 18 | 3300035119 | Ga0373956_0000317 | Ga0373956_0000317_3540_4817 | 347 |
| 19 | 3300035172 | Ga0373955_0049253 | Ga0373955_0049253_148_1425 | 347 |
| 20 | 3300035410 | Ga0373924_0001503 | Ga0373924_0001503_2483_3760 | 347 |
| 21 | 3300035724 | Ga0373933_0000422 | Ga0373933_0000422_10480_11757 | 347 |
| 22 | 3300036401 | Ga0373937_0000144 | Ga0373937_0000144_56785_58062 | 347 |
| 23 | 3300046454 | Ga0495592_0001066 | Ga0495592_0001066_11310_12587 | 347 |
| 24 | 3300046462 | Ga0495651_0000208 | Ga0495651_0000208_19969_21246 | 347 |
| 25 | 3300046463 | Ga0495653_0001721 | Ga0495653_0001721_9457_10734 | 347 |
| 26 | 3300046511 | Ga0495608_0000316 | Ga0495608_0000316_14508_15785 | 347 |
| 27 | 3300046516 | Ga0495628_0000414 | Ga0495628_0000414_7666_8943 | 347 |
| 28 | 3300046517 | Ga0495630_0000689 | Ga0495630_0000689_2808_4085 | 347 |
| 29 | 3300046529 | Ga0495652_0001020 | Ga0495652_0001020_22016_23293 | 347 |
| 30 | 3300046536 | Ga0495587_0000166 | Ga0495587_0000166_2962_4239 | 347 |
| 31 | 3300046543 | Ga0495645_0000741 | Ga0495645_0000741_1053_2330 | 347 |
| 32 | 3300046559 | Ga0495667_0000444 | Ga0495667_0000444_8647_9924 | 347 |
| 33 | 3300046663 | Ga0495635_0000614 | Ga0495635_0000614_6826_8103 | 347 |
| 34 | 3300046675 | Ga0495657_0000359 | Ga0495657_0000359_10349_11626 | 347 |
| 35 | 3300046678 | Ga0495599_0000571 | Ga0495599_0000571_15994_17271 | 347 |
| 36 | 3300046679 | Ga0495623_0000312 | Ga0495623_0000312_23828_25105 | 347 |
| 37 | 3300046680 | Ga0495646_0017409 | Ga0495646_0017409_3169_4446 | 347 |
| 38 | 3300046689 | Ga0495613_0032083 | Ga0495613_0032083_1681_2958 | 347 |
| 39 | 3300046809 | Ga0495600_0000131 | Ga0495600_0000131_14865_16142 | 347 |
| 40 | 3300047315 | Ga0495581_0065905 | Ga0495581_0065905_275_1552 | 347 |
| 41 | 3300047317 | Ga0495604_0000992 | Ga0495604_0000992_14651_15928 | 347 |
| 42 | 3300047319 | Ga0495674_0002567 | Ga0495674_0002567_1478_2755 | 347 |
| 43 | 3300047322 | Ga0495680_0008762 | Ga0495680_0008762_3008_4285 | 347 |
| 44 | 3300047444 | Ga0495675_0001641 | Ga0495675_0001641_9674_10951 | 347 |
| 45 | 3300047471 | Ga0495684_0000476 | Ga0495684_0000476_3045_4322 | 347 |
| 46 | 3300048088 | Ga0495602_0000161 | Ga0495602_0000161_44737_46014 | 347 |
| 47 | 3300053085 | Ga0495619_0000899 | Ga0495619_0000899_12011_13288 | 347 |
| 48 | 3300031548 | Ga0307408_100009498 | Ga0307408_1000094984 | 348 |
| 49 | 3300031731 | Ga0307405_10001142 | Ga0307405_100011427 | 348 |
| 50 | 3300031824 | Ga0307413_10000114 | Ga0307413_100001149 | 348 |
| 51 | 3300031852 | Ga0307410_10000180 | Ga0307410_100001805 | 348 |
| 52 | 3300031901 | Ga0307406_10039177 | Ga0307406_100391772 | 348 |
| 53 | 3300031903 | Ga0307407_10009579 | Ga0307407_100095793 | 348 |
| 54 | 3300031911 | Ga0307412_10000559 | Ga0307412_100005594 | 348 |
| 55 | 3300031995 | Ga0307409_100003438 | Ga0307409_1000034385 | 348 |
| 56 | 3300032005 | Ga0307411_10000053 | Ga0307411_1000005314 | 348 |
| 57 | 3300032126 | Ga0307415_100001985 | Ga0307415_1000019854 | 348 |
| 58 | 3300005546 | Ga0070696_100076638 | Ga0070696_1000766382 | 351 |
| 59 | 3300025912 | Ga0207707_10222975 | Ga0207707_102229752 | 352 |
| 60 | 3300032002 | Ga0307416_100055287 | Ga0307416_1000552872 | 352 |
| 61 | 3300005329 | Ga0070683_100001864 | Ga0070683_1000018645 | 353 |
| 62 | 3300005578 | Ga0068854_100004227 | Ga0068854_1000042274 | 353 |
| 63 | 3300005616 | Ga0068852_100003906 | Ga0068852_1000039065 | 353 |
| 64 | 3300025912 | Ga0207707_10001596 | Ga0207707_100015969 | 353 |
| 65 | 3300025913 | Ga0207695_10001210 | Ga0207695_1000121010 | 353 |
| 66 | 3300025917 | Ga0207660_10000728 | Ga0207660_1000072811 | 353 |
| 67 | 3300025921 | Ga0207652_10000336 | Ga0207652_1000033610 | 353 |
| 68 | 3300025949 | Ga0207667_10055996 | Ga0207667_100559963 | 353 |
| 69 | 3300025981 | Ga0207640_10001996 | Ga0207640_100019969 | 353 |
| 70 | 3300026142 | Ga0207698_10107444 | Ga0207698_101074442 | 353 |
| 71 | 3300005335 | Ga0070666_10193435 | Ga0070666_101934351 | 354 |
| 72 | 3300005354 | Ga0070675_100046839 | Ga0070675_1000468392 | 354 |
| 73 | 3300005365 | Ga0070688_100010144 | Ga0070688_1000101445 | 354 |
| 74 | 3300005367 | Ga0070667_100062461 | Ga0070667_1000624612 | 354 |
| 75 | 3300005444 | Ga0070694_100190379 | Ga0070694_1001903791 | 354 |
| 76 | 3300005530 | Ga0070679_100015185 | Ga0070679_1000151852 | 354 |
| 77 | 3300005548 | Ga0070665_100223932 | Ga0070665_1002239322 | 354 |
| 78 | 3300005719 | Ga0068861_100215266 | Ga0068861_1002152662 | 354 |
| 79 | 3300005844 | Ga0068862_100173579 | Ga0068862_1001735792 | 354 |
| 80 | 3300009553 | Ga0105249_10124839 | Ga0105249_101248392 | 354 |
| 81 | 3300013306 | Ga0163162_10177202 | Ga0163162_101772022 | 354 |
| 82 | 3300013308 | Ga0157375_10009308 | Ga0157375_100093082 | 354 |
| 83 | 3300025923 | Ga0207681_10142632 | Ga0207681_101426322 | 354 |
| 84 | 3300025936 | Ga0207670_10173053 | Ga0207670_101730532 | 354 |
| 85 | 3300025940 | Ga0207691_10026805 | Ga0207691_100268052 | 354 |
| 86 | 3300026035 | Ga0207703_10098178 | Ga0207703_100981782 | 354 |
| 87 | 3300026116 | Ga0207674_10347353 | Ga0207674_103473532 | 354 |
| 88 | 3300028379 | Ga0268266_10177191 | Ga0268266_101771912 | 354 |
| 89 | 3300028380 | Ga0268265_10093324 | Ga0268265_100933242 | 354 |
| 90 | 3300005336 | Ga0070680_100122335 | Ga0070680_1001223352 | 355 |
| 91 | 3300045976 | Ga0466967_0171003 | Ga0466967_0171003_494_1777 | 355 |
| 92 | 3300005458 | Ga0070681_10055099 | Ga0070681_100550993 | 356 |
| 93 | 3300005530 | Ga0070679_100016129 | Ga0070679_1000161295 | 356 |
| 94 | 3300006871 | Ga0075434_100069023 | Ga0075434_1000690232 | 356 |
| 95 | 3300025917 | Ga0207660_10088305 | Ga0207660_100883052 | 356 |
| 96 | 3300025921 | Ga0207652_10059986 | Ga0207652_100599863 | 356 |
| 97 | 3300045049 | Ga0466959_0036359 | Ga0466959_0036359_1248_2528 | 356 |
| 98 | 3300005336 | Ga0070680_100000936 | Ga0070680_1000009364 | 357 |
| 99 | 3300005458 | Ga0070681_10006664 | Ga0070681_100066646 | 357 |
| 100 | 3300005530 | Ga0070679_100001015 | Ga0070679_10000101517 | 357 |
| 101 | 3300025912 | Ga0207707_10005323 | Ga0207707_100053235 | 357 |
| 102 | 3300025917 | Ga0207660_10009431 | Ga0207660_100094315 | 357 |
| 103 | 3300025921 | Ga0207652_10008325 | Ga0207652_100083255 | 357 |
| 104 | 3300031548 | Ga0307408_100103737 | Ga0307408_1001037372 | 357 |
| 105 | 3300031911 | Ga0307412_10031368 | Ga0307412_100313682 | 357 |
| 106 | 3300032002 | Ga0307416_100014021 | Ga0307416_1000140212 | 357 |
| 107 | 3300005546 | Ga0070696_100000381 | Ga0070696_1000003813 | 358 |
| 108 | 3300045976 | Ga0466967_0055508 | Ga0466967_0055508_596_1885 | 358 |
| 109 | 3300005564 | Ga0070664_100086142 | Ga0070664_1000861422 | 359 |
| 110 | 3300025944 | Ga0207661_10152717 | Ga0207661_101527172 | 359 |
| 111 | 3300046499 | Ga0495594_0008663 | Ga0495594_0008663_2544_3848 | 359 |
| 112 | 3300046499 | Ga0495594_0003350 | Ga0495594_0003350_3254_4534 | 360 |
| 113 | 3300047319 | Ga0495674_0068466 | Ga0495674_0068466_248_1531 | 360 |
| 114 | 3300005355 | Ga0070671_100139835 | Ga0070671_1001398352 | 362 |
| 115 | 3300005459 | Ga0068867_100118367 | Ga0068867_1001183672 | 362 |
| 116 | 3300009176 | Ga0105242_10107419 | Ga0105242_101074192 | 362 |
| 117 | 3300009177 | Ga0105248_10036024 | Ga0105248_100360242 | 362 |
| 118 | 3300025931 | Ga0207644_10024221 | Ga0207644_100242212 | 362 |
| 119 | 3300025931 | Ga0207644_10069760 | Ga0207644_100697602 | 362 |
| 120 | 3300025934 | Ga0207686_10044803 | Ga0207686_100448033 | 362 |
| 121 | 3300025937 | Ga0207669_10035452 | Ga0207669_100354523 | 362 |
| 122 | 3300026089 | Ga0207648_10005761 | Ga0207648_100057619 | 362 |
| 123 | 3300031901 | Ga0307406_10169640 | Ga0307406_101696402 | 362 |
| 124 | 3300031995 | Ga0307409_100024846 | Ga0307409_1000248464 | 362 |
| 125 | 3300032005 | Ga0307411_10144771 | Ga0307411_101447712 | 362 |
| 126 | 3300013104 | Ga0157370_10025087 | Ga0157370_100250873 | 363 |
| 127 | 3300025913 | Ga0207695_10003856 | Ga0207695_100038566 | 363 |
| 128 | 3300031238 | Ga0265332_10008418 | Ga0265332_100084184 | 363 |
| 129 | 3300046463 | Ga0495653_0127111 | Ga0495653_0127111_474_1778 | 363 |
| 130 | 3300046516 | Ga0495628_0053572 | Ga0495628_0053572_1086_2390 | 363 |
| 131 | 3300046529 | Ga0495652_0024962 | Ga0495652_0024962_1649_2953 | 363 |
| 132 | 3300046535 | Ga0495586_0018355 | Ga0495586_0018355_671_1975 | 363 |
| 133 | 3300046642 | Ga0495634_0034358 | Ga0495634_0034358_369_1673 | 363 |
| 134 | 3300046663 | Ga0495635_0043978 | Ga0495635_0043978_1131_2435 | 363 |
| 135 | 3300046680 | Ga0495646_0017980 | Ga0495646_0017980_2597_3901 | 363 |
| 136 | 3300046809 | Ga0495600_0071453 | Ga0495600_0071453_605_1909 | 363 |
| 137 | 3300047317 | Ga0495604_0080500 | Ga0495604_0080500_831_2135 | 363 |
| 138 | 3300047322 | Ga0495680_0016948 | Ga0495680_0016948_3139_4443 | 363 |
| 139 | 3300047471 | Ga0495684_0004844 | Ga0495684_0004844_4479_5783 | 363 |
| 140 | 3300048088 | Ga0495602_0038925 | Ga0495602_0038925_992_2296 | 363 |
| 141 | 3300050510 | nmdc:mga06r32_95931_c1 | nmdc:mga06r32_95931_c1_95_1384 | 363 |
| 142 | 3300005328 | Ga0070676_10084717 | Ga0070676_100847171 | 364 |
| 143 | 3300005329 | Ga0070683_100000591 | Ga0070683_1000005918 | 364 |
| 144 | 3300005329 | Ga0070683_100023285 | Ga0070683_1000232854 | 364 |
| 145 | 3300005331 | Ga0070670_100011628 | Ga0070670_1000116284 | 364 |
| 146 | 3300005336 | Ga0070680_100000354 | Ga0070680_10000035422 | 364 |
| 147 | 3300005336 | Ga0070680_100035186 | Ga0070680_1000351862 | 364 |
| 148 | 3300005337 | Ga0070682_100000603 | Ga0070682_1000006037 | 364 |
| 149 | 3300005344 | Ga0070661_100059075 | Ga0070661_1000590752 | 364 |
| 150 | 3300005345 | Ga0070692_10032194 | Ga0070692_100321942 | 364 |
| 151 | 3300005353 | Ga0070669_100061493 | Ga0070669_1000614932 | 364 |
| 152 | 3300005356 | Ga0070674_100027116 | Ga0070674_1000271162 | 364 |
| 153 | 3300005458 | Ga0070681_10001240 | Ga0070681_1000124011 | 364 |
| 154 | 3300005458 | Ga0070681_10006631 | Ga0070681_100066314 | 364 |
| 155 | 3300005518 | Ga0070699_100006387 | Ga0070699_1000063873 | 364 |
| 156 | 3300005530 | Ga0070679_100000377 | Ga0070679_10000037713 | 364 |
| 157 | 3300005530 | Ga0070679_100049893 | Ga0070679_1000498934 | 364 |
| 158 | 3300005535 | Ga0070684_100003431 | Ga0070684_1000034315 | 364 |
| 159 | 3300005535 | Ga0070684_100128845 | Ga0070684_1001288452 | 364 |
| 160 | 3300005539 | Ga0068853_100046309 | Ga0068853_1000463093 | 364 |
| 161 | 3300005543 | Ga0070672_100019241 | Ga0070672_1000192414 | 364 |
| 162 | 3300005546 | Ga0070696_100006093 | Ga0070696_1000060934 | 364 |
| 163 | 3300005563 | Ga0068855_100113345 | Ga0068855_1001133453 | 364 |
| 164 | 3300005564 | Ga0070664_100040888 | Ga0070664_1000408882 | 364 |
| 165 | 3300005616 | Ga0068852_100024462 | Ga0068852_1000244624 | 364 |
| 166 | 3300005985 | Ga0081539_10000807 | Ga0081539_1000080727 | 364 |
| 167 | 3300009093 | Ga0105240_10001901 | Ga0105240_1000190128 | 364 |
| 168 | 3300013100 | Ga0157373_10000902 | Ga0157373_100009023 | 364 |
| 169 | 3300013104 | Ga0157370_10004753 | Ga0157370_100047531 | 364 |
| 170 | 3300013307 | Ga0157372_10007393 | Ga0157372_100073933 | 364 |
| 171 | 3300013307 | Ga0157372_10009520 | Ga0157372_100095203 | 364 |
| 172 | 3300013307 | Ga0157372_10010408 | Ga0157372_100104086 | 364 |
| 173 | 3300025907 | Ga0207645_10095276 | Ga0207645_100952762 | 364 |
| 174 | 3300025912 | Ga0207707_10000687 | Ga0207707_100006876 | 364 |
| 175 | 3300025912 | Ga0207707_10005264 | Ga0207707_100052643 | 364 |
| 176 | 3300025913 | Ga0207695_10074847 | Ga0207695_100748472 | 364 |
| 177 | 3300025917 | Ga0207660_10003100 | Ga0207660_100031005 | 364 |
| 178 | 3300025917 | Ga0207660_10133458 | Ga0207660_101334581 | 364 |
| 179 | 3300025920 | Ga0207649_10063549 | Ga0207649_100635492 | 364 |
| 180 | 3300025921 | Ga0207652_10005447 | Ga0207652_100054474 | 364 |
| 181 | 3300025921 | Ga0207652_10030799 | Ga0207652_100307993 | 364 |
| 182 | 3300025923 | Ga0207681_10070515 | Ga0207681_100705151 | 364 |
| 183 | 3300025925 | Ga0207650_10010401 | Ga0207650_100104014 | 364 |
| 184 | 3300025927 | Ga0207687_10076200 | Ga0207687_100762002 | 364 |
| 185 | 3300025937 | Ga0207669_10051363 | Ga0207669_100513633 | 364 |
| 186 | 3300025940 | Ga0207691_10001606 | Ga0207691_100016062 | 364 |
| 187 | 3300025944 | Ga0207661_10002219 | Ga0207661_100022193 | 364 |
| 188 | 3300025944 | Ga0207661_10006853 | Ga0207661_100068535 | 364 |
| 189 | 3300025945 | Ga0207679_10012928 | Ga0207679_100129284 | 364 |
| 190 | 3300025949 | Ga0207667_10115039 | Ga0207667_101150392 | 364 |
| 191 | 3300026023 | Ga0207677_10029375 | Ga0207677_100293753 | 364 |
| 192 | 3300026041 | Ga0207639_10016185 | Ga0207639_100161852 | 364 |
| 193 | 3300026142 | Ga0207698_10006565 | Ga0207698_100065655 | 364 |
| 194 | 3300031731 | Ga0307405_10090490 | Ga0307405_100904902 | 364 |
| 195 | 3300034820 | Ga0373959_0009373 | Ga0373959_0009373_257_1546 | 364 |
| 196 | 3300035691 | Ga0373931_0013436 | Ga0373931_0013436_1101_2390 | 364 |
| 197 | 3300044684 | Ga0466966_0036617 | Ga0466966_0036617_704_1996 | 364 |
| 198 | 3300046476 | Ga0495662_0010984 | Ga0495662_0010984_96_1400 | 364 |
| 199 | 3300046514 | Ga0495618_0009104 | Ga0495618_0009104_4412_5716 | 364 |
| 200 | 3300046516 | Ga0495628_0039563 | Ga0495628_0039563_1229_2533 | 364 |
| 201 | 3300046531 | Ga0495665_0065760 | Ga0495665_0065760_514_1818 | 364 |
| 202 | 3300046533 | Ga0495640_0078971 | Ga0495640_0078971_686_1990 | 364 |
| 203 | 3300046663 | Ga0495635_0008883 | Ga0495635_0008883_507_1811 | 364 |
| 204 | 3300046679 | Ga0495623_0030808 | Ga0495623_0030808_656_1912 | 364 |
| 205 | 3300046680 | Ga0495646_0035527 | Ga0495646_0035527_507_1811 | 364 |
| 206 | 3300046689 | Ga0495613_0014782 | Ga0495613_0014782_3261_4565 | 364 |
| 207 | 3300046690 | Ga0495624_0015111 | Ga0495624_0015111_3126_4430 | 364 |
| 208 | 3300047317 | Ga0495604_0053445 | Ga0495604_0053445_443_1747 | 364 |
| 209 | 3300047444 | Ga0495675_0011414 | Ga0495675_0011414_2019_3323 | 364 |
| 210 | 3300047471 | Ga0495684_0154156 | Ga0495684_0154156_83_1387 | 364 |
| 211 | 3300048915 | Ga0496112_0041965 | Ga0496112_0041965_1763_3052 | 364 |
| 212 | 3300050512 | nmdc:mga0n895_110268_c1 | nmdc:mga0n895_110268_c1_485_1774 | 364 |
| 213 | 3300050515 | nmdc:mga0a205_27712_c1 | nmdc:mga0a205_27712_c1_853_2142 | 364 |
| 214 | 3300005295 | Ga0065707_10149842 | Ga0065707_101498422 | 365 |
| 215 | 3300005331 | Ga0070670_100024459 | Ga0070670_1000244591 | 365 |
| 216 | 3300005434 | Ga0070709_10081114 | Ga0070709_100811142 | 365 |
| 217 | 3300005530 | Ga0070679_100091733 | Ga0070679_1000917332 | 365 |
| 218 | 3300005535 | Ga0070684_100145941 | Ga0070684_1001459412 | 365 |
| 219 | 3300005564 | Ga0070664_100237191 | Ga0070664_1002371912 | 365 |
| 220 | 3300005614 | Ga0068856_100159215 | Ga0068856_1001592151 | 365 |
| 221 | 3300005618 | Ga0068864_100018057 | Ga0068864_1000180572 | 365 |
| 222 | 3300005834 | Ga0068851_10012953 | Ga0068851_100129532 | 365 |
| 223 | 3300013100 | Ga0157373_10080658 | Ga0157373_100806582 | 365 |
| 224 | 3300013296 | Ga0157374_10188367 | Ga0157374_101883672 | 365 |
| 225 | 3300025321 | Ga0207656_10006585 | Ga0207656_100065854 | 365 |
| 226 | 3300025919 | Ga0207657_10265199 | Ga0207657_102651991 | 365 |
| 227 | 3300025932 | Ga0207690_10055504 | Ga0207690_100555042 | 365 |
| 228 | 3300026142 | Ga0207698_10108496 | Ga0207698_101084961 | 365 |
| 229 | 3300035170 | Ga0373943_0029000 | Ga0373943_0029000_1090_2373 | 365 |
| 230 | 3300035172 | Ga0373955_0032852 | Ga0373955_0032852_948_2231 | 365 |
| 231 | 3300035692 | Ga0373935_0045792 | Ga0373935_0045792_332_1615 | 365 |
| 232 | 3300035695 | Ga0373927_0009039 | Ga0373927_0009039_644_1927 | 365 |
| 233 | 3300035724 | Ga0373933_0004863 | Ga0373933_0004863_3015_4298 | 365 |
| 234 | 3300035725 | Ga0373947_0008534 | Ga0373947_0008534_3354_4637 | 365 |
| 235 | 3300036401 | Ga0373937_0001066 | Ga0373937_0001066_3890_5173 | 365 |
| 236 | 3300046462 | Ga0495651_0015258 | Ga0495651_0015258_3925_5208 | 365 |
| 237 | 3300046472 | Ga0495580_0071117 | Ga0495580_0071117_651_1934 | 365 |
| 238 | 3300046499 | Ga0495594_0050773 | Ga0495594_0050773_41_1324 | 365 |
| 239 | 3300046517 | Ga0495630_0096316 | Ga0495630_0096316_444_1727 | 365 |
| 240 | 3300046526 | Ga0495666_0079901 | Ga0495666_0079901_189_1472 | 365 |
| 241 | 3300046531 | Ga0495665_0070948 | Ga0495665_0070948_206_1489 | 365 |
| 242 | 3300046535 | Ga0495586_0052387 | Ga0495586_0052387_597_1880 | 365 |
| 243 | 3300046536 | Ga0495587_0027064 | Ga0495587_0027064_1845_3128 | 365 |
| 244 | 3300046543 | Ga0495645_0000316 | Ga0495645_0000316_16891_18174 | 365 |
| 245 | 3300046559 | Ga0495667_0017754 | Ga0495667_0017754_459_1742 | 365 |
| 246 | 3300046678 | Ga0495599_0017660 | Ga0495599_0017660_1739_3031 | 365 |
| 247 | 3300046679 | Ga0495623_0009840 | Ga0495623_0009840_4516_5799 | 365 |
| 248 | 3300047315 | Ga0495581_0014446 | Ga0495581_0014446_3031_4314 | 365 |
| 249 | 3300053077 | Ga0495601_0083900 | Ga0495601_0083900_289_1572 | 365 |
| 250 | 3300005295 | Ga0065707_10083638 | Ga0065707_100836383 | 366 |
| 251 | 3300005336 | Ga0070680_100076451 | Ga0070680_1000764512 | 366 |
| 252 | 3300005340 | Ga0070689_100000673 | Ga0070689_10000067318 | 366 |
| 253 | 3300005344 | Ga0070661_100129498 | Ga0070661_1001294982 | 366 |
| 254 | 3300005345 | Ga0070692_10014594 | Ga0070692_100145943 | 366 |
| 255 | 3300005347 | Ga0070668_100035536 | Ga0070668_1000355362 | 366 |
| 256 | 3300005366 | Ga0070659_100011079 | Ga0070659_1000110795 | 366 |
| 257 | 3300005367 | Ga0070667_100055906 | Ga0070667_1000559062 | 366 |
| 258 | 3300005435 | Ga0070714_100044819 | Ga0070714_1000448193 | 366 |
| 259 | 3300005438 | Ga0070701_10004493 | Ga0070701_100044932 | 366 |
| 260 | 3300005441 | Ga0070700_100019789 | Ga0070700_1000197893 | 366 |
| 261 | 3300005457 | Ga0070662_100019195 | Ga0070662_1000191952 | 366 |
| 262 | 3300005458 | Ga0070681_10007450 | Ga0070681_100074509 | 366 |
| 263 | 3300005543 | Ga0070672_100002581 | Ga0070672_1000025818 | 366 |
| 264 | 3300005548 | Ga0070665_100171105 | Ga0070665_1001711052 | 366 |
| 265 | 3300005577 | Ga0068857_100166097 | Ga0068857_1001660972 | 366 |
| 266 | 3300005616 | Ga0068852_100169300 | Ga0068852_1001693002 | 366 |
| 267 | 3300005719 | Ga0068861_100003917 | Ga0068861_1000039176 | 366 |
| 268 | 3300005834 | Ga0068851_10022605 | Ga0068851_100226053 | 366 |
| 269 | 3300005841 | Ga0068863_100018014 | Ga0068863_1000180145 | 366 |
| 270 | 3300005842 | Ga0068858_100022669 | Ga0068858_1000226692 | 366 |
| 271 | 3300005843 | Ga0068860_100091863 | Ga0068860_1000918632 | 366 |
| 272 | 3300005844 | Ga0068862_100034981 | Ga0068862_1000349812 | 366 |
| 273 | 3300006881 | Ga0068865_100013641 | Ga0068865_1000136412 | 366 |
| 274 | 3300006914 | Ga0075436_100001320 | Ga0075436_10000132012 | 366 |
| 275 | 3300009093 | Ga0105240_10003398 | Ga0105240_1000339825 | 366 |
| 276 | 3300009098 | Ga0105245_10073359 | Ga0105245_100733593 | 366 |
| 277 | 3300009177 | Ga0105248_10015072 | Ga0105248_100150726 | 366 |
| 278 | 3300009553 | Ga0105249_10013612 | Ga0105249_100136126 | 366 |
| 279 | 3300010375 | Ga0105239_10004555 | Ga0105239_100045555 | 366 |
| 280 | 3300013102 | Ga0157371_10005201 | Ga0157371_100052018 | 366 |
| 281 | 3300013105 | Ga0157369_10002628 | Ga0157369_100026288 | 366 |
| 282 | 3300013306 | Ga0163162_10005796 | Ga0163162_100057962 | 366 |
| 283 | 3300013307 | Ga0157372_10021399 | Ga0157372_100213992 | 366 |
| 284 | 3300014326 | Ga0157380_10017758 | Ga0157380_100177582 | 366 |
| 285 | 3300014968 | Ga0157379_10000965 | Ga0157379_1000096520 | 366 |
| 286 | 3300017792 | Ga0163161_10004493 | Ga0163161_100044936 | 366 |
| 287 | 3300020070 | Ga0206356_11232198 | Ga0206356_112321982 | 366 |
| 288 | 3300025315 | Ga0207697_10003952 | Ga0207697_100039525 | 366 |
| 289 | 3300025912 | Ga0207707_10242879 | Ga0207707_102428792 | 366 |
| 290 | 3300025913 | Ga0207695_10035820 | Ga0207695_100358202 | 366 |
| 291 | 3300025918 | Ga0207662_10000828 | Ga0207662_100008283 | 366 |
| 292 | 3300025920 | Ga0207649_10007484 | Ga0207649_100074845 | 366 |
| 293 | 3300025920 | Ga0207649_10114375 | Ga0207649_101143752 | 366 |
| 294 | 3300025923 | Ga0207681_10002981 | Ga0207681_100029817 | 366 |
| 295 | 3300025926 | Ga0207659_10005914 | Ga0207659_100059142 | 366 |
| 296 | 3300025932 | Ga0207690_10006435 | Ga0207690_100064352 | 366 |
| 297 | 3300025933 | Ga0207706_10001727 | Ga0207706_1000172721 | 366 |
| 298 | 3300025933 | Ga0207706_10050682 | Ga0207706_100506824 | 366 |
| 299 | 3300025936 | Ga0207670_10003234 | Ga0207670_100032342 | 366 |
| 300 | 3300025938 | Ga0207704_10196997 | Ga0207704_101969971 | 366 |
| 301 | 3300025940 | Ga0207691_10000638 | Ga0207691_1000063817 | 366 |
| 302 | 3300025949 | Ga0207667_10025839 | Ga0207667_100258392 | 366 |
| 303 | 3300025961 | Ga0207712_10001624 | Ga0207712_100016249 | 366 |
| 304 | 3300025972 | Ga0207668_10006894 | Ga0207668_100068942 | 366 |
| 305 | 3300026035 | Ga0207703_10023903 | Ga0207703_100239033 | 366 |
| 306 | 3300026041 | Ga0207639_10063638 | Ga0207639_100636382 | 366 |
| 307 | 3300026075 | Ga0207708_10006782 | Ga0207708_100067822 | 366 |
| 308 | 3300026088 | Ga0207641_10019519 | Ga0207641_100195194 | 366 |
| 309 | 3300026089 | Ga0207648_10130827 | Ga0207648_101308272 | 366 |
| 310 | 3300026116 | Ga0207674_10064202 | Ga0207674_100642024 | 366 |
| 311 | 3300026118 | Ga0207675_100000352 | Ga0207675_1000003529 | 366 |
| 312 | 3300026142 | Ga0207698_10035618 | Ga0207698_100356184 | 366 |
| 313 | 3300028379 | Ga0268266_10067410 | Ga0268266_100674102 | 366 |
| 314 | 3300028380 | Ga0268265_10010375 | Ga0268265_100103755 | 366 |
| 315 | 3300028381 | Ga0268264_10014185 | Ga0268264_100141853 | 366 |
| 316 | 3300005338 | Ga0068868_100007265 | Ga0068868_1000072653 | 367 |
| 317 | 3300005441 | Ga0070700_100011573 | Ga0070700_1000115732 | 367 |
| 318 | 3300005445 | Ga0070708_100000006 | Ga0070708_10000000686 | 367 |
| 319 | 3300005459 | Ga0068867_100059685 | Ga0068867_1000596852 | 367 |
| 320 | 3300005468 | Ga0070707_100033032 | Ga0070707_1000330324 | 367 |
| 321 | 3300005539 | Ga0068853_100018830 | Ga0068853_1000188305 | 367 |
| 322 | 3300005544 | Ga0070686_100014493 | Ga0070686_1000144933 | 367 |
| 323 | 3300005578 | Ga0068854_100069469 | Ga0068854_1000694692 | 367 |
| 324 | 3300006881 | Ga0068865_100004921 | Ga0068865_1000049214 | 367 |
| 325 | 3300009551 | Ga0105238_10028857 | Ga0105238_100288575 | 367 |
| 326 | 3300013297 | Ga0157378_10012398 | Ga0157378_100123984 | 367 |
| 327 | 3300025899 | Ga0207642_10027638 | Ga0207642_100276383 | 367 |
| 328 | 3300025907 | Ga0207645_10002866 | Ga0207645_100028663 | 367 |
| 329 | 3300025913 | Ga0207695_10233752 | Ga0207695_102337522 | 367 |
| 330 | 3300025922 | Ga0207646_10018582 | Ga0207646_100185823 | 367 |
| 331 | 3300025924 | Ga0207694_10019538 | Ga0207694_100195382 | 367 |
| 332 | 3300025933 | Ga0207706_10001172 | Ga0207706_1000117217 | 367 |
| 333 | 3300026075 | Ga0207708_10013032 | Ga0207708_100130324 | 367 |
| 334 | 3300026089 | Ga0207648_10077334 | Ga0207648_100773342 | 367 |
| 335 | 3300026118 | Ga0207675_100178855 | Ga0207675_1001788552 | 367 |
| 336 | 3300005328 | Ga0070676_10006200 | Ga0070676_100062005 | 368 |
| 337 | 3300005434 | Ga0070709_10003594 | Ga0070709_100035944 | 368 |
| 338 | 3300005437 | Ga0070710_10128664 | Ga0070710_101286641 | 368 |
| 339 | 3300005834 | Ga0068851_10032374 | Ga0068851_100323742 | 368 |
| 340 | 3300006173 | Ga0070716_100001023 | Ga0070716_1000010234 | 368 |
| 341 | 3300006914 | Ga0075436_100010070 | Ga0075436_1000100703 | 368 |
| 342 | 3300025898 | Ga0207692_10006731 | Ga0207692_100067313 | 368 |
| 343 | 3300025906 | Ga0207699_10007002 | Ga0207699_100070024 | 368 |
| 344 | 3300025907 | Ga0207645_10030281 | Ga0207645_100302812 | 368 |
| 345 | 3300025926 | Ga0207659_10101828 | Ga0207659_101018282 | 368 |
| 346 | 3300025929 | Ga0207664_10056762 | Ga0207664_100567622 | 368 |
| 347 | 3300025939 | Ga0207665_10001133 | Ga0207665_1000113310 | 368 |
| 348 | 3300037312 | Ga0395899_0008510 | Ga0395899_0008510_1309_2595 | 368 |
| 349 | 3300037418 | Ga0395900_0012468 | Ga0395900_0012468_3400_4686 | 368 |
| 350 | 3300037466 | Ga0395898_0081679 | Ga0395898_0081679_455_1741 | 368 |
| 351 | 3300037471 | Ga0395905_0007988 | Ga0395905_0007988_1568_2854 | 368 |
| 352 | 3300038443 | Ga0395901_0002171 | Ga0395901_0002171_5708_6994 | 368 |
| 353 | 3300042876 | Ga0451577_0000001 | Ga0451577_0000001_443369_444637 | 368 |
| 354 | 3300047320 | Ga0495672_0001021 | Ga0495672_0001021_11981_13261 | 368 |
| 355 | 3300050513 | nmdc:mga0rr50_156675_c1 | nmdc:mga0rr50_156675_c1_158_1447 | 368 |
| 356 | 3300050514 | nmdc:mga08x19_13541_c1 | nmdc:mga08x19_13541_c1_2831_4120 | 368 |
| 357 | 3300005329 | Ga0070683_100003631 | Ga0070683_1000036315 | 369 |
| 358 | 3300005329 | Ga0070683_100017066 | Ga0070683_1000170662 | 369 |
| 359 | 3300005329 | Ga0070683_100162718 | Ga0070683_1001627182 | 369 |
| 360 | 3300005331 | Ga0070670_100017014 | Ga0070670_1000170142 | 369 |
| 361 | 3300005334 | Ga0068869_100014965 | Ga0068869_1000149654 | 369 |
| 362 | 3300005336 | Ga0070680_100005427 | Ga0070680_1000054276 | 369 |
| 363 | 3300005337 | Ga0070682_100001650 | Ga0070682_1000016504 | 369 |
| 364 | 3300005339 | Ga0070660_100024997 | Ga0070660_1000249972 | 369 |
| 365 | 3300005340 | Ga0070689_100056709 | Ga0070689_1000567093 | 369 |
| 366 | 3300005344 | Ga0070661_100001410 | Ga0070661_1000014103 | 369 |
| 367 | 3300005354 | Ga0070675_100007252 | Ga0070675_1000072522 | 369 |
| 368 | 3300005364 | Ga0070673_100055404 | Ga0070673_1000554042 | 369 |
| 369 | 3300005366 | Ga0070659_100005487 | Ga0070659_1000054876 | 369 |
| 370 | 3300005435 | Ga0070714_100004689 | Ga0070714_1000046892 | 369 |
| 371 | 3300005457 | Ga0070662_100010334 | Ga0070662_1000103342 | 369 |
| 372 | 3300005458 | Ga0070681_10003137 | Ga0070681_100031376 | 369 |
| 373 | 3300005458 | Ga0070681_10034647 | Ga0070681_100346474 | 369 |
| 374 | 3300005458 | Ga0070681_10290222 | Ga0070681_102902222 | 369 |
| 375 | 3300005530 | Ga0070679_100011373 | Ga0070679_1000113734 | 369 |
| 376 | 3300005535 | Ga0070684_100010316 | Ga0070684_1000103165 | 369 |
| 377 | 3300005535 | Ga0070684_100057726 | Ga0070684_1000577262 | 369 |
| 378 | 3300005539 | Ga0068853_100069589 | Ga0068853_1000695893 | 369 |
| 379 | 3300005545 | Ga0070695_100025834 | Ga0070695_1000258342 | 369 |
| 380 | 3300005547 | Ga0070693_100040148 | Ga0070693_1000401483 | 369 |
| 381 | 3300005577 | Ga0068857_100006817 | Ga0068857_1000068173 | 369 |
| 382 | 3300005614 | Ga0068856_100005156 | Ga0068856_1000051562 | 369 |
| 383 | 3300005615 | Ga0070702_100101001 | Ga0070702_1001010012 | 369 |
| 384 | 3300005616 | Ga0068852_100145427 | Ga0068852_1001454271 | 369 |
| 385 | 3300005617 | Ga0068859_100010691 | Ga0068859_1000106916 | 369 |
| 386 | 3300005618 | Ga0068864_100053047 | Ga0068864_1000530472 | 369 |
| 387 | 3300005841 | Ga0068863_100042253 | Ga0068863_1000422533 | 369 |
| 388 | 3300005843 | Ga0068860_100008551 | Ga0068860_1000085516 | 369 |
| 389 | 3300006237 | Ga0097621_100025099 | Ga0097621_1000250992 | 369 |
| 390 | 3300006358 | Ga0068871_100005320 | Ga0068871_1000053203 | 369 |
| 391 | 3300006846 | Ga0075430_100000259 | Ga0075430_1000002596 | 369 |
| 392 | 3300006880 | Ga0075429_100049453 | Ga0075429_1000494532 | 369 |
| 393 | 3300006931 | Ga0097620_100010691 | Ga0097620_1000106916 | 369 |
| 394 | 3300009098 | Ga0105245_10019074 | Ga0105245_100190742 | 369 |
| 395 | 3300009174 | Ga0105241_10031703 | Ga0105241_100317032 | 369 |
| 396 | 3300009177 | Ga0105248_10003532 | Ga0105248_100035325 | 369 |
| 397 | 3300010375 | Ga0105239_10009555 | Ga0105239_1000955510 | 369 |
| 398 | 3300011119 | Ga0105246_10001101 | Ga0105246_100011016 | 369 |
| 399 | 3300013102 | Ga0157371_10002858 | Ga0157371_100028585 | 369 |
| 400 | 3300013102 | Ga0157371_10029869 | Ga0157371_100298694 | 369 |
| 401 | 3300013296 | Ga0157374_10010387 | Ga0157374_100103872 | 369 |
| 402 | 3300013307 | Ga0157372_10022673 | Ga0157372_100226733 | 369 |
| 403 | 3300014745 | Ga0157377_10000658 | Ga0157377_100006582 | 369 |
| 404 | 3300014969 | Ga0157376_10158732 | Ga0157376_101587322 | 369 |
| 405 | 3300025912 | Ga0207707_10017297 | Ga0207707_100172973 | 369 |
| 406 | 3300025912 | Ga0207707_10201141 | Ga0207707_102011412 | 369 |
| 407 | 3300025917 | Ga0207660_10010587 | Ga0207660_100105873 | 369 |
| 408 | 3300025919 | Ga0207657_10052575 | Ga0207657_100525753 | 369 |
| 409 | 3300025920 | Ga0207649_10018842 | Ga0207649_100188422 | 369 |
| 410 | 3300025921 | Ga0207652_10005612 | Ga0207652_100056125 | 369 |
| 411 | 3300025921 | Ga0207652_10191179 | Ga0207652_101911792 | 369 |
| 412 | 3300025925 | Ga0207650_10008654 | Ga0207650_100086543 | 369 |
| 413 | 3300025926 | Ga0207659_10002918 | Ga0207659_100029183 | 369 |
| 414 | 3300025927 | Ga0207687_10004929 | Ga0207687_100049291 | 369 |
| 415 | 3300025929 | Ga0207664_10020683 | Ga0207664_100206834 | 369 |
| 416 | 3300025932 | Ga0207690_10002104 | Ga0207690_100021046 | 369 |
| 417 | 3300025933 | Ga0207706_10008153 | Ga0207706_100081538 | 369 |
| 418 | 3300025936 | Ga0207670_10046930 | Ga0207670_100469303 | 369 |
| 419 | 3300025941 | Ga0207711_10005992 | Ga0207711_100059928 | 369 |
| 420 | 3300025942 | Ga0207689_10001394 | Ga0207689_1000139417 | 369 |
| 421 | 3300025944 | Ga0207661_10000767 | Ga0207661_100007676 | 369 |
| 422 | 3300025944 | Ga0207661_10019807 | Ga0207661_100198072 | 369 |
| 423 | 3300025944 | Ga0207661_10233666 | Ga0207661_102336661 | 369 |
| 424 | 3300025945 | Ga0207679_10001065 | Ga0207679_100010653 | 369 |
| 425 | 3300025949 | Ga0207667_10063713 | Ga0207667_100637132 | 369 |
| 426 | 3300025960 | Ga0207651_10022197 | Ga0207651_100221972 | 369 |
| 427 | 3300025986 | Ga0207658_10268637 | Ga0207658_102686371 | 369 |
| 428 | 3300026078 | Ga0207702_10013163 | Ga0207702_100131635 | 369 |
| 429 | 3300026095 | Ga0207676_10000885 | Ga0207676_1000088514 | 369 |
| 430 | 3300026116 | Ga0207674_10000208 | Ga0207674_1000020826 | 369 |
| 431 | 3300026142 | Ga0207698_10137900 | Ga0207698_101379002 | 369 |
| 432 | 3300028381 | Ga0268264_10024061 | Ga0268264_100240613 | 369 |
| 433 | 3300031548 | Ga0307408_100245839 | Ga0307408_1002458392 | 369 |
| 434 | 3300046459 | Ga0495629_0010738 | Ga0495629_0010738_3824_5110 | 369 |
| 435 | 3300046473 | Ga0495582_0028268 | Ga0495582_0028268_154_1440 | 369 |
| 436 | 3300046536 | Ga0495587_0086894 | Ga0495587_0086894_420_1706 | 369 |
| 437 | 3300046543 | Ga0495645_0011529 | Ga0495645_0011529_4341_5627 | 369 |
| 438 | 3300046683 | Ga0495658_0008175 | Ga0495658_0008175_3528_4814 | 369 |
| 439 | 3300047315 | Ga0495581_0022142 | Ga0495581_0022142_1314_2600 | 369 |
| 440 | 3300005290 | Ga0065712_10090873 | Ga0065712_100908732 | 370 |
| 441 | 3300005458 | Ga0070681_10001953 | Ga0070681_100019537 | 370 |
| 442 | 3300005535 | Ga0070684_100037605 | Ga0070684_1000376053 | 370 |
| 443 | 3300009094 | Ga0111539_10110728 | Ga0111539_101107283 | 370 |
| 444 | 3300009174 | Ga0105241_10000038 | Ga0105241_100000383 | 370 |
| 445 | 3300013306 | Ga0163162_10186244 | Ga0163162_101862442 | 370 |
| 446 | 3300013307 | Ga0157372_10240865 | Ga0157372_102408652 | 370 |
| 447 | 3300013308 | Ga0157375_10164357 | Ga0157375_101643572 | 370 |
| 448 | 3300025911 | Ga0207654_10000036 | Ga0207654_1000003611 | 370 |
| 449 | 3300025912 | Ga0207707_10067629 | Ga0207707_100676292 | 370 |
| 450 | 3300025921 | Ga0207652_10025555 | Ga0207652_100255554 | 370 |
| 451 | 3300025936 | Ga0207670_10088792 | Ga0207670_100887922 | 370 |
| 452 | 3300025941 | Ga0207711_10053193 | Ga0207711_100531932 | 370 |
| 453 | 3300025944 | Ga0207661_10018751 | Ga0207661_100187512 | 370 |
| 454 | 3300026088 | Ga0207641_10023623 | Ga0207641_100236233 | 370 |
| 455 | 3300031824 | Ga0307413_10176570 | Ga0307413_101765702 | 370 |
| 456 | 3300031901 | Ga0307406_10001787 | Ga0307406_100017875 | 370 |
| 457 | 3300031903 | Ga0307407_10064119 | Ga0307407_100641192 | 370 |
| 458 | 3300035170 | Ga0373943_0001771 | Ga0373943_0001771_1327_2604 | 370 |
| 459 | 3300035171 | Ga0373946_0000905 | Ga0373946_0000905_4718_5995 | 370 |
| 460 | 3300035692 | Ga0373935_0002644 | Ga0373935_0002644_7398_8675 | 370 |
| 461 | 3300035725 | Ga0373947_0000797 | Ga0373947_0000797_10345_11622 | 370 |
| 462 | 3300037068 | Ga0373925_0000980 | Ga0373925_0000980_3522_4799 | 370 |
| 463 | 3300046455 | Ga0495603_0004967 | Ga0495603_0004967_1919_3196 | 370 |
| 464 | 3300046459 | Ga0495629_0042012 | Ga0495629_0042012_572_1849 | 370 |
| 465 | 3300046472 | Ga0495580_0000874 | Ga0495580_0000874_17784_19061 | 370 |
| 466 | 3300046473 | Ga0495582_0000142 | Ga0495582_0000142_32430_33707 | 370 |
| 467 | 3300046475 | Ga0495639_0001161 | Ga0495639_0001161_3195_4472 | 370 |
| 468 | 3300046517 | Ga0495630_0003388 | Ga0495630_0003388_2379_3656 | 370 |
| 469 | 3300046531 | Ga0495665_0000009 | Ga0495665_0000009_52860_54137 | 370 |
| 470 | 3300046674 | Ga0495588_0000811 | Ga0495588_0000811_7465_8742 | 370 |
| 471 | 3300046683 | Ga0495658_0001023 | Ga0495658_0001023_6128_7405 | 370 |
| 472 | 3300046689 | Ga0495613_0003686 | Ga0495613_0003686_4028_5305 | 370 |
| 473 | 3300047315 | Ga0495581_0000601 | Ga0495581_0000601_7374_8651 | 370 |
| 474 | 3300047673 | Ga0495593_0000040 | Ga0495593_0000040_7354_8631 | 370 |
| 475 | 3300048089 | Ga0495614_0001591 | Ga0495614_0001591_7374_8651 | 370 |
| 476 | 3300048912 | Ga0496109_0004616 | Ga0496109_0004616_6651_7937 | 370 |
| 477 | 3300048915 | Ga0496112_0042974 | Ga0496112_0042974_1552_2838 | 370 |
| 478 | 3300006847 | Ga0075431_100019818 | Ga0075431_1000198182 | 371 |
| 479 | 3300009094 | Ga0111539_10001571 | Ga0111539_100015714 | 371 |
| 480 | 3300009147 | Ga0114129_10206297 | Ga0114129_102062972 | 371 |
| 481 | 3300021384 | Ga0213876_10015299 | Ga0213876_100152992 | 371 |
| 482 | 3300025893 | Ga0207682_10037499 | Ga0207682_100374991 | 371 |
| 483 | 3300031731 | Ga0307405_10171077 | Ga0307405_101710772 | 371 |
| 484 | 3300039437 | Ga0436365_1118439 | Ga0436365_1118439_693_2000 | 371 |
| 485 | 3300046674 | Ga0495588_0035742 | Ga0495588_0035742_425_1711 | 371 |
| 486 | 3300049568 | Ga0501031_0018939 | Ga0501031_0018939_768_2054 | 371 |
| 487 | 3300049576 | Ga0501040_0011687 | Ga0501040_0011687_1611_2897 | 371 |
| 488 | 3300049578 | Ga0501042_0024925 | Ga0501042_0024925_2676_3962 | 371 |
| 489 | 3300049742 | Ga0501080_0092247 | Ga0501080_0092247_401_1687 | 371 |
| 490 | 3300049743 | Ga0501081_0068983 | Ga0501081_0068983_625_1911 | 371 |
| 491 | 3300049824 | Ga0501045_0014345 | Ga0501045_0014345_2334_3620 | 371 |
| 492 | 3300050509 | nmdc:mga0qj67_53748_c1 | nmdc:mga0qj67_53748_c1_1854_3143 | 371 |
| 493 | 3300050510 | nmdc:mga06r32_371657_c1 | nmdc:mga06r32_371657_c1_34_1323 | 371 |
| 494 | 3300050511 | nmdc:mga08y16_68878_c1 | nmdc:mga08y16_68878_c1_1748_3037 | 371 |
| 495 | 3300005295 | Ga0065707_10110315 | Ga0065707_101103152 | 372 |
| 496 | 3300005331 | Ga0070670_100106425 | Ga0070670_1001064252 | 372 |
| 497 | 3300005347 | Ga0070668_100185610 | Ga0070668_1001856102 | 372 |
| 498 | 3300005353 | Ga0070669_100009719 | Ga0070669_1000097194 | 372 |
| 499 | 3300005441 | Ga0070700_100081208 | Ga0070700_1000812082 | 372 |
| 500 | 3300005471 | Ga0070698_100003289 | Ga0070698_1000032895 | 372 |
| 501 | 3300005471 | Ga0070698_100034805 | Ga0070698_1000348054 | 372 |
| 502 | 3300005543 | Ga0070672_100168701 | Ga0070672_1001687011 | 372 |
| 503 | 3300006028 | Ga0070717_10000852 | Ga0070717_1000085212 | 372 |
| 504 | 3300006852 | Ga0075433_10035407 | Ga0075433_100354073 | 372 |
| 505 | 3300006871 | Ga0075434_100049838 | Ga0075434_1000498382 | 372 |
| 506 | 3300009094 | Ga0111539_10028076 | Ga0111539_100280765 | 372 |
| 507 | 3300009147 | Ga0114129_10148828 | Ga0114129_101488282 | 372 |
| 508 | 3300009553 | Ga0105249_10000131 | Ga0105249_1000013162 | 372 |
| 509 | 3300025915 | Ga0207693_10048697 | Ga0207693_100486973 | 372 |
| 510 | 3300025923 | Ga0207681_10002777 | Ga0207681_100027777 | 372 |
| 511 | 3300025928 | Ga0207700_10000462 | Ga0207700_100004628 | 372 |
| 512 | 3300025933 | Ga0207706_10024841 | Ga0207706_100248413 | 372 |
| 513 | 3300025972 | Ga0207668_10007120 | Ga0207668_100071203 | 372 |
| 514 | 3300026075 | Ga0207708_10018656 | Ga0207708_100186562 | 372 |
| 515 | 3300026089 | Ga0207648_10204247 | Ga0207648_102042472 | 372 |
| 516 | 3300026116 | Ga0207674_10011994 | Ga0207674_100119943 | 372 |
| 517 | 3300026118 | Ga0207675_100012994 | Ga0207675_1000129945 | 372 |
| 518 | 3300028380 | Ga0268265_10000717 | Ga0268265_1000071718 | 372 |
| 519 | 3300049743 | Ga0501081_0062751 | Ga0501081_0062751_1117_2406 | 372 |
| 520 | 3300049822 | Ga0501035_0232737 | Ga0501035_0232737_114_1385 | 372 |
| 521 | 3300050507 | nmdc:mga05p37_121331_c1 | nmdc:mga05p37_121331_c1_1775_3064 | 372 |
| 522 | 3300050510 | nmdc:mga06r32_76361_c1 | nmdc:mga06r32_76361_c1_703_1992 | 372 |
| 523 | 3300050511 | nmdc:mga08y16_24875_c1 | nmdc:mga08y16_24875_c1_3761_5053 | 372 |
| 524 | 3300050512 | nmdc:mga0n895_50160_c1 | nmdc:mga0n895_50160_c1_1083_2372 | 372 |
| 525 | 3300050515 | nmdc:mga0a205_7237_c1 | nmdc:mga0a205_7237_c1_6040_7329 | 372 |
| 526 | 3300005290 | Ga0065712_10121264 | Ga0065712_101212641 | 373 |
| 527 | 3300005293 | Ga0065715_10002581 | Ga0065715_100025814 | 373 |
| 528 | 3300005327 | Ga0070658_10009239 | Ga0070658_100092396 | 373 |
| 529 | 3300005329 | Ga0070683_100027246 | Ga0070683_1000272464 | 373 |
| 530 | 3300005333 | Ga0070677_10046335 | Ga0070677_100463352 | 373 |
| 531 | 3300005337 | Ga0070682_100001339 | Ga0070682_1000013395 | 373 |
| 532 | 3300005354 | Ga0070675_100030544 | Ga0070675_1000305443 | 373 |
| 533 | 3300005436 | Ga0070713_100004613 | Ga0070713_1000046133 | 373 |
| 534 | 3300005441 | Ga0070700_100017080 | Ga0070700_1000170802 | 373 |
| 535 | 3300005445 | Ga0070708_100000557 | Ga0070708_10000055719 | 373 |
| 536 | 3300005468 | Ga0070707_100011264 | Ga0070707_1000112644 | 373 |
| 537 | 3300005530 | Ga0070679_100090680 | Ga0070679_1000906802 | 373 |
| 538 | 3300005536 | Ga0070697_100050303 | Ga0070697_1000503032 | 373 |
| 539 | 3300005539 | Ga0068853_100049463 | Ga0068853_1000494632 | 373 |
| 540 | 3300005545 | Ga0070695_100000817 | Ga0070695_1000008178 | 373 |
| 541 | 3300005563 | Ga0068855_100002065 | Ga0068855_10000206519 | 373 |
| 542 | 3300006844 | Ga0075428_100002736 | Ga0075428_1000027364 | 373 |
| 543 | 3300006846 | Ga0075430_100015905 | Ga0075430_1000159055 | 373 |
| 544 | 3300006847 | Ga0075431_100010472 | Ga0075431_1000104722 | 373 |
| 545 | 3300009093 | Ga0105240_10221102 | Ga0105240_102211022 | 373 |
| 546 | 3300010159 | Ga0099796_10010200 | Ga0099796_100102002 | 373 |
| 547 | 3300013297 | Ga0157378_10039374 | Ga0157378_100393742 | 373 |
| 548 | 3300013307 | Ga0157372_10024142 | Ga0157372_100241424 | 373 |
| 549 | 3300025910 | Ga0207684_10119286 | Ga0207684_101192862 | 373 |
| 550 | 3300025913 | Ga0207695_10273788 | Ga0207695_102737882 | 373 |
| 551 | 3300025921 | Ga0207652_10082019 | Ga0207652_100820192 | 373 |
| 552 | 3300025922 | Ga0207646_10001823 | Ga0207646_1000182314 | 373 |
| 553 | 3300025922 | Ga0207646_10025374 | Ga0207646_100253744 | 373 |
| 554 | 3300025928 | Ga0207700_10004118 | Ga0207700_100041183 | 373 |
| 555 | 3300025929 | Ga0207664_10014464 | Ga0207664_100144645 | 373 |
| 556 | 3300025949 | Ga0207667_10007778 | Ga0207667_100077784 | 373 |
| 557 | 3300026041 | Ga0207639_10072799 | Ga0207639_100727992 | 373 |
| 558 | 3300031548 | Ga0307408_100035072 | Ga0307408_1000350721 | 373 |
| 559 | 3300031824 | Ga0307413_10121346 | Ga0307413_101213462 | 373 |
| 560 | 3300031852 | Ga0307410_10000406 | Ga0307410_1000040615 | 373 |
| 561 | 3300031901 | Ga0307406_10011407 | Ga0307406_100114071 | 373 |
| 562 | 3300031903 | Ga0307407_10003394 | Ga0307407_100033945 | 373 |
| 563 | 3300031911 | Ga0307412_10014392 | Ga0307412_100143924 | 373 |
| 564 | 3300031995 | Ga0307409_100029942 | Ga0307409_1000299424 | 373 |
| 565 | 3300032002 | Ga0307416_100000293 | Ga0307416_10000029313 | 373 |
| 566 | 3300032004 | Ga0307414_10063513 | Ga0307414_100635132 | 373 |
| 567 | 3300032005 | Ga0307411_10015123 | Ga0307411_100151234 | 373 |
| 568 | 3300045051 | Ga0451576_0179464 | Ga0451576_0179464_284_1573 | 373 |
| 569 | 3300048915 | Ga0496112_0091036 | Ga0496112_0091036_1036_2325 | 373 |
| 570 | 3300050510 | nmdc:mga06r32_11221_c1 | nmdc:mga06r32_11221_c1_2091_3380 | 373 |
| 571 | 3300050510 | nmdc:mga06r32_270345_c1 | nmdc:mga06r32_270345_c1_139_1428 | 373 |
| 572 | 3300050513 | nmdc:mga0rr50_54470_c1 | nmdc:mga0rr50_54470_c1_1542_2831 | 373 |
| 573 | 3300005329 | Ga0070683_100022900 | Ga0070683_1000229002 | 374 |
| 574 | 3300005564 | Ga0070664_100030867 | Ga0070664_1000308673 | 374 |
| 575 | 3300025927 | Ga0207687_10135521 | Ga0207687_101355212 | 374 |
| 576 | 3300031251 | Ga0265327_10005655 | Ga0265327_100056553 | 374 |
| 577 | 3300031711 | Ga0265314_10009257 | Ga0265314_100092572 | 374 |
| 578 | 3300050515 | nmdc:mga0a205_22607_c1 | nmdc:mga0a205_22607_c1_3252_4541 | 374 |
| 579 | 3300005290 | Ga0065712_10118316 | Ga0065712_101183161 | 375 |
| 580 | 3300005327 | Ga0070658_10003927 | Ga0070658_100039274 | 375 |
| 581 | 3300005328 | Ga0070676_10069492 | Ga0070676_100694922 | 375 |
| 582 | 3300005335 | Ga0070666_10113029 | Ga0070666_101130292 | 375 |
| 583 | 3300005339 | Ga0070660_100185224 | Ga0070660_1001852242 | 375 |
| 584 | 3300005340 | Ga0070689_100045006 | Ga0070689_1000450062 | 375 |
| 585 | 3300005343 | Ga0070687_100026118 | Ga0070687_1000261182 | 375 |
| 586 | 3300005353 | Ga0070669_100014947 | Ga0070669_1000149474 | 375 |
| 587 | 3300005354 | Ga0070675_100098687 | Ga0070675_1000986872 | 375 |
| 588 | 3300005355 | Ga0070671_100062509 | Ga0070671_1000625092 | 375 |
| 589 | 3300005365 | Ga0070688_100005942 | Ga0070688_1000059424 | 375 |
| 590 | 3300005367 | Ga0070667_100200725 | Ga0070667_1002007252 | 375 |
| 591 | 3300005367 | Ga0070667_100270132 | Ga0070667_1002701321 | 375 |
| 592 | 3300005459 | Ga0068867_100018001 | Ga0068867_1000180014 | 375 |
| 593 | 3300005466 | Ga0070685_10026695 | Ga0070685_100266951 | 375 |
| 594 | 3300005543 | Ga0070672_100002781 | Ga0070672_1000027818 | 375 |
| 595 | 3300005543 | Ga0070672_100019911 | Ga0070672_1000199112 | 375 |
| 596 | 3300005577 | Ga0068857_100023658 | Ga0068857_1000236584 | 375 |
| 597 | 3300005834 | Ga0068851_10030572 | Ga0068851_100305722 | 375 |
| 598 | 3300005840 | Ga0068870_10059539 | Ga0068870_100595392 | 375 |
| 599 | 3300009177 | Ga0105248_10208359 | Ga0105248_102083592 | 375 |
| 600 | 3300009177 | Ga0105248_10250434 | Ga0105248_102504341 | 375 |
| 601 | 3300009177 | Ga0105248_10273841 | Ga0105248_102738412 | 375 |
| 602 | 3300014745 | Ga0157377_10081574 | Ga0157377_100815742 | 375 |
| 603 | 3300025321 | Ga0207656_10065099 | Ga0207656_100650992 | 375 |
| 604 | 3300025904 | Ga0207647_10082828 | Ga0207647_100828282 | 375 |
| 605 | 3300025907 | Ga0207645_10011870 | Ga0207645_100118703 | 375 |
| 606 | 3300025909 | Ga0207705_10020700 | Ga0207705_100207004 | 375 |
| 607 | 3300025918 | Ga0207662_10019617 | Ga0207662_100196173 | 375 |
| 608 | 3300025919 | Ga0207657_10124715 | Ga0207657_101247152 | 375 |
| 609 | 3300025923 | Ga0207681_10007052 | Ga0207681_100070521 | 375 |
| 610 | 3300025926 | Ga0207659_10002226 | Ga0207659_100022262 | 375 |
| 611 | 3300025934 | Ga0207686_10038782 | Ga0207686_100387821 | 375 |
| 612 | 3300025940 | Ga0207691_10070979 | Ga0207691_100709792 | 375 |
| 613 | 3300025940 | Ga0207691_10119919 | Ga0207691_101199192 | 375 |
| 614 | 3300025941 | Ga0207711_10210757 | Ga0207711_102107572 | 375 |
| 615 | 3300025944 | Ga0207661_10021067 | Ga0207661_100210674 | 375 |
| 616 | 3300025944 | Ga0207661_10112683 | Ga0207661_101126832 | 375 |
| 617 | 3300026095 | Ga0207676_10186267 | Ga0207676_101862672 | 375 |
| 618 | 3300026116 | Ga0207674_10009905 | Ga0207674_100099052 | 375 |
| 619 | 3300026116 | Ga0207674_10042626 | Ga0207674_100426264 | 375 |
| 620 | 3300028379 | Ga0268266_10016390 | Ga0268266_100163904 | 375 |
| 621 | 3300031731 | Ga0307405_10002565 | Ga0307405_100025653 | 375 |
| 622 | 3300031731 | Ga0307405_10008225 | Ga0307405_100082252 | 375 |
| 623 | 3300031852 | Ga0307410_10002408 | Ga0307410_100024085 | 375 |
| 624 | 3300031901 | Ga0307406_10003825 | Ga0307406_100038255 | 375 |
| 625 | 3300031903 | Ga0307407_10002412 | Ga0307407_100024124 | 375 |
| 626 | 3300031911 | Ga0307412_10029034 | Ga0307412_100290342 | 375 |
| 627 | 3300031995 | Ga0307409_100003789 | Ga0307409_1000037895 | 375 |
| 628 | 3300032002 | Ga0307416_100126061 | Ga0307416_1001260612 | 375 |
| 629 | 3300032004 | Ga0307414_10012081 | Ga0307414_100120813 | 375 |
| 630 | 3300032004 | Ga0307414_10086585 | Ga0307414_100865852 | 375 |
| 631 | 3300032005 | Ga0307411_10011708 | Ga0307411_100117082 | 375 |
| 632 | 3300045051 | Ga0451576_0081376 | Ga0451576_0081376_66_1349 | 375 |
| 633 | 3300046539 | Ga0495621_0004550 | Ga0495621_0004550_79_1362 | 375 |
| 634 | 3300048090 | Ga0495615_0013186 | Ga0495615_0013186_330_1613 | 375 |
| 635 | 3300048907 | Ga0496104_0233546 | Ga0496104_0233546_450_1730 | 375 |
| 636 | 3300000549 | LJQas_1004512 | LJQas_10045122 | 376 |
| 637 | 3300005327 | Ga0070658_10001116 | Ga0070658_100011164 | 376 |
| 638 | 3300005327 | Ga0070658_10001610 | Ga0070658_1000161012 | 376 |
| 639 | 3300005339 | Ga0070660_100023520 | Ga0070660_1000235203 | 376 |
| 640 | 3300005356 | Ga0070674_100194195 | Ga0070674_1001941952 | 376 |
| 641 | 3300005530 | Ga0070679_100071411 | Ga0070679_1000714112 | 376 |
| 642 | 3300005616 | Ga0068852_100011168 | Ga0068852_1000111684 | 376 |
| 643 | 3300005616 | Ga0068852_100157233 | Ga0068852_1001572332 | 376 |
| 644 | 3300006847 | Ga0075431_100092265 | Ga0075431_1000922652 | 376 |
| 645 | 3300006880 | Ga0075429_100024903 | Ga0075429_1000249035 | 376 |
| 646 | 3300013102 | Ga0157371_10014535 | Ga0157371_100145353 | 376 |
| 647 | 3300013105 | Ga0157369_10023239 | Ga0157369_100232395 | 376 |
| 648 | 3300013105 | Ga0157369_10067494 | Ga0157369_100674942 | 376 |
| 649 | 3300013307 | Ga0157372_10001161 | Ga0157372_100011619 | 376 |
| 650 | 3300013307 | Ga0157372_10006620 | Ga0157372_100066204 | 376 |
| 651 | 3300025909 | Ga0207705_10001150 | Ga0207705_100011504 | 376 |
| 652 | 3300025909 | Ga0207705_10005894 | Ga0207705_100058948 | 376 |
| 653 | 3300025919 | Ga0207657_10001987 | Ga0207657_100019874 | 376 |
| 654 | 3300025919 | Ga0207657_10054966 | Ga0207657_100549663 | 376 |
| 655 | 3300026089 | Ga0207648_10033355 | Ga0207648_100333554 | 376 |
| 656 | 3300026142 | Ga0207698_10002882 | Ga0207698_100028824 | 376 |
| 657 | 3300031731 | Ga0307405_10059148 | Ga0307405_100591482 | 376 |
| 658 | 3300031824 | Ga0307413_10004330 | Ga0307413_100043304 | 376 |
| 659 | 3300031911 | Ga0307412_10166396 | Ga0307412_101663962 | 376 |
| 660 | 3300032002 | Ga0307416_100056918 | Ga0307416_1000569182 | 376 |
| 661 | 3300032002 | Ga0307416_100178347 | Ga0307416_1001783472 | 376 |
| 662 | 3300046499 | Ga0495594_0068855 | Ga0495594_0068855_446_1729 | 376 |
| 663 | 3300048918 | Ga0496115_0132833 | Ga0496115_0132833_220_1503 | 376 |
| 664 | 3300049571 | Ga0501034_0203830 | Ga0501034_0203830_116_1396 | 376 |
| 665 | 3300049574 | Ga0501038_0021849 | Ga0501038_0021849_3490_4770 | 376 |
| 666 | 3300049579 | Ga0501043_0032922 | Ga0501043_0032922_991_2271 | 376 |
| 667 | 3300049581 | Ga0501047_0002061 | Ga0501047_0002061_4737_6017 | 376 |
| 668 | 3300049586 | Ga0501070_0007886 | Ga0501070_0007886_5371_6651 | 376 |
| 669 | 3300050508 | nmdc:mga09592_21081_c1 | nmdc:mga09592_21081_c1_3183_4472 | 376 |
| 670 | 3300050509 | nmdc:mga0qj67_24446_c1 | nmdc:mga0qj67_24446_c1_3240_4529 | 376 |
| 671 | 3300050510 | nmdc:mga06r32_196984_c1 | nmdc:mga06r32_196984_c1_186_1475 | 376 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cdx-assembly1.cif.gz_B | crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides | 0.8416 | 62 | 92 |
| 5vz0-assembly1.cif.gz_A | crystal structure of lactococcus lactis pyruvate carboxylase g746a mutant in complex with cyclic-di-amp | 0.8283 | 62 | 173 |
| 7ybu-assembly1.cif.gz_A | human propionyl-coenzyme a carboxylase | 0.8283 | 58 | 173 |
| 5gu9-assembly1.cif.gz_A | structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant | 0.8256 | 62 | 172 |
| 7wta-assembly1.cif.gz_D | cryo-em structure of human pyruvate carboxylase in apo state | 0.8248 | 62 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3t51B01 | Mainly Beta;Beta Barrel;conserved putative lor/sdh protein from methanococcus maripaludis s2 fold; | 0.891 | 268 | 346 | 2.40.420.20 |
| 4l8jA03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8887 | 59 | 175 | 2.40.50.100 |
| 4kkuA01 | Mainly Beta;Beta Barrel;conserved putative lor/sdh protein from methanococcus maripaludis s2 fold; | 0.8797 | 268 | 363 | 2.40.420.20 |
| af_Q553S7_647_713_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8767 | 63 | 155 | 2.40.50.100 |
| af_Q54KE6_633_699_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8762 | 63 | 172 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5T1M2-F1-model_v4 | Efflux RND transporter periplasmic adaptor subunit | 0.7719 | 28 | 363 |
GO:0015562
GO:1990281 |
| AF-A0A2D7SQW6-F1-model_v4 | Efflux transporter periplasmic adaptor subunit | 0.7678 | 30 | 362 |
GO:0015562
GO:1990281 |
| AF-A0A1Y6KGQ7-F1-model_v4 | Multidrug resistance efflux pump | 0.767 | 45 | 261 |
GO:0016020
|
| AF-A0A2E7GEI6-F1-model_v4 | deleted | 0.766 | 27 | 351 |
|
| AF-Q6MGV3-F1-model_v4 | RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein | 0.7619 | 28 | 363 |
GO:0015562
GO:1990281 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar