F474169

General Info

Members Datasets Scaffolds Average Seq Length
671 290 671 390

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10005655|Ga0265327_100056553
Length 430
Sequence MSKGMKYGILAVVVMAIGGVVAVTMQKNNNKSTEVRIESVEKRDLVSSVTASGQVRPHTKVDLSSDISGKIVKLSVKEGDYVKQGQFLLQIDPLTYESAVQQAEAQLSNQKAAQAQTQANLVQAQNNYRRSLEIRQSNPNLVAADQLEQLKTAVEVNTAMLEAAKHNVEQAQASVKTQKLNLDKTTIYAPMAGRVTRLVVENGETAVPGTFNKDAATLLTISDMSVLETKVKVDETDVSRIHLGDSTIVQLDAFPDTTFIGKVVEISNSSVKGTTTSTGDQAIDYEVTVRLLNPPKDTKPDFSATAKIITDSRTKVLSIPIIALTVRENEALASADTAQRPGAKQQNAKQVGKKDVEGVFVVGTDNKVTFKPVKVGIAGEKHFEVLSGLKEGDKIVAGTYQAIRELKDGTLVREAKQPDKKPGTPGSTKP

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
260 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.89
Rhizosphere 98.81
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1004512 3300000549 Bacteria 1808
2 Ga0065712_10090873 3300005290 Bacteria 2400
3 Ga0065712_10118316 3300005290 Bacteria 1708
4 Ga0065712_10121264 3300005290 Bacteria 1667
5 Ga0065715_10002581 3300005293 Bacteria 6107
6 Ga0065707_10083638 3300005295 Bacteria 8568
7 Ga0065707_10110315 3300005295 Bacteria 2435
8 Ga0065707_10149842 3300005295 Unclassified 1671
9 Ga0070658_10001116 3300005327 Bacteria 22923
10 Ga0070658_10001610 3300005327 Bacteria 19101
11 Ga0070658_10003927 3300005327 Bacteria 12192
12 Ga0070658_10009239 3300005327 Bacteria 7925
13 Ga0070676_10006200 3300005328 Bacteria 6385
14 Ga0070676_10069492 3300005328 Bacteria 2111
15 Ga0070676_10084717 3300005328 Bacteria 1930
16 Ga0070683_100000591 3300005329 Bacteria 25943
17 Ga0070683_100001864 3300005329 Bacteria 16460
18 Ga0070683_100003631 3300005329 Bacteria 12573
19 Ga0070683_100017066 3300005329 Bacteria 6408
20 Ga0070683_100022900 3300005329 Bacteria 5585
21 Ga0070683_100023285 3300005329 Bacteria 5539
22 Ga0070683_100027246 3300005329 Bacteria 5152
23 Ga0070683_100162718 3300005329 Bacteria 2117
24 Ga0070670_100011628 3300005331 Bacteria 7527
25 Ga0070670_100017014 3300005331 Bacteria 6240
26 Ga0070670_100024459 3300005331 Bacteria 5193
27 Ga0070670_100106425 3300005331 Bacteria 2417
28 Ga0070677_10046335 3300005333 Bacteria 1738
29 Ga0068869_100014965 3300005334 Bacteria 5188
30 Ga0070666_10113029 3300005335 Unclassified 1879
31 Ga0070666_10193435 3300005335 Bacteria 1430
32 Ga0070680_100000354 3300005336 Bacteria 30834
33 Ga0070680_100000936 3300005336 Bacteria 20644
34 Ga0070680_100005427 3300005336 Bacteria 9656
35 Ga0070680_100035186 3300005336 Bacteria 4042
36 Ga0070680_100076451 3300005336 Bacteria 2756
37 Ga0070680_100122335 3300005336 Bacteria 2173
38 Ga0070682_100000603 3300005337 Bacteria 21874
39 Ga0070682_100001339 3300005337 Bacteria 13916
40 Ga0070682_100001650 3300005337 Bacteria 12403
41 Ga0068868_100007265 3300005338 Bacteria 7880
42 Ga0070660_100023520 3300005339 Bacteria 4564
43 Ga0070660_100024997 3300005339 Bacteria 4436
44 Ga0070660_100185224 3300005339 Unclassified 1685
45 Ga0070689_100000673 3300005340 Bacteria 20688
46 Ga0070689_100045006 3300005340 Bacteria 3397
47 Ga0070689_100056709 3300005340 Bacteria 3038
48 Ga0070687_100026118 3300005343 Bacteria 2809
49 Ga0070661_100001410 3300005344 Bacteria 16773
50 Ga0070661_100059075 3300005344 Bacteria 2811
51 Ga0070661_100129498 3300005344 Bacteria 1894
52 Ga0070692_10014594 3300005345 Bacteria 3695
53 Ga0070692_10032194 3300005345 Bacteria 2635
54 Ga0070668_100035536 3300005347 Bacteria 3800
55 Ga0070668_100185610 3300005347 Bacteria 1701
56 Ga0070669_100009719 3300005353 Bacteria 6852
57 Ga0070669_100014947 3300005353 Bacteria 5531
58 Ga0070669_100061493 3300005353 Bacteria 2760
59 Ga0070675_100007252 3300005354 Bacteria 8552
60 Ga0070675_100030544 3300005354 Bacteria 4350
61 Ga0070675_100046839 3300005354 Bacteria 3542
62 Ga0070675_100098687 3300005354 Bacteria 2457
63 Ga0070671_100062509 3300005355 Bacteria 3100
64 Ga0070671_100139835 3300005355 Bacteria 2043
65 Ga0070674_100027116 3300005356 Bacteria 3751
66 Ga0070674_100194195 3300005356 Bacteria 1563
67 Ga0070673_100055404 3300005364 Bacteria 3124
68 Ga0070688_100005942 3300005365 Bacteria 6467
69 Ga0070688_100010144 3300005365 Bacteria 5182
70 Ga0070659_100005487 3300005366 Bacteria 9113
71 Ga0070659_100011079 3300005366 Bacteria 6661
72 Ga0070667_100055906 3300005367 Bacteria 3333
73 Ga0070667_100062461 3300005367 Bacteria 3155
74 Ga0070667_100200725 3300005367 Bacteria 1770
75 Ga0070667_100270132 3300005367 Bacteria 1524
76 Ga0070709_10003594 3300005434 Bacteria 8328
77 Ga0070709_10081114 3300005434 Bacteria 2116
78 Ga0070714_100004689 3300005435 Bacteria 10333
79 Ga0070714_100044819 3300005435 Bacteria 3745
80 Ga0070713_100004613 3300005436 Bacteria 9292
81 Ga0070710_10128664 3300005437 Bacteria 1541
82 Ga0070701_10004493 3300005438 Bacteria 5660
83 Ga0070700_100011573 3300005441 Bacteria 4890
84 Ga0070700_100017080 3300005441 Bacteria 4143
85 Ga0070700_100019789 3300005441 Bacteria 3890
86 Ga0070700_100081208 3300005441 Bacteria 2094
87 Ga0070694_100190379 3300005444 Unclassified 1523
88 Ga0070708_100000006 3300005445 Bacteria 150596
89 Ga0070708_100000557 3300005445 Bacteria 27909
90 Ga0070662_100010334 3300005457 Bacteria 6119
91 Ga0070662_100019195 3300005457 Bacteria 4638
92 Ga0070681_10001240 3300005458 Bacteria 22205
93 Ga0070681_10001953 3300005458 Bacteria 18621
94 Ga0070681_10003137 3300005458 Bacteria 15352
95 Ga0070681_10006631 3300005458 Bacteria 11274
96 Ga0070681_10006664 3300005458 Bacteria 11240
97 Ga0070681_10007450 3300005458 Bacteria 10696
98 Ga0070681_10034647 3300005458 Bacteria 5070
99 Ga0070681_10055099 3300005458 Bacteria 3961
100 Ga0070681_10290222 3300005458 Bacteria 1546
101 Ga0068867_100018001 3300005459 Bacteria 5020
102 Ga0068867_100059685 3300005459 Bacteria 2827
103 Ga0068867_100118367 3300005459 Bacteria 2043
104 Ga0070685_10026695 3300005466 Bacteria 3185
105 Ga0070707_100011264 3300005468 Bacteria 8336
106 Ga0070707_100033032 3300005468 Bacteria 4932
107 Ga0070698_100003289 3300005471 Bacteria 17769
108 Ga0070698_100034805 3300005471 Bacteria 5211
109 Ga0070699_100006387 3300005518 Bacteria 10270
110 Ga0070679_100000377 3300005530 Bacteria 37955
111 Ga0070679_100001015 3300005530 Bacteria 24474
112 Ga0070679_100011373 3300005530 Bacteria 8478
113 Ga0070679_100015185 3300005530 Bacteria 7399
114 Ga0070679_100016129 3300005530 Bacteria 7198
115 Ga0070679_100049893 3300005530 Unclassified 4168
116 Ga0070679_100071411 3300005530 Bacteria 3463
117 Ga0070679_100090680 3300005530 Bacteria 3045
118 Ga0070679_100091733 3300005530 Bacteria 3025
119 Ga0070684_100003431 3300005535 Bacteria 11901
120 Ga0070684_100010316 3300005535 Bacteria 7397
121 Ga0070684_100037605 3300005535 Bacteria 4153
122 Ga0070684_100057726 3300005535 Bacteria 3390
123 Ga0070684_100128845 3300005535 Bacteria 2282
124 Ga0070684_100145941 3300005535 Bacteria 2142
125 Ga0070697_100050303 3300005536 Bacteria 3382
126 Ga0068853_100018830 3300005539 Bacteria 5717
127 Ga0068853_100046309 3300005539 Bacteria 3729
128 Ga0068853_100049463 3300005539 Bacteria 3613
129 Ga0068853_100069589 3300005539 Bacteria 3062
130 Ga0070672_100002581 3300005543 Bacteria 11562
131 Ga0070672_100002781 3300005543 Bacteria 11217
132 Ga0070672_100019241 3300005543 Bacteria 4953
133 Ga0070672_100019911 3300005543 Bacteria 4882
134 Ga0070672_100168701 3300005543 Bacteria 1819
135 Ga0070686_100014493 3300005544 Bacteria 4547
136 Ga0070695_100000817 3300005545 Bacteria 16786
137 Ga0070695_100025834 3300005545 Bacteria 3629
138 Ga0070696_100000381 3300005546 Bacteria 27159
139 Ga0070696_100006093 3300005546 Bacteria 8054
140 Ga0070696_100076638 3300005546 Bacteria 2361
141 Ga0070693_100040148 3300005547 Bacteria 2626
142 Ga0070665_100171105 3300005548 Bacteria 2173
143 Ga0070665_100223932 3300005548 Unclassified 1882
144 Ga0068855_100002065 3300005563 Bacteria 24885
145 Ga0068855_100113345 3300005563 Bacteria 3111
146 Ga0068855_100334178 3300005563 Bacteria 1672
147 Ga0070664_100030867 3300005564 Bacteria 4473
148 Ga0070664_100040888 3300005564 Bacteria 3911
149 Ga0070664_100086142 3300005564 Bacteria 2714
150 Ga0070664_100237191 3300005564 Bacteria 1636
151 Ga0068857_100006817 3300005577 Bacteria 9833
152 Ga0068857_100023658 3300005577 Bacteria 5409
153 Ga0068857_100166097 3300005577 Bacteria 2004
154 Ga0068854_100004227 3300005578 Bacteria 9039
155 Ga0068854_100069469 3300005578 Bacteria 2572
156 Ga0068856_100005156 3300005614 Bacteria 12897
157 Ga0068856_100159215 3300005614 Bacteria 2268
158 Ga0070702_100101001 3300005615 Unclassified 1769
159 Ga0068852_100003906 3300005616 Bacteria 10471
160 Ga0068852_100011168 3300005616 Bacteria 6746
161 Ga0068852_100024462 3300005616 Bacteria 4881
162 Ga0068852_100145427 3300005616 Bacteria 2198
163 Ga0068852_100157233 3300005616 Bacteria 2119
164 Ga0068852_100169300 3300005616 Bacteria 2046
165 Ga0068859_100010691 3300005617 Bacteria 9239
166 Ga0068864_100018057 3300005618 Bacteria 5887
167 Ga0068864_100053047 3300005618 Bacteria 3496
168 Ga0068861_100003917 3300005719 Bacteria 9952
169 Ga0068861_100215266 3300005719 Unclassified 1621
170 Ga0068851_10012953 3300005834 Bacteria 3939
171 Ga0068851_10022605 3300005834 Bacteria 3067
172 Ga0068851_10030572 3300005834 Bacteria 2671
173 Ga0068851_10032374 3300005834 Unclassified 2602
174 Ga0068870_10059539 3300005840 Bacteria 2047
175 Ga0068863_100018014 3300005841 Bacteria 6760
176 Ga0068863_100042253 3300005841 Bacteria 4332
177 Ga0068858_100022669 3300005842 Bacteria 5857
178 Ga0068860_100008551 3300005843 Bacteria 10201
179 Ga0068860_100091863 3300005843 Bacteria 2892
180 Ga0068862_100034981 3300005844 Bacteria 4252
181 Ga0068862_100173579 3300005844 Bacteria 1931
182 Ga0081539_10000807 3300005985 Bacteria 60932
183 Ga0070717_10000852 3300006028 Bacteria 20225
184 Ga0070716_100001023 3300006173 Bacteria 12231
185 Ga0097621_100025099 3300006237 Bacteria 4661
186 Ga0068871_100005320 3300006358 Bacteria 9019
187 Ga0075428_100002736 3300006844 Bacteria 19192
188 Ga0075430_100000259 3300006846 Bacteria 37106
189 Ga0075430_100015905 3300006846 Bacteria 6407
190 Ga0075431_100010472 3300006847 Bacteria 9325
191 Ga0075431_100019818 3300006847 Bacteria 6867
192 Ga0075431_100092265 3300006847 Bacteria 3126
193 Ga0075433_10035407 3300006852 Bacteria 4293
194 Ga0075434_100049838 3300006871 Bacteria 4159
195 Ga0075434_100069023 3300006871 Bacteria 3523
196 Ga0075429_100024903 3300006880 Bacteria 5194
197 Ga0075429_100049453 3300006880 Bacteria 3656
198 Ga0068865_100004921 3300006881 Bacteria 8075
199 Ga0068865_100013641 3300006881 Bacteria 5144
200 Ga0075436_100001320 3300006914 Bacteria 16853
201 Ga0075436_100010070 3300006914 Bacteria 6468
202 Ga0097620_100010691 3300006931 Bacteria 9239
203 Ga0105240_10001901 3300009093 Bacteria 34675
204 Ga0105240_10003398 3300009093 Bacteria 24750
205 Ga0105240_10221102 3300009093 Bacteria 2206
206 Ga0111539_10001571 3300009094 Bacteria 30396
207 Ga0111539_10028076 3300009094 Bacteria 6870
208 Ga0111539_10110728 3300009094 Bacteria 3222
209 Ga0105245_10019074 3300009098 Bacteria 6004
210 Ga0105245_10073359 3300009098 Bacteria 3112
211 Ga0114129_10148828 3300009147 Bacteria 3205
212 Ga0114129_10206297 3300009147 Bacteria 2659
213 Ga0105241_10000038 3300009174 Bacteria 115211
214 Ga0105241_10031703 3300009174 Bacteria 3958
215 Ga0105242_10107419 3300009176 Bacteria 2374
216 Ga0105248_10003532 3300009177 Bacteria 17338
217 Ga0105248_10015072 3300009177 Bacteria 8512
218 Ga0105248_10036024 3300009177 Bacteria 5534
219 Ga0105248_10208359 3300009177 Bacteria 2203
220 Ga0105248_10250434 3300009177 Bacteria 1994
221 Ga0105248_10273841 3300009177 Bacteria 1901
222 Ga0105238_10028857 3300009551 Bacteria 5651
223 Ga0105249_10000131 3300009553 Bacteria 99448
224 Ga0105249_10013612 3300009553 Bacteria 7184
225 Ga0105249_10124839 3300009553 Bacteria 2450
226 Ga0099796_10010200 3300010159 Bacteria 2574
227 Ga0105239_10004555 3300010375 Bacteria 16518
228 Ga0105239_10009555 3300010375 Bacteria 10914
229 Ga0105246_10001101 3300011119 Bacteria 15683
230 Ga0157373_10000902 3300013100 Bacteria 23019
231 Ga0157373_10080658 3300013100 Bacteria 2294
232 Ga0157371_10002858 3300013102 Bacteria 16135
233 Ga0157371_10005201 3300013102 Bacteria 11063
234 Ga0157371_10014535 3300013102 Bacteria 5938
235 Ga0157371_10029869 3300013102 Bacteria 3935
236 Ga0157370_10004753 3300013104 Bacteria 15461
237 Ga0157370_10025087 3300013104 Bacteria 5901
238 Ga0157369_10002628 3300013105 Bacteria 21471
239 Ga0157369_10023239 3300013105 Bacteria 6908
240 Ga0157369_10067494 3300013105 Bacteria 3845
241 Ga0157374_10010387 3300013296 Bacteria 8008
242 Ga0157374_10188367 3300013296 Bacteria 2018
243 Ga0157378_10012398 3300013297 Bacteria 7463
244 Ga0157378_10039374 3300013297 Bacteria 4192
245 Ga0163162_10005796 3300013306 Bacteria 11954
246 Ga0163162_10177202 3300013306 Bacteria 2257
247 Ga0163162_10186244 3300013306 Bacteria 2203
248 Ga0157372_10001161 3300013307 Bacteria 28502
249 Ga0157372_10006620 3300013307 Bacteria 12331
250 Ga0157372_10007393 3300013307 Bacteria 11682
251 Ga0157372_10009520 3300013307 Bacteria 10327
252 Ga0157372_10010408 3300013307 Bacteria 9888
253 Ga0157372_10021399 3300013307 Bacteria 6987
254 Ga0157372_10022673 3300013307 Bacteria 6795
255 Ga0157372_10024142 3300013307 Bacteria 6599
256 Ga0157372_10240865 3300013307 Bacteria 2099
257 Ga0157375_10009308 3300013308 Bacteria 8622
258 Ga0157375_10164357 3300013308 Bacteria 2363
259 Ga0157380_10017758 3300014326 Bacteria 5270
260 Ga0157377_10000658 3300014745 Bacteria 14409
261 Ga0157377_10081574 3300014745 Bacteria 1892
262 Ga0157379_10000965 3300014968 Bacteria 23357
263 Ga0157376_10158732 3300014969 Bacteria 2047
264 Ga0163161_10004493 3300017792 Bacteria 9702
265 Ga0206356_11232198 3300020070 Bacteria 1621
266 Ga0213876_10015299 3300021384 Bacteria 4062
267 Ga0207697_10003952 3300025315 Bacteria 7208
268 Ga0207656_10006585 3300025321 Bacteria 4188
269 Ga0207656_10065099 3300025321 Unclassified 1608
270 Ga0207682_10037499 3300025893 Bacteria 1964
271 Ga0207692_10006731 3300025898 Bacteria 4672
272 Ga0207642_10027638 3300025899 Bacteria 2324
273 Ga0207647_10082828 3300025904 Bacteria 1921
274 Ga0207699_10007002 3300025906 Bacteria 5492
275 Ga0207645_10002866 3300025907 Bacteria 13360
276 Ga0207645_10011870 3300025907 Bacteria 5929
277 Ga0207645_10030281 3300025907 Bacteria 3487
278 Ga0207645_10095276 3300025907 Bacteria 1916
279 Ga0207705_10001150 3300025909 Bacteria 21556
280 Ga0207705_10005894 3300025909 Bacteria 9109
281 Ga0207705_10020700 3300025909 Bacteria 4697
282 Ga0207684_10119286 3300025910 Bacteria 2261
283 Ga0207654_10000036 3300025911 Bacteria 110335
284 Ga0207707_10000687 3300025912 Bacteria 33610
285 Ga0207707_10001596 3300025912 Bacteria 20889
286 Ga0207707_10005264 3300025912 Bacteria 11328
287 Ga0207707_10005323 3300025912 Bacteria 11243
288 Ga0207707_10017297 3300025912 Bacteria 6284
289 Ga0207707_10067629 3300025912 Bacteria 3112
290 Ga0207707_10201141 3300025912 Bacteria 1737
291 Ga0207707_10222975 3300025912 Bacteria 1641
292 Ga0207707_10242879 3300025912 Bacteria 1565
293 Ga0207695_10001210 3300025913 Bacteria 44236
294 Ga0207695_10003856 3300025913 Bacteria 20757
295 Ga0207695_10035820 3300025913 Bacteria 5373
296 Ga0207695_10074847 3300025913 Bacteria 3447
297 Ga0207695_10233752 3300025913 Bacteria 1742
298 Ga0207695_10273788 3300025913 Bacteria 1583
299 Ga0207693_10048697 3300025915 Bacteria 3328
300 Ga0207660_10000728 3300025917 Bacteria 21885
301 Ga0207660_10003100 3300025917 Bacteria 10866
302 Ga0207660_10009431 3300025917 Bacteria 6318
303 Ga0207660_10010587 3300025917 Bacteria 5990
304 Ga0207660_10088305 3300025917 Bacteria 2292
305 Ga0207660_10133458 3300025917 Bacteria 1892
306 Ga0207662_10000828 3300025918 Bacteria 14238
307 Ga0207662_10019617 3300025918 Bacteria 3851
308 Ga0207657_10001987 3300025919 Bacteria 22084
309 Ga0207657_10052575 3300025919 Bacteria 3535
310 Ga0207657_10054966 3300025919 Bacteria 3441
311 Ga0207657_10124715 3300025919 Bacteria 2116
312 Ga0207657_10265199 3300025919 Bacteria 1366
313 Ga0207649_10007484 3300025920 Bacteria 5937
314 Ga0207649_10018842 3300025920 Bacteria 3935
315 Ga0207649_10063549 3300025920 Bacteria 2331
316 Ga0207649_10114375 3300025920 Bacteria 1808
317 Ga0207652_10000336 3300025921 Bacteria 48795
318 Ga0207652_10005447 3300025921 Bacteria 10327
319 Ga0207652_10005612 3300025921 Bacteria 10177
320 Ga0207652_10008325 3300025921 Bacteria 8337
321 Ga0207652_10025555 3300025921 Bacteria 4911
322 Ga0207652_10030799 3300025921 Bacteria 4497
323 Ga0207652_10059986 3300025921 Bacteria 3281
324 Ga0207652_10082019 3300025921 Bacteria 2821
325 Ga0207652_10191179 3300025921 Bacteria 1841
326 Ga0207646_10001823 3300025922 Bacteria 25742
327 Ga0207646_10018582 3300025922 Bacteria 6481
328 Ga0207646_10025374 3300025922 Bacteria 5422
329 Ga0207681_10002777 3300025923 Bacteria 11078
330 Ga0207681_10002981 3300025923 Bacteria 10638
331 Ga0207681_10007052 3300025923 Bacteria 6896
332 Ga0207681_10070515 3300025923 Bacteria 2434
333 Ga0207681_10142632 3300025923 Bacteria 1786
334 Ga0207694_10019538 3300025924 Bacteria 5122
335 Ga0207650_10008654 3300025925 Bacteria 6951
336 Ga0207650_10010401 3300025925 Bacteria 6378
337 Ga0207659_10002226 3300025926 Bacteria 11551
338 Ga0207659_10002918 3300025926 Bacteria 10184
339 Ga0207659_10005914 3300025926 Bacteria 7470
340 Ga0207659_10101828 3300025926 Bacteria 2167
341 Ga0207687_10004929 3300025927 Bacteria 8863
342 Ga0207687_10076200 3300025927 Bacteria 2408
343 Ga0207687_10135521 3300025927 Bacteria 1862
344 Ga0207700_10000462 3300025928 Bacteria 23848
345 Ga0207700_10004118 3300025928 Bacteria 8531
346 Ga0207664_10014464 3300025929 Bacteria 5699
347 Ga0207664_10020683 3300025929 Bacteria 4884
348 Ga0207664_10056762 3300025929 Bacteria 3111
349 Ga0207644_10024221 3300025931 Bacteria 4165
350 Ga0207644_10069760 3300025931 Bacteria 2567
351 Ga0207690_10002104 3300025932 Bacteria 12194
352 Ga0207690_10006435 3300025932 Bacteria 6961
353 Ga0207690_10055504 3300025932 Bacteria 2668
354 Ga0207706_10001172 3300025933 Bacteria 26572
355 Ga0207706_10001727 3300025933 Bacteria 21522
356 Ga0207706_10008153 3300025933 Bacteria 9663
357 Ga0207706_10024841 3300025933 Bacteria 5371
358 Ga0207706_10050682 3300025933 Bacteria 3668
359 Ga0207686_10038782 3300025934 Bacteria 2885
360 Ga0207686_10044803 3300025934 Bacteria 2718
361 Ga0207670_10003234 3300025936 Bacteria 8632
362 Ga0207670_10046930 3300025936 Bacteria 2873
363 Ga0207670_10088792 3300025936 Bacteria 2181
364 Ga0207670_10173053 3300025936 Unclassified 1620
365 Ga0207669_10035452 3300025937 Bacteria 2839
366 Ga0207669_10051363 3300025937 Bacteria 2470
367 Ga0207704_10196997 3300025938 Bacteria 1471
368 Ga0207665_10001133 3300025939 Bacteria 17938
369 Ga0207691_10000638 3300025940 Bacteria 34615
370 Ga0207691_10001606 3300025940 Bacteria 22446
371 Ga0207691_10026805 3300025940 Bacteria 5408
372 Ga0207691_10070979 3300025940 Bacteria 3144
373 Ga0207691_10119919 3300025940 Bacteria 2332
374 Ga0207711_10005992 3300025941 Bacteria 10275
375 Ga0207711_10053193 3300025941 Bacteria 3472
376 Ga0207711_10210757 3300025941 Bacteria 1775
377 Ga0207689_10001394 3300025942 Bacteria 23050
378 Ga0207661_10000767 3300025944 Bacteria 20823
379 Ga0207661_10002219 3300025944 Bacteria 13404
380 Ga0207661_10006853 3300025944 Bacteria 8076
381 Ga0207661_10018751 3300025944 Bacteria 5147
382 Ga0207661_10019807 3300025944 Bacteria 5021
383 Ga0207661_10021067 3300025944 Bacteria 4882
384 Ga0207661_10112683 3300025944 Bacteria 2303
385 Ga0207661_10152717 3300025944 Bacteria 1997
386 Ga0207661_10233666 3300025944 Unclassified 1629
387 Ga0207679_10001065 3300025945 Bacteria 17442
388 Ga0207679_10012928 3300025945 Bacteria 5462
389 Ga0207667_10007778 3300025949 Bacteria 12815
390 Ga0207667_10025839 3300025949 Bacteria 6424
391 Ga0207667_10055996 3300025949 Bacteria 4144
392 Ga0207667_10063713 3300025949 Bacteria 3852
393 Ga0207667_10115039 3300025949 Bacteria 2772
394 Ga0207651_10022197 3300025960 Bacteria 3875
395 Ga0207712_10001624 3300025961 Bacteria 15155
396 Ga0207668_10006894 3300025972 Bacteria 6740
397 Ga0207668_10007120 3300025972 Bacteria 6639
398 Ga0207668_10300549 3300025972 Bacteria 1324
399 Ga0207640_10001996 3300025981 Bacteria 11011
400 Ga0207658_10268637 3300025986 Unclassified 1457
401 Ga0207677_10029375 3300026023 Bacteria 3493
402 Ga0207703_10023903 3300026035 Bacteria 4805
403 Ga0207703_10098178 3300026035 Bacteria 2476
404 Ga0207639_10016185 3300026041 Bacteria 5270
405 Ga0207639_10063638 3300026041 Bacteria 2857
406 Ga0207639_10072799 3300026041 Bacteria 2692
407 Ga0207708_10006782 3300026075 Bacteria 8474
408 Ga0207708_10013032 3300026075 Bacteria 6203
409 Ga0207708_10018656 3300026075 Bacteria 5225
410 Ga0207702_10013163 3300026078 Bacteria 6879
411 Ga0207641_10019519 3300026088 Bacteria 5564
412 Ga0207641_10023623 3300026088 Bacteria 5065
413 Ga0207648_10005761 3300026089 Bacteria 12415
414 Ga0207648_10033355 3300026089 Bacteria 4541
415 Ga0207648_10077334 3300026089 Bacteria 2901
416 Ga0207648_10130827 3300026089 Bacteria 2209
417 Ga0207648_10204247 3300026089 Bacteria 1753
418 Ga0207676_10000885 3300026095 Bacteria 23251
419 Ga0207676_10186267 3300026095 Bacteria 1822
420 Ga0207674_10000208 3300026116 Bacteria 72594
421 Ga0207674_10009905 3300026116 Bacteria 10842
422 Ga0207674_10011994 3300026116 Bacteria 9713
423 Ga0207674_10042626 3300026116 Bacteria 4685
424 Ga0207674_10064202 3300026116 Bacteria 3704
425 Ga0207674_10347353 3300026116 Bacteria 1434
426 Ga0207675_100000352 3300026118 Bacteria 43894
427 Ga0207675_100012994 3300026118 Bacteria 7771
428 Ga0207675_100178855 3300026118 Bacteria 2031
429 Ga0207698_10002882 3300026142 Bacteria 10289
430 Ga0207698_10006565 3300026142 Bacteria 7269
431 Ga0207698_10035618 3300026142 Bacteria 3643
432 Ga0207698_10107444 3300026142 Bacteria 2330
433 Ga0207698_10108496 3300026142 Bacteria 2321
434 Ga0207698_10137900 3300026142 Bacteria 2096
435 Ga0268266_10016390 3300028379 Bacteria 6336
436 Ga0268266_10067410 3300028379 Bacteria 3098
437 Ga0268266_10177191 3300028379 Unclassified 1939
438 Ga0268265_10000717 3300028380 Bacteria 32468
439 Ga0268265_10010375 3300028380 Bacteria 6292
440 Ga0268265_10093324 3300028380 Bacteria 2411
441 Ga0268264_10014185 3300028381 Bacteria 6552
442 Ga0268264_10024061 3300028381 Bacteria 4970
443 Ga0265332_10008418 3300031238 Bacteria 4635
444 Ga0265327_10005655 3300031251 Bacteria 10348
445 Ga0307408_100009498 3300031548 Bacteria 6417
446 Ga0307408_100035072 3300031548 Bacteria 3518
447 Ga0307408_100103737 3300031548 Bacteria 2171
448 Ga0307408_100245839 3300031548 Bacteria 1473
449 Ga0265314_10009257 3300031711 Bacteria 8342
450 Ga0307405_10001142 3300031731 Bacteria 10889
451 Ga0307405_10002565 3300031731 Bacteria 8062
452 Ga0307405_10008225 3300031731 Bacteria 5274
453 Ga0307405_10059148 3300031731 Bacteria 2414
454 Ga0307405_10090490 3300031731 Bacteria 2025
455 Ga0307405_10171077 3300031731 Unclassified 1550
456 Ga0307413_10000114 3300031824 Bacteria 20639
457 Ga0307413_10004330 3300031824 Bacteria 6159
458 Ga0307413_10121346 3300031824 Bacteria 1771
459 Ga0307413_10176570 3300031824 Bacteria 1518
460 Ga0307410_10000180 3300031852 Bacteria 23276
461 Ga0307410_10000406 3300031852 Bacteria 17054
462 Ga0307410_10002408 3300031852 Bacteria 9031
463 Ga0307406_10001787 3300031901 Bacteria 11754
464 Ga0307406_10003825 3300031901 Bacteria 8193
465 Ga0307406_10011407 3300031901 Bacteria 5042
466 Ga0307406_10039177 3300031901 Bacteria 2938
467 Ga0307406_10169640 3300031901 Unclassified 1578
468 Ga0307407_10002412 3300031903 Bacteria 7310
469 Ga0307407_10003394 3300031903 Bacteria 6523
470 Ga0307407_10009579 3300031903 Bacteria 4519
471 Ga0307407_10064119 3300031903 Bacteria 2158
472 Ga0307412_10000559 3300031911 Bacteria 22114
473 Ga0307412_10014392 3300031911 Bacteria 4664
474 Ga0307412_10029034 3300031911 Bacteria 3467
475 Ga0307412_10031368 3300031911 Bacteria 3356
476 Ga0307412_10166396 3300031911 Bacteria 1644
477 Ga0307409_100003438 3300031995 Bacteria 8602
478 Ga0307409_100003789 3300031995 Bacteria 8326
479 Ga0307409_100024846 3300031995 Bacteria 4189
480 Ga0307409_100029942 3300031995 Bacteria 3904
481 Ga0307416_100000293 3300032002 Bacteria 26182
482 Ga0307416_100014021 3300032002 Bacteria 5470
483 Ga0307416_100055287 3300032002 Unclassified 3196
484 Ga0307416_100056918 3300032002 Bacteria 3159
485 Ga0307416_100126061 3300032002 Bacteria 2293
486 Ga0307416_100178347 3300032002 Bacteria 1988
487 Ga0307414_10012081 3300032004 Bacteria 5095
488 Ga0307414_10063513 3300032004 Bacteria 2625
489 Ga0307414_10086585 3300032004 Bacteria 2312
490 Ga0307411_10000053 3300032005 Bacteria 34373
491 Ga0307411_10011708 3300032005 Bacteria 4749
492 Ga0307411_10015123 3300032005 Bacteria 4322
493 Ga0307411_10144771 3300032005 Bacteria 1757
494 Ga0307415_100001985 3300032126 Bacteria 10061
495 Ga0373959_0009373 3300034820 Bacteria 1687
496 Ga0373934_0000121 3300035086 Bacteria 28230
497 Ga0373923_0000572 3300035111 Bacteria 9075
498 Ga0373953_0002839 3300035117 Bacteria 5277
499 Ga0373954_0020142 3300035118 Bacteria 3015
500 Ga0373956_0000317 3300035119 Bacteria 19476
501 Ga0373943_0001771 3300035170 Bacteria 9771
502 Ga0373943_0029000 3300035170 Bacteria 2612
503 Ga0373946_0000905 3300035171 Bacteria 10192
504 Ga0373955_0032852 3300035172 Bacteria 2728
505 Ga0373955_0049253 3300035172 Bacteria 2287
506 Ga0373924_0001503 3300035410 Bacteria 7597
507 Ga0373931_0013436 3300035691 Bacteria 3987
508 Ga0373935_0002644 3300035692 Bacteria 10293
509 Ga0373935_0045792 3300035692 Bacteria 2761
510 Ga0373927_0009039 3300035695 Bacteria 6688
511 Ga0373933_0000422 3300035724 Bacteria 26693
512 Ga0373933_0004863 3300035724 Bacteria 7332
513 Ga0373947_0000797 3300035725 Bacteria 18986
514 Ga0373947_0008534 3300035725 Bacteria 5902
515 Ga0373937_0000144 3300036401 Bacteria 68655
516 Ga0373937_0001066 3300036401 Bacteria 23146
517 Ga0373925_0000980 3300037068 Bacteria 26006
518 Ga0395899_0008510 3300037312 Bacteria 7903
519 Ga0395900_0012468 3300037418 Bacteria 8691
520 Ga0395898_0081679 3300037466 Bacteria 3116
521 Ga0395905_0007988 3300037471 Bacteria 10455
522 Ga0395901_0002171 3300038443 Bacteria 20034
523 Ga0436365_1118439 3300039437 Bacteria 10260
524 Ga0439462_0006256 3300042015 Bacteria 2955
525 Ga0451577_0000001 3300042876 Bacteria 2461803
526 Ga0466966_0036617 3300044684 Bacteria 3168
527 Ga0466959_0036359 3300045049 Bacteria 3639
528 Ga0451576_0081376 3300045051 Bacteria 3368
529 Ga0451576_0179464 3300045051 Bacteria 2211
530 Ga0466967_0055508 3300045976 Bacteria 3489
531 Ga0466967_0171003 3300045976 Bacteria 2044
532 Ga0495592_0001066 3300046454 Bacteria 18965
533 Ga0495603_0004967 3300046455 Bacteria 7959
534 Ga0495629_0010738 3300046459 Bacteria 6662
535 Ga0495629_0042012 3300046459 Bacteria 3214
536 Ga0495629_0210501 3300046459 Bacteria 1343
537 Ga0495651_0000208 3300046462 Bacteria 44905
538 Ga0495651_0015258 3300046462 Bacteria 5939
539 Ga0495653_0001721 3300046463 Bacteria 17240
540 Ga0495653_0127111 3300046463 Bacteria 1808
541 Ga0495580_0000874 3300046472 Bacteria 26072
542 Ga0495580_0071117 3300046472 Bacteria 2430
543 Ga0495582_0000142 3300046473 Bacteria 38514
544 Ga0495582_0028268 3300046473 Bacteria 3077
545 Ga0495639_0001161 3300046475 Bacteria 11913
546 Ga0495662_0010984 3300046476 Bacteria 4427
547 Ga0495594_0003350 3300046499 Bacteria 8281
548 Ga0495594_0008663 3300046499 Bacteria 5242
549 Ga0495594_0050773 3300046499 Bacteria 2282
550 Ga0495594_0068855 3300046499 Bacteria 1966
551 Ga0495608_0000316 3300046511 Bacteria 33956
552 Ga0495618_0009104 3300046514 Bacteria 5991
553 Ga0495628_0000414 3300046516 Bacteria 39218
554 Ga0495628_0039563 3300046516 Bacteria 3771
555 Ga0495628_0053572 3300046516 Bacteria 3183
556 Ga0495630_0000689 3300046517 Bacteria 24229
557 Ga0495630_0003388 3300046517 Bacteria 11104
558 Ga0495630_0096316 3300046517 Bacteria 2237
559 Ga0495666_0079901 3300046526 Bacteria 1548
560 Ga0495652_0001020 3300046529 Bacteria 32048
561 Ga0495652_0024962 3300046529 Bacteria 5289
562 Ga0495652_0030742 3300046529 Bacteria 4706
563 Ga0495665_0000009 3300046531 Bacteria 75094
564 Ga0495665_0065760 3300046531 Bacteria 1914
565 Ga0495665_0070948 3300046531 Bacteria 1835
566 Ga0495640_0078971 3300046533 Bacteria 2191
567 Ga0495586_0018355 3300046535 Bacteria 3725
568 Ga0495586_0052387 3300046535 Bacteria 2209
569 Ga0495587_0000166 3300046536 Bacteria 47900
570 Ga0495587_0027064 3300046536 Bacteria 3492
571 Ga0495587_0086894 3300046536 Bacteria 1810
572 Ga0495621_0004550 3300046539 Bacteria 3912
573 Ga0495645_0000316 3300046543 Bacteria 34637
574 Ga0495645_0000741 3300046543 Bacteria 22298
575 Ga0495645_0011529 3300046543 Bacteria 6223
576 Ga0495667_0000444 3300046559 Bacteria 26487
577 Ga0495667_0017754 3300046559 Bacteria 4805
578 Ga0495667_0212674 3300046559 Bacteria 1235
579 Ga0495634_0034358 3300046642 Bacteria 3480
580 Ga0495635_0000614 3300046663 Bacteria 22955
581 Ga0495635_0008883 3300046663 Bacteria 7014
582 Ga0495635_0043978 3300046663 Bacteria 3081
583 Ga0495588_0000811 3300046674 Bacteria 13971
584 Ga0495588_0035742 3300046674 Bacteria 2519
585 Ga0495657_0000359 3300046675 Bacteria 41984
586 Ga0495599_0000571 3300046678 Bacteria 21026
587 Ga0495599_0017660 3300046678 Bacteria 4437
588 Ga0495623_0000312 3300046679 Bacteria 31331
589 Ga0495623_0009840 3300046679 Bacteria 6195
590 Ga0495623_0030808 3300046679 Bacteria 3451
591 Ga0495646_0017409 3300046680 Unclassified 4558
592 Ga0495646_0017980 3300046680 Bacteria 4479
593 Ga0495646_0035527 3300046680 Bacteria 3091
594 Ga0495658_0001023 3300046683 Bacteria 14794
595 Ga0495658_0008175 3300046683 Bacteria 5184
596 Ga0495613_0003686 3300046689 Bacteria 11483
597 Ga0495613_0014782 3300046689 Bacteria 5793
598 Ga0495613_0032083 3300046689 Bacteria 3902
599 Ga0495624_0015111 3300046690 Bacteria 5222
600 Ga0495600_0000131 3300046809 Bacteria 42268
601 Ga0495600_0071453 3300046809 Bacteria 2267
602 Ga0495581_0000601 3300047315 Bacteria 18827
603 Ga0495581_0014446 3300047315 Bacteria 4579
604 Ga0495581_0022142 3300047315 Bacteria 3683
605 Ga0495581_0065905 3300047315 Bacteria 2094
606 Ga0495604_0000992 3300047317 Bacteria 23588
607 Ga0495604_0053445 3300047317 Bacteria 3121
608 Ga0495604_0080500 3300047317 Bacteria 2440
609 Ga0495674_0002567 3300047319 Bacteria 17701
610 Ga0495674_0068466 3300047319 Bacteria 3072
611 Ga0495672_0001021 3300047320 Bacteria 28772
612 Ga0495680_0008762 3300047322 Bacteria 9164
613 Ga0495680_0016948 3300047322 Bacteria 6239
614 Ga0495675_0001641 3300047444 Bacteria 13430
615 Ga0495675_0011414 3300047444 Bacteria 5577
616 Ga0495684_0000476 3300047471 Bacteria 32788
617 Ga0495684_0004844 3300047471 Bacteria 10506
618 Ga0495684_0154156 3300047471 Bacteria 1716
619 Ga0495593_0000040 3300047673 Bacteria 52326
620 Ga0495602_0000161 3300048088 Bacteria 62393
621 Ga0495602_0038925 3300048088 Bacteria 4387
622 Ga0495614_0001591 3300048089 Bacteria 9860
623 Ga0495615_0013186 3300048090 Unclassified 1722
624 Ga0496104_0233546 3300048907 Bacteria 1751
625 Ga0496109_0004616 3300048912 Bacteria 11500
626 Ga0496112_0041965 3300048915 Bacteria 4476
627 Ga0496112_0042974 3300048915 Bacteria 4423
628 Ga0496112_0091036 3300048915 Bacteria 3019
629 Ga0496115_0132833 3300048918 Unclassified 2052
630 Ga0501031_0018939 3300049568 Bacteria 4482
631 Ga0501033_0005194 3300049570 Bacteria 10345
632 Ga0501034_0028051 3300049571 Bacteria 5726
633 Ga0501034_0203830 3300049571 Bacteria 1935
634 Ga0501038_0011267 3300049574 Bacteria 8164
635 Ga0501038_0021849 3300049574 Bacteria 5739
636 Ga0501040_0011687 3300049576 Bacteria 5746
637 Ga0501042_0024925 3300049578 Bacteria 4198
638 Ga0501043_0032922 3300049579 Bacteria 4077
639 Ga0501047_0002061 3300049581 Bacteria 19214
640 Ga0501070_0007886 3300049586 Bacteria 9021
641 Ga0501080_0092247 3300049742 Bacteria 2813
642 Ga0501081_0062751 3300049743 Bacteria 2578
643 Ga0501081_0068983 3300049743 Bacteria 2462
644 Ga0501035_0232737 3300049822 Bacteria 1570
645 Ga0501044_0002752 3300049823 Bacteria 20012
646 Ga0501045_0014345 3300049824 Bacteria 5615
647 nmdc:mga05p37_121331_c1 3300050507 Bacteria 3211
648 nmdc:mga09592_135509_c1 3300050508 Bacteria 2121
649 nmdc:mga09592_21081_c1 3300050508 Bacteria 5367
650 nmdc:mga0qj67_24446_c1 3300050509 Bacteria 4657
651 nmdc:mga0qj67_53748_c1 3300050509 Bacteria 3189
652 nmdc:mga06r32_11221_c1 3300050510 Bacteria 8072
653 nmdc:mga06r32_130402_c1 3300050510 Bacteria 2486
654 nmdc:mga06r32_196984_c1 3300050510 Bacteria 2002
655 nmdc:mga06r32_270345_c1 3300050510 Bacteria 1687
656 nmdc:mga06r32_371657_c1 3300050510 Bacteria 1413
657 nmdc:mga06r32_76361_c1 3300050510 Bacteria 3253
658 nmdc:mga06r32_95931_c1 3300050510 Bacteria 2903
659 nmdc:mga08y16_24875_c1 3300050511 Bacteria 6316
660 nmdc:mga08y16_68878_c1 3300050511 Bacteria 3689
661 nmdc:mga0n895_110268_c1 3300050512 Bacteria 2768
662 nmdc:mga0n895_50160_c1 3300050512 Bacteria 4091
663 nmdc:mga0rr50_156675_c1 3300050513 Unclassified 1845
664 nmdc:mga0rr50_54470_c1 3300050513 Bacteria 2980
665 nmdc:mga08x19_13541_c1 3300050514 Bacteria 4932
666 nmdc:mga0a205_22607_c1 3300050515 Bacteria 5959
667 nmdc:mga0a205_27712_c1 3300050515 Bacteria 4082
668 nmdc:mga0a205_7237_c1 3300050515 Bacteria 10034
669 Ga0495601_0083900 3300053077 Bacteria 2047
670 Ga0495612_0003723 3300053078 Bacteria 6334
671 Ga0495619_0000899 3300053085 Bacteria 19480

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0210501 Ga0495629_0210501_16_1107 295
2 3300046559 Ga0495667_0212674 Ga0495667_0212674_83_1207 305
3 3300025972 Ga0207668_10300549 Ga0207668_103005492 321
4 3300005563 Ga0068855_100334178 Ga0068855_1003341782 323
5 3300042015 Ga0439462_0006256 Ga0439462_0006256_564_1844 336
6 3300050508 nmdc:mga09592_135509_c1 nmdc:mga09592_135509_c1_356_1537 336
7 3300050510 nmdc:mga06r32_130402_c1 nmdc:mga06r32_130402_c1_548_1729 336
8 3300049570 Ga0501033_0005194 Ga0501033_0005194_6321_7601 339
9 3300049571 Ga0501034_0028051 Ga0501034_0028051_961_2241 339
10 3300049574 Ga0501038_0011267 Ga0501038_0011267_2403_3683 339
11 3300049823 Ga0501044_0002752 Ga0501044_0002752_16450_17730 339
12 3300053078 Ga0495612_0003723 Ga0495612_0003723_72_1349 341
13 3300046529 Ga0495652_0030742 Ga0495652_0030742_2059_3366 342
14 3300035086 Ga0373934_0000121 Ga0373934_0000121_16667_17944 347
15 3300035111 Ga0373923_0000572 Ga0373923_0000572_1595_2872 347
16 3300035117 Ga0373953_0002839 Ga0373953_0002839_643_1920 347
17 3300035118 Ga0373954_0020142 Ga0373954_0020142_70_1347 347
18 3300035119 Ga0373956_0000317 Ga0373956_0000317_3540_4817 347
19 3300035172 Ga0373955_0049253 Ga0373955_0049253_148_1425 347
20 3300035410 Ga0373924_0001503 Ga0373924_0001503_2483_3760 347
21 3300035724 Ga0373933_0000422 Ga0373933_0000422_10480_11757 347
22 3300036401 Ga0373937_0000144 Ga0373937_0000144_56785_58062 347
23 3300046454 Ga0495592_0001066 Ga0495592_0001066_11310_12587 347
24 3300046462 Ga0495651_0000208 Ga0495651_0000208_19969_21246 347
25 3300046463 Ga0495653_0001721 Ga0495653_0001721_9457_10734 347
26 3300046511 Ga0495608_0000316 Ga0495608_0000316_14508_15785 347
27 3300046516 Ga0495628_0000414 Ga0495628_0000414_7666_8943 347
28 3300046517 Ga0495630_0000689 Ga0495630_0000689_2808_4085 347
29 3300046529 Ga0495652_0001020 Ga0495652_0001020_22016_23293 347
30 3300046536 Ga0495587_0000166 Ga0495587_0000166_2962_4239 347
31 3300046543 Ga0495645_0000741 Ga0495645_0000741_1053_2330 347
32 3300046559 Ga0495667_0000444 Ga0495667_0000444_8647_9924 347
33 3300046663 Ga0495635_0000614 Ga0495635_0000614_6826_8103 347
34 3300046675 Ga0495657_0000359 Ga0495657_0000359_10349_11626 347
35 3300046678 Ga0495599_0000571 Ga0495599_0000571_15994_17271 347
36 3300046679 Ga0495623_0000312 Ga0495623_0000312_23828_25105 347
37 3300046680 Ga0495646_0017409 Ga0495646_0017409_3169_4446 347
38 3300046689 Ga0495613_0032083 Ga0495613_0032083_1681_2958 347
39 3300046809 Ga0495600_0000131 Ga0495600_0000131_14865_16142 347
40 3300047315 Ga0495581_0065905 Ga0495581_0065905_275_1552 347
41 3300047317 Ga0495604_0000992 Ga0495604_0000992_14651_15928 347
42 3300047319 Ga0495674_0002567 Ga0495674_0002567_1478_2755 347
43 3300047322 Ga0495680_0008762 Ga0495680_0008762_3008_4285 347
44 3300047444 Ga0495675_0001641 Ga0495675_0001641_9674_10951 347
45 3300047471 Ga0495684_0000476 Ga0495684_0000476_3045_4322 347
46 3300048088 Ga0495602_0000161 Ga0495602_0000161_44737_46014 347
47 3300053085 Ga0495619_0000899 Ga0495619_0000899_12011_13288 347
48 3300031548 Ga0307408_100009498 Ga0307408_1000094984 348
49 3300031731 Ga0307405_10001142 Ga0307405_100011427 348
50 3300031824 Ga0307413_10000114 Ga0307413_100001149 348
51 3300031852 Ga0307410_10000180 Ga0307410_100001805 348
52 3300031901 Ga0307406_10039177 Ga0307406_100391772 348
53 3300031903 Ga0307407_10009579 Ga0307407_100095793 348
54 3300031911 Ga0307412_10000559 Ga0307412_100005594 348
55 3300031995 Ga0307409_100003438 Ga0307409_1000034385 348
56 3300032005 Ga0307411_10000053 Ga0307411_1000005314 348
57 3300032126 Ga0307415_100001985 Ga0307415_1000019854 348
58 3300005546 Ga0070696_100076638 Ga0070696_1000766382 351
59 3300025912 Ga0207707_10222975 Ga0207707_102229752 352
60 3300032002 Ga0307416_100055287 Ga0307416_1000552872 352
61 3300005329 Ga0070683_100001864 Ga0070683_1000018645 353
62 3300005578 Ga0068854_100004227 Ga0068854_1000042274 353
63 3300005616 Ga0068852_100003906 Ga0068852_1000039065 353
64 3300025912 Ga0207707_10001596 Ga0207707_100015969 353
65 3300025913 Ga0207695_10001210 Ga0207695_1000121010 353
66 3300025917 Ga0207660_10000728 Ga0207660_1000072811 353
67 3300025921 Ga0207652_10000336 Ga0207652_1000033610 353
68 3300025949 Ga0207667_10055996 Ga0207667_100559963 353
69 3300025981 Ga0207640_10001996 Ga0207640_100019969 353
70 3300026142 Ga0207698_10107444 Ga0207698_101074442 353
71 3300005335 Ga0070666_10193435 Ga0070666_101934351 354
72 3300005354 Ga0070675_100046839 Ga0070675_1000468392 354
73 3300005365 Ga0070688_100010144 Ga0070688_1000101445 354
74 3300005367 Ga0070667_100062461 Ga0070667_1000624612 354
75 3300005444 Ga0070694_100190379 Ga0070694_1001903791 354
76 3300005530 Ga0070679_100015185 Ga0070679_1000151852 354
77 3300005548 Ga0070665_100223932 Ga0070665_1002239322 354
78 3300005719 Ga0068861_100215266 Ga0068861_1002152662 354
79 3300005844 Ga0068862_100173579 Ga0068862_1001735792 354
80 3300009553 Ga0105249_10124839 Ga0105249_101248392 354
81 3300013306 Ga0163162_10177202 Ga0163162_101772022 354
82 3300013308 Ga0157375_10009308 Ga0157375_100093082 354
83 3300025923 Ga0207681_10142632 Ga0207681_101426322 354
84 3300025936 Ga0207670_10173053 Ga0207670_101730532 354
85 3300025940 Ga0207691_10026805 Ga0207691_100268052 354
86 3300026035 Ga0207703_10098178 Ga0207703_100981782 354
87 3300026116 Ga0207674_10347353 Ga0207674_103473532 354
88 3300028379 Ga0268266_10177191 Ga0268266_101771912 354
89 3300028380 Ga0268265_10093324 Ga0268265_100933242 354
90 3300005336 Ga0070680_100122335 Ga0070680_1001223352 355
91 3300045976 Ga0466967_0171003 Ga0466967_0171003_494_1777 355
92 3300005458 Ga0070681_10055099 Ga0070681_100550993 356
93 3300005530 Ga0070679_100016129 Ga0070679_1000161295 356
94 3300006871 Ga0075434_100069023 Ga0075434_1000690232 356
95 3300025917 Ga0207660_10088305 Ga0207660_100883052 356
96 3300025921 Ga0207652_10059986 Ga0207652_100599863 356
97 3300045049 Ga0466959_0036359 Ga0466959_0036359_1248_2528 356
98 3300005336 Ga0070680_100000936 Ga0070680_1000009364 357
99 3300005458 Ga0070681_10006664 Ga0070681_100066646 357
100 3300005530 Ga0070679_100001015 Ga0070679_10000101517 357
101 3300025912 Ga0207707_10005323 Ga0207707_100053235 357
102 3300025917 Ga0207660_10009431 Ga0207660_100094315 357
103 3300025921 Ga0207652_10008325 Ga0207652_100083255 357
104 3300031548 Ga0307408_100103737 Ga0307408_1001037372 357
105 3300031911 Ga0307412_10031368 Ga0307412_100313682 357
106 3300032002 Ga0307416_100014021 Ga0307416_1000140212 357
107 3300005546 Ga0070696_100000381 Ga0070696_1000003813 358
108 3300045976 Ga0466967_0055508 Ga0466967_0055508_596_1885 358
109 3300005564 Ga0070664_100086142 Ga0070664_1000861422 359
110 3300025944 Ga0207661_10152717 Ga0207661_101527172 359
111 3300046499 Ga0495594_0008663 Ga0495594_0008663_2544_3848 359
112 3300046499 Ga0495594_0003350 Ga0495594_0003350_3254_4534 360
113 3300047319 Ga0495674_0068466 Ga0495674_0068466_248_1531 360
114 3300005355 Ga0070671_100139835 Ga0070671_1001398352 362
115 3300005459 Ga0068867_100118367 Ga0068867_1001183672 362
116 3300009176 Ga0105242_10107419 Ga0105242_101074192 362
117 3300009177 Ga0105248_10036024 Ga0105248_100360242 362
118 3300025931 Ga0207644_10024221 Ga0207644_100242212 362
119 3300025931 Ga0207644_10069760 Ga0207644_100697602 362
120 3300025934 Ga0207686_10044803 Ga0207686_100448033 362
121 3300025937 Ga0207669_10035452 Ga0207669_100354523 362
122 3300026089 Ga0207648_10005761 Ga0207648_100057619 362
123 3300031901 Ga0307406_10169640 Ga0307406_101696402 362
124 3300031995 Ga0307409_100024846 Ga0307409_1000248464 362
125 3300032005 Ga0307411_10144771 Ga0307411_101447712 362
126 3300013104 Ga0157370_10025087 Ga0157370_100250873 363
127 3300025913 Ga0207695_10003856 Ga0207695_100038566 363
128 3300031238 Ga0265332_10008418 Ga0265332_100084184 363
129 3300046463 Ga0495653_0127111 Ga0495653_0127111_474_1778 363
130 3300046516 Ga0495628_0053572 Ga0495628_0053572_1086_2390 363
131 3300046529 Ga0495652_0024962 Ga0495652_0024962_1649_2953 363
132 3300046535 Ga0495586_0018355 Ga0495586_0018355_671_1975 363
133 3300046642 Ga0495634_0034358 Ga0495634_0034358_369_1673 363
134 3300046663 Ga0495635_0043978 Ga0495635_0043978_1131_2435 363
135 3300046680 Ga0495646_0017980 Ga0495646_0017980_2597_3901 363
136 3300046809 Ga0495600_0071453 Ga0495600_0071453_605_1909 363
137 3300047317 Ga0495604_0080500 Ga0495604_0080500_831_2135 363
138 3300047322 Ga0495680_0016948 Ga0495680_0016948_3139_4443 363
139 3300047471 Ga0495684_0004844 Ga0495684_0004844_4479_5783 363
140 3300048088 Ga0495602_0038925 Ga0495602_0038925_992_2296 363
141 3300050510 nmdc:mga06r32_95931_c1 nmdc:mga06r32_95931_c1_95_1384 363
142 3300005328 Ga0070676_10084717 Ga0070676_100847171 364
143 3300005329 Ga0070683_100000591 Ga0070683_1000005918 364
144 3300005329 Ga0070683_100023285 Ga0070683_1000232854 364
145 3300005331 Ga0070670_100011628 Ga0070670_1000116284 364
146 3300005336 Ga0070680_100000354 Ga0070680_10000035422 364
147 3300005336 Ga0070680_100035186 Ga0070680_1000351862 364
148 3300005337 Ga0070682_100000603 Ga0070682_1000006037 364
149 3300005344 Ga0070661_100059075 Ga0070661_1000590752 364
150 3300005345 Ga0070692_10032194 Ga0070692_100321942 364
151 3300005353 Ga0070669_100061493 Ga0070669_1000614932 364
152 3300005356 Ga0070674_100027116 Ga0070674_1000271162 364
153 3300005458 Ga0070681_10001240 Ga0070681_1000124011 364
154 3300005458 Ga0070681_10006631 Ga0070681_100066314 364
155 3300005518 Ga0070699_100006387 Ga0070699_1000063873 364
156 3300005530 Ga0070679_100000377 Ga0070679_10000037713 364
157 3300005530 Ga0070679_100049893 Ga0070679_1000498934 364
158 3300005535 Ga0070684_100003431 Ga0070684_1000034315 364
159 3300005535 Ga0070684_100128845 Ga0070684_1001288452 364
160 3300005539 Ga0068853_100046309 Ga0068853_1000463093 364
161 3300005543 Ga0070672_100019241 Ga0070672_1000192414 364
162 3300005546 Ga0070696_100006093 Ga0070696_1000060934 364
163 3300005563 Ga0068855_100113345 Ga0068855_1001133453 364
164 3300005564 Ga0070664_100040888 Ga0070664_1000408882 364
165 3300005616 Ga0068852_100024462 Ga0068852_1000244624 364
166 3300005985 Ga0081539_10000807 Ga0081539_1000080727 364
167 3300009093 Ga0105240_10001901 Ga0105240_1000190128 364
168 3300013100 Ga0157373_10000902 Ga0157373_100009023 364
169 3300013104 Ga0157370_10004753 Ga0157370_100047531 364
170 3300013307 Ga0157372_10007393 Ga0157372_100073933 364
171 3300013307 Ga0157372_10009520 Ga0157372_100095203 364
172 3300013307 Ga0157372_10010408 Ga0157372_100104086 364
173 3300025907 Ga0207645_10095276 Ga0207645_100952762 364
174 3300025912 Ga0207707_10000687 Ga0207707_100006876 364
175 3300025912 Ga0207707_10005264 Ga0207707_100052643 364
176 3300025913 Ga0207695_10074847 Ga0207695_100748472 364
177 3300025917 Ga0207660_10003100 Ga0207660_100031005 364
178 3300025917 Ga0207660_10133458 Ga0207660_101334581 364
179 3300025920 Ga0207649_10063549 Ga0207649_100635492 364
180 3300025921 Ga0207652_10005447 Ga0207652_100054474 364
181 3300025921 Ga0207652_10030799 Ga0207652_100307993 364
182 3300025923 Ga0207681_10070515 Ga0207681_100705151 364
183 3300025925 Ga0207650_10010401 Ga0207650_100104014 364
184 3300025927 Ga0207687_10076200 Ga0207687_100762002 364
185 3300025937 Ga0207669_10051363 Ga0207669_100513633 364
186 3300025940 Ga0207691_10001606 Ga0207691_100016062 364
187 3300025944 Ga0207661_10002219 Ga0207661_100022193 364
188 3300025944 Ga0207661_10006853 Ga0207661_100068535 364
189 3300025945 Ga0207679_10012928 Ga0207679_100129284 364
190 3300025949 Ga0207667_10115039 Ga0207667_101150392 364
191 3300026023 Ga0207677_10029375 Ga0207677_100293753 364
192 3300026041 Ga0207639_10016185 Ga0207639_100161852 364
193 3300026142 Ga0207698_10006565 Ga0207698_100065655 364
194 3300031731 Ga0307405_10090490 Ga0307405_100904902 364
195 3300034820 Ga0373959_0009373 Ga0373959_0009373_257_1546 364
196 3300035691 Ga0373931_0013436 Ga0373931_0013436_1101_2390 364
197 3300044684 Ga0466966_0036617 Ga0466966_0036617_704_1996 364
198 3300046476 Ga0495662_0010984 Ga0495662_0010984_96_1400 364
199 3300046514 Ga0495618_0009104 Ga0495618_0009104_4412_5716 364
200 3300046516 Ga0495628_0039563 Ga0495628_0039563_1229_2533 364
201 3300046531 Ga0495665_0065760 Ga0495665_0065760_514_1818 364
202 3300046533 Ga0495640_0078971 Ga0495640_0078971_686_1990 364
203 3300046663 Ga0495635_0008883 Ga0495635_0008883_507_1811 364
204 3300046679 Ga0495623_0030808 Ga0495623_0030808_656_1912 364
205 3300046680 Ga0495646_0035527 Ga0495646_0035527_507_1811 364
206 3300046689 Ga0495613_0014782 Ga0495613_0014782_3261_4565 364
207 3300046690 Ga0495624_0015111 Ga0495624_0015111_3126_4430 364
208 3300047317 Ga0495604_0053445 Ga0495604_0053445_443_1747 364
209 3300047444 Ga0495675_0011414 Ga0495675_0011414_2019_3323 364
210 3300047471 Ga0495684_0154156 Ga0495684_0154156_83_1387 364
211 3300048915 Ga0496112_0041965 Ga0496112_0041965_1763_3052 364
212 3300050512 nmdc:mga0n895_110268_c1 nmdc:mga0n895_110268_c1_485_1774 364
213 3300050515 nmdc:mga0a205_27712_c1 nmdc:mga0a205_27712_c1_853_2142 364
214 3300005295 Ga0065707_10149842 Ga0065707_101498422 365
215 3300005331 Ga0070670_100024459 Ga0070670_1000244591 365
216 3300005434 Ga0070709_10081114 Ga0070709_100811142 365
217 3300005530 Ga0070679_100091733 Ga0070679_1000917332 365
218 3300005535 Ga0070684_100145941 Ga0070684_1001459412 365
219 3300005564 Ga0070664_100237191 Ga0070664_1002371912 365
220 3300005614 Ga0068856_100159215 Ga0068856_1001592151 365
221 3300005618 Ga0068864_100018057 Ga0068864_1000180572 365
222 3300005834 Ga0068851_10012953 Ga0068851_100129532 365
223 3300013100 Ga0157373_10080658 Ga0157373_100806582 365
224 3300013296 Ga0157374_10188367 Ga0157374_101883672 365
225 3300025321 Ga0207656_10006585 Ga0207656_100065854 365
226 3300025919 Ga0207657_10265199 Ga0207657_102651991 365
227 3300025932 Ga0207690_10055504 Ga0207690_100555042 365
228 3300026142 Ga0207698_10108496 Ga0207698_101084961 365
229 3300035170 Ga0373943_0029000 Ga0373943_0029000_1090_2373 365
230 3300035172 Ga0373955_0032852 Ga0373955_0032852_948_2231 365
231 3300035692 Ga0373935_0045792 Ga0373935_0045792_332_1615 365
232 3300035695 Ga0373927_0009039 Ga0373927_0009039_644_1927 365
233 3300035724 Ga0373933_0004863 Ga0373933_0004863_3015_4298 365
234 3300035725 Ga0373947_0008534 Ga0373947_0008534_3354_4637 365
235 3300036401 Ga0373937_0001066 Ga0373937_0001066_3890_5173 365
236 3300046462 Ga0495651_0015258 Ga0495651_0015258_3925_5208 365
237 3300046472 Ga0495580_0071117 Ga0495580_0071117_651_1934 365
238 3300046499 Ga0495594_0050773 Ga0495594_0050773_41_1324 365
239 3300046517 Ga0495630_0096316 Ga0495630_0096316_444_1727 365
240 3300046526 Ga0495666_0079901 Ga0495666_0079901_189_1472 365
241 3300046531 Ga0495665_0070948 Ga0495665_0070948_206_1489 365
242 3300046535 Ga0495586_0052387 Ga0495586_0052387_597_1880 365
243 3300046536 Ga0495587_0027064 Ga0495587_0027064_1845_3128 365
244 3300046543 Ga0495645_0000316 Ga0495645_0000316_16891_18174 365
245 3300046559 Ga0495667_0017754 Ga0495667_0017754_459_1742 365
246 3300046678 Ga0495599_0017660 Ga0495599_0017660_1739_3031 365
247 3300046679 Ga0495623_0009840 Ga0495623_0009840_4516_5799 365
248 3300047315 Ga0495581_0014446 Ga0495581_0014446_3031_4314 365
249 3300053077 Ga0495601_0083900 Ga0495601_0083900_289_1572 365
250 3300005295 Ga0065707_10083638 Ga0065707_100836383 366
251 3300005336 Ga0070680_100076451 Ga0070680_1000764512 366
252 3300005340 Ga0070689_100000673 Ga0070689_10000067318 366
253 3300005344 Ga0070661_100129498 Ga0070661_1001294982 366
254 3300005345 Ga0070692_10014594 Ga0070692_100145943 366
255 3300005347 Ga0070668_100035536 Ga0070668_1000355362 366
256 3300005366 Ga0070659_100011079 Ga0070659_1000110795 366
257 3300005367 Ga0070667_100055906 Ga0070667_1000559062 366
258 3300005435 Ga0070714_100044819 Ga0070714_1000448193 366
259 3300005438 Ga0070701_10004493 Ga0070701_100044932 366
260 3300005441 Ga0070700_100019789 Ga0070700_1000197893 366
261 3300005457 Ga0070662_100019195 Ga0070662_1000191952 366
262 3300005458 Ga0070681_10007450 Ga0070681_100074509 366
263 3300005543 Ga0070672_100002581 Ga0070672_1000025818 366
264 3300005548 Ga0070665_100171105 Ga0070665_1001711052 366
265 3300005577 Ga0068857_100166097 Ga0068857_1001660972 366
266 3300005616 Ga0068852_100169300 Ga0068852_1001693002 366
267 3300005719 Ga0068861_100003917 Ga0068861_1000039176 366
268 3300005834 Ga0068851_10022605 Ga0068851_100226053 366
269 3300005841 Ga0068863_100018014 Ga0068863_1000180145 366
270 3300005842 Ga0068858_100022669 Ga0068858_1000226692 366
271 3300005843 Ga0068860_100091863 Ga0068860_1000918632 366
272 3300005844 Ga0068862_100034981 Ga0068862_1000349812 366
273 3300006881 Ga0068865_100013641 Ga0068865_1000136412 366
274 3300006914 Ga0075436_100001320 Ga0075436_10000132012 366
275 3300009093 Ga0105240_10003398 Ga0105240_1000339825 366
276 3300009098 Ga0105245_10073359 Ga0105245_100733593 366
277 3300009177 Ga0105248_10015072 Ga0105248_100150726 366
278 3300009553 Ga0105249_10013612 Ga0105249_100136126 366
279 3300010375 Ga0105239_10004555 Ga0105239_100045555 366
280 3300013102 Ga0157371_10005201 Ga0157371_100052018 366
281 3300013105 Ga0157369_10002628 Ga0157369_100026288 366
282 3300013306 Ga0163162_10005796 Ga0163162_100057962 366
283 3300013307 Ga0157372_10021399 Ga0157372_100213992 366
284 3300014326 Ga0157380_10017758 Ga0157380_100177582 366
285 3300014968 Ga0157379_10000965 Ga0157379_1000096520 366
286 3300017792 Ga0163161_10004493 Ga0163161_100044936 366
287 3300020070 Ga0206356_11232198 Ga0206356_112321982 366
288 3300025315 Ga0207697_10003952 Ga0207697_100039525 366
289 3300025912 Ga0207707_10242879 Ga0207707_102428792 366
290 3300025913 Ga0207695_10035820 Ga0207695_100358202 366
291 3300025918 Ga0207662_10000828 Ga0207662_100008283 366
292 3300025920 Ga0207649_10007484 Ga0207649_100074845 366
293 3300025920 Ga0207649_10114375 Ga0207649_101143752 366
294 3300025923 Ga0207681_10002981 Ga0207681_100029817 366
295 3300025926 Ga0207659_10005914 Ga0207659_100059142 366
296 3300025932 Ga0207690_10006435 Ga0207690_100064352 366
297 3300025933 Ga0207706_10001727 Ga0207706_1000172721 366
298 3300025933 Ga0207706_10050682 Ga0207706_100506824 366
299 3300025936 Ga0207670_10003234 Ga0207670_100032342 366
300 3300025938 Ga0207704_10196997 Ga0207704_101969971 366
301 3300025940 Ga0207691_10000638 Ga0207691_1000063817 366
302 3300025949 Ga0207667_10025839 Ga0207667_100258392 366
303 3300025961 Ga0207712_10001624 Ga0207712_100016249 366
304 3300025972 Ga0207668_10006894 Ga0207668_100068942 366
305 3300026035 Ga0207703_10023903 Ga0207703_100239033 366
306 3300026041 Ga0207639_10063638 Ga0207639_100636382 366
307 3300026075 Ga0207708_10006782 Ga0207708_100067822 366
308 3300026088 Ga0207641_10019519 Ga0207641_100195194 366
309 3300026089 Ga0207648_10130827 Ga0207648_101308272 366
310 3300026116 Ga0207674_10064202 Ga0207674_100642024 366
311 3300026118 Ga0207675_100000352 Ga0207675_1000003529 366
312 3300026142 Ga0207698_10035618 Ga0207698_100356184 366
313 3300028379 Ga0268266_10067410 Ga0268266_100674102 366
314 3300028380 Ga0268265_10010375 Ga0268265_100103755 366
315 3300028381 Ga0268264_10014185 Ga0268264_100141853 366
316 3300005338 Ga0068868_100007265 Ga0068868_1000072653 367
317 3300005441 Ga0070700_100011573 Ga0070700_1000115732 367
318 3300005445 Ga0070708_100000006 Ga0070708_10000000686 367
319 3300005459 Ga0068867_100059685 Ga0068867_1000596852 367
320 3300005468 Ga0070707_100033032 Ga0070707_1000330324 367
321 3300005539 Ga0068853_100018830 Ga0068853_1000188305 367
322 3300005544 Ga0070686_100014493 Ga0070686_1000144933 367
323 3300005578 Ga0068854_100069469 Ga0068854_1000694692 367
324 3300006881 Ga0068865_100004921 Ga0068865_1000049214 367
325 3300009551 Ga0105238_10028857 Ga0105238_100288575 367
326 3300013297 Ga0157378_10012398 Ga0157378_100123984 367
327 3300025899 Ga0207642_10027638 Ga0207642_100276383 367
328 3300025907 Ga0207645_10002866 Ga0207645_100028663 367
329 3300025913 Ga0207695_10233752 Ga0207695_102337522 367
330 3300025922 Ga0207646_10018582 Ga0207646_100185823 367
331 3300025924 Ga0207694_10019538 Ga0207694_100195382 367
332 3300025933 Ga0207706_10001172 Ga0207706_1000117217 367
333 3300026075 Ga0207708_10013032 Ga0207708_100130324 367
334 3300026089 Ga0207648_10077334 Ga0207648_100773342 367
335 3300026118 Ga0207675_100178855 Ga0207675_1001788552 367
336 3300005328 Ga0070676_10006200 Ga0070676_100062005 368
337 3300005434 Ga0070709_10003594 Ga0070709_100035944 368
338 3300005437 Ga0070710_10128664 Ga0070710_101286641 368
339 3300005834 Ga0068851_10032374 Ga0068851_100323742 368
340 3300006173 Ga0070716_100001023 Ga0070716_1000010234 368
341 3300006914 Ga0075436_100010070 Ga0075436_1000100703 368
342 3300025898 Ga0207692_10006731 Ga0207692_100067313 368
343 3300025906 Ga0207699_10007002 Ga0207699_100070024 368
344 3300025907 Ga0207645_10030281 Ga0207645_100302812 368
345 3300025926 Ga0207659_10101828 Ga0207659_101018282 368
346 3300025929 Ga0207664_10056762 Ga0207664_100567622 368
347 3300025939 Ga0207665_10001133 Ga0207665_1000113310 368
348 3300037312 Ga0395899_0008510 Ga0395899_0008510_1309_2595 368
349 3300037418 Ga0395900_0012468 Ga0395900_0012468_3400_4686 368
350 3300037466 Ga0395898_0081679 Ga0395898_0081679_455_1741 368
351 3300037471 Ga0395905_0007988 Ga0395905_0007988_1568_2854 368
352 3300038443 Ga0395901_0002171 Ga0395901_0002171_5708_6994 368
353 3300042876 Ga0451577_0000001 Ga0451577_0000001_443369_444637 368
354 3300047320 Ga0495672_0001021 Ga0495672_0001021_11981_13261 368
355 3300050513 nmdc:mga0rr50_156675_c1 nmdc:mga0rr50_156675_c1_158_1447 368
356 3300050514 nmdc:mga08x19_13541_c1 nmdc:mga08x19_13541_c1_2831_4120 368
357 3300005329 Ga0070683_100003631 Ga0070683_1000036315 369
358 3300005329 Ga0070683_100017066 Ga0070683_1000170662 369
359 3300005329 Ga0070683_100162718 Ga0070683_1001627182 369
360 3300005331 Ga0070670_100017014 Ga0070670_1000170142 369
361 3300005334 Ga0068869_100014965 Ga0068869_1000149654 369
362 3300005336 Ga0070680_100005427 Ga0070680_1000054276 369
363 3300005337 Ga0070682_100001650 Ga0070682_1000016504 369
364 3300005339 Ga0070660_100024997 Ga0070660_1000249972 369
365 3300005340 Ga0070689_100056709 Ga0070689_1000567093 369
366 3300005344 Ga0070661_100001410 Ga0070661_1000014103 369
367 3300005354 Ga0070675_100007252 Ga0070675_1000072522 369
368 3300005364 Ga0070673_100055404 Ga0070673_1000554042 369
369 3300005366 Ga0070659_100005487 Ga0070659_1000054876 369
370 3300005435 Ga0070714_100004689 Ga0070714_1000046892 369
371 3300005457 Ga0070662_100010334 Ga0070662_1000103342 369
372 3300005458 Ga0070681_10003137 Ga0070681_100031376 369
373 3300005458 Ga0070681_10034647 Ga0070681_100346474 369
374 3300005458 Ga0070681_10290222 Ga0070681_102902222 369
375 3300005530 Ga0070679_100011373 Ga0070679_1000113734 369
376 3300005535 Ga0070684_100010316 Ga0070684_1000103165 369
377 3300005535 Ga0070684_100057726 Ga0070684_1000577262 369
378 3300005539 Ga0068853_100069589 Ga0068853_1000695893 369
379 3300005545 Ga0070695_100025834 Ga0070695_1000258342 369
380 3300005547 Ga0070693_100040148 Ga0070693_1000401483 369
381 3300005577 Ga0068857_100006817 Ga0068857_1000068173 369
382 3300005614 Ga0068856_100005156 Ga0068856_1000051562 369
383 3300005615 Ga0070702_100101001 Ga0070702_1001010012 369
384 3300005616 Ga0068852_100145427 Ga0068852_1001454271 369
385 3300005617 Ga0068859_100010691 Ga0068859_1000106916 369
386 3300005618 Ga0068864_100053047 Ga0068864_1000530472 369
387 3300005841 Ga0068863_100042253 Ga0068863_1000422533 369
388 3300005843 Ga0068860_100008551 Ga0068860_1000085516 369
389 3300006237 Ga0097621_100025099 Ga0097621_1000250992 369
390 3300006358 Ga0068871_100005320 Ga0068871_1000053203 369
391 3300006846 Ga0075430_100000259 Ga0075430_1000002596 369
392 3300006880 Ga0075429_100049453 Ga0075429_1000494532 369
393 3300006931 Ga0097620_100010691 Ga0097620_1000106916 369
394 3300009098 Ga0105245_10019074 Ga0105245_100190742 369
395 3300009174 Ga0105241_10031703 Ga0105241_100317032 369
396 3300009177 Ga0105248_10003532 Ga0105248_100035325 369
397 3300010375 Ga0105239_10009555 Ga0105239_1000955510 369
398 3300011119 Ga0105246_10001101 Ga0105246_100011016 369
399 3300013102 Ga0157371_10002858 Ga0157371_100028585 369
400 3300013102 Ga0157371_10029869 Ga0157371_100298694 369
401 3300013296 Ga0157374_10010387 Ga0157374_100103872 369
402 3300013307 Ga0157372_10022673 Ga0157372_100226733 369
403 3300014745 Ga0157377_10000658 Ga0157377_100006582 369
404 3300014969 Ga0157376_10158732 Ga0157376_101587322 369
405 3300025912 Ga0207707_10017297 Ga0207707_100172973 369
406 3300025912 Ga0207707_10201141 Ga0207707_102011412 369
407 3300025917 Ga0207660_10010587 Ga0207660_100105873 369
408 3300025919 Ga0207657_10052575 Ga0207657_100525753 369
409 3300025920 Ga0207649_10018842 Ga0207649_100188422 369
410 3300025921 Ga0207652_10005612 Ga0207652_100056125 369
411 3300025921 Ga0207652_10191179 Ga0207652_101911792 369
412 3300025925 Ga0207650_10008654 Ga0207650_100086543 369
413 3300025926 Ga0207659_10002918 Ga0207659_100029183 369
414 3300025927 Ga0207687_10004929 Ga0207687_100049291 369
415 3300025929 Ga0207664_10020683 Ga0207664_100206834 369
416 3300025932 Ga0207690_10002104 Ga0207690_100021046 369
417 3300025933 Ga0207706_10008153 Ga0207706_100081538 369
418 3300025936 Ga0207670_10046930 Ga0207670_100469303 369
419 3300025941 Ga0207711_10005992 Ga0207711_100059928 369
420 3300025942 Ga0207689_10001394 Ga0207689_1000139417 369
421 3300025944 Ga0207661_10000767 Ga0207661_100007676 369
422 3300025944 Ga0207661_10019807 Ga0207661_100198072 369
423 3300025944 Ga0207661_10233666 Ga0207661_102336661 369
424 3300025945 Ga0207679_10001065 Ga0207679_100010653 369
425 3300025949 Ga0207667_10063713 Ga0207667_100637132 369
426 3300025960 Ga0207651_10022197 Ga0207651_100221972 369
427 3300025986 Ga0207658_10268637 Ga0207658_102686371 369
428 3300026078 Ga0207702_10013163 Ga0207702_100131635 369
429 3300026095 Ga0207676_10000885 Ga0207676_1000088514 369
430 3300026116 Ga0207674_10000208 Ga0207674_1000020826 369
431 3300026142 Ga0207698_10137900 Ga0207698_101379002 369
432 3300028381 Ga0268264_10024061 Ga0268264_100240613 369
433 3300031548 Ga0307408_100245839 Ga0307408_1002458392 369
434 3300046459 Ga0495629_0010738 Ga0495629_0010738_3824_5110 369
435 3300046473 Ga0495582_0028268 Ga0495582_0028268_154_1440 369
436 3300046536 Ga0495587_0086894 Ga0495587_0086894_420_1706 369
437 3300046543 Ga0495645_0011529 Ga0495645_0011529_4341_5627 369
438 3300046683 Ga0495658_0008175 Ga0495658_0008175_3528_4814 369
439 3300047315 Ga0495581_0022142 Ga0495581_0022142_1314_2600 369
440 3300005290 Ga0065712_10090873 Ga0065712_100908732 370
441 3300005458 Ga0070681_10001953 Ga0070681_100019537 370
442 3300005535 Ga0070684_100037605 Ga0070684_1000376053 370
443 3300009094 Ga0111539_10110728 Ga0111539_101107283 370
444 3300009174 Ga0105241_10000038 Ga0105241_100000383 370
445 3300013306 Ga0163162_10186244 Ga0163162_101862442 370
446 3300013307 Ga0157372_10240865 Ga0157372_102408652 370
447 3300013308 Ga0157375_10164357 Ga0157375_101643572 370
448 3300025911 Ga0207654_10000036 Ga0207654_1000003611 370
449 3300025912 Ga0207707_10067629 Ga0207707_100676292 370
450 3300025921 Ga0207652_10025555 Ga0207652_100255554 370
451 3300025936 Ga0207670_10088792 Ga0207670_100887922 370
452 3300025941 Ga0207711_10053193 Ga0207711_100531932 370
453 3300025944 Ga0207661_10018751 Ga0207661_100187512 370
454 3300026088 Ga0207641_10023623 Ga0207641_100236233 370
455 3300031824 Ga0307413_10176570 Ga0307413_101765702 370
456 3300031901 Ga0307406_10001787 Ga0307406_100017875 370
457 3300031903 Ga0307407_10064119 Ga0307407_100641192 370
458 3300035170 Ga0373943_0001771 Ga0373943_0001771_1327_2604 370
459 3300035171 Ga0373946_0000905 Ga0373946_0000905_4718_5995 370
460 3300035692 Ga0373935_0002644 Ga0373935_0002644_7398_8675 370
461 3300035725 Ga0373947_0000797 Ga0373947_0000797_10345_11622 370
462 3300037068 Ga0373925_0000980 Ga0373925_0000980_3522_4799 370
463 3300046455 Ga0495603_0004967 Ga0495603_0004967_1919_3196 370
464 3300046459 Ga0495629_0042012 Ga0495629_0042012_572_1849 370
465 3300046472 Ga0495580_0000874 Ga0495580_0000874_17784_19061 370
466 3300046473 Ga0495582_0000142 Ga0495582_0000142_32430_33707 370
467 3300046475 Ga0495639_0001161 Ga0495639_0001161_3195_4472 370
468 3300046517 Ga0495630_0003388 Ga0495630_0003388_2379_3656 370
469 3300046531 Ga0495665_0000009 Ga0495665_0000009_52860_54137 370
470 3300046674 Ga0495588_0000811 Ga0495588_0000811_7465_8742 370
471 3300046683 Ga0495658_0001023 Ga0495658_0001023_6128_7405 370
472 3300046689 Ga0495613_0003686 Ga0495613_0003686_4028_5305 370
473 3300047315 Ga0495581_0000601 Ga0495581_0000601_7374_8651 370
474 3300047673 Ga0495593_0000040 Ga0495593_0000040_7354_8631 370
475 3300048089 Ga0495614_0001591 Ga0495614_0001591_7374_8651 370
476 3300048912 Ga0496109_0004616 Ga0496109_0004616_6651_7937 370
477 3300048915 Ga0496112_0042974 Ga0496112_0042974_1552_2838 370
478 3300006847 Ga0075431_100019818 Ga0075431_1000198182 371
479 3300009094 Ga0111539_10001571 Ga0111539_100015714 371
480 3300009147 Ga0114129_10206297 Ga0114129_102062972 371
481 3300021384 Ga0213876_10015299 Ga0213876_100152992 371
482 3300025893 Ga0207682_10037499 Ga0207682_100374991 371
483 3300031731 Ga0307405_10171077 Ga0307405_101710772 371
484 3300039437 Ga0436365_1118439 Ga0436365_1118439_693_2000 371
485 3300046674 Ga0495588_0035742 Ga0495588_0035742_425_1711 371
486 3300049568 Ga0501031_0018939 Ga0501031_0018939_768_2054 371
487 3300049576 Ga0501040_0011687 Ga0501040_0011687_1611_2897 371
488 3300049578 Ga0501042_0024925 Ga0501042_0024925_2676_3962 371
489 3300049742 Ga0501080_0092247 Ga0501080_0092247_401_1687 371
490 3300049743 Ga0501081_0068983 Ga0501081_0068983_625_1911 371
491 3300049824 Ga0501045_0014345 Ga0501045_0014345_2334_3620 371
492 3300050509 nmdc:mga0qj67_53748_c1 nmdc:mga0qj67_53748_c1_1854_3143 371
493 3300050510 nmdc:mga06r32_371657_c1 nmdc:mga06r32_371657_c1_34_1323 371
494 3300050511 nmdc:mga08y16_68878_c1 nmdc:mga08y16_68878_c1_1748_3037 371
495 3300005295 Ga0065707_10110315 Ga0065707_101103152 372
496 3300005331 Ga0070670_100106425 Ga0070670_1001064252 372
497 3300005347 Ga0070668_100185610 Ga0070668_1001856102 372
498 3300005353 Ga0070669_100009719 Ga0070669_1000097194 372
499 3300005441 Ga0070700_100081208 Ga0070700_1000812082 372
500 3300005471 Ga0070698_100003289 Ga0070698_1000032895 372
501 3300005471 Ga0070698_100034805 Ga0070698_1000348054 372
502 3300005543 Ga0070672_100168701 Ga0070672_1001687011 372
503 3300006028 Ga0070717_10000852 Ga0070717_1000085212 372
504 3300006852 Ga0075433_10035407 Ga0075433_100354073 372
505 3300006871 Ga0075434_100049838 Ga0075434_1000498382 372
506 3300009094 Ga0111539_10028076 Ga0111539_100280765 372
507 3300009147 Ga0114129_10148828 Ga0114129_101488282 372
508 3300009553 Ga0105249_10000131 Ga0105249_1000013162 372
509 3300025915 Ga0207693_10048697 Ga0207693_100486973 372
510 3300025923 Ga0207681_10002777 Ga0207681_100027777 372
511 3300025928 Ga0207700_10000462 Ga0207700_100004628 372
512 3300025933 Ga0207706_10024841 Ga0207706_100248413 372
513 3300025972 Ga0207668_10007120 Ga0207668_100071203 372
514 3300026075 Ga0207708_10018656 Ga0207708_100186562 372
515 3300026089 Ga0207648_10204247 Ga0207648_102042472 372
516 3300026116 Ga0207674_10011994 Ga0207674_100119943 372
517 3300026118 Ga0207675_100012994 Ga0207675_1000129945 372
518 3300028380 Ga0268265_10000717 Ga0268265_1000071718 372
519 3300049743 Ga0501081_0062751 Ga0501081_0062751_1117_2406 372
520 3300049822 Ga0501035_0232737 Ga0501035_0232737_114_1385 372
521 3300050507 nmdc:mga05p37_121331_c1 nmdc:mga05p37_121331_c1_1775_3064 372
522 3300050510 nmdc:mga06r32_76361_c1 nmdc:mga06r32_76361_c1_703_1992 372
523 3300050511 nmdc:mga08y16_24875_c1 nmdc:mga08y16_24875_c1_3761_5053 372
524 3300050512 nmdc:mga0n895_50160_c1 nmdc:mga0n895_50160_c1_1083_2372 372
525 3300050515 nmdc:mga0a205_7237_c1 nmdc:mga0a205_7237_c1_6040_7329 372
526 3300005290 Ga0065712_10121264 Ga0065712_101212641 373
527 3300005293 Ga0065715_10002581 Ga0065715_100025814 373
528 3300005327 Ga0070658_10009239 Ga0070658_100092396 373
529 3300005329 Ga0070683_100027246 Ga0070683_1000272464 373
530 3300005333 Ga0070677_10046335 Ga0070677_100463352 373
531 3300005337 Ga0070682_100001339 Ga0070682_1000013395 373
532 3300005354 Ga0070675_100030544 Ga0070675_1000305443 373
533 3300005436 Ga0070713_100004613 Ga0070713_1000046133 373
534 3300005441 Ga0070700_100017080 Ga0070700_1000170802 373
535 3300005445 Ga0070708_100000557 Ga0070708_10000055719 373
536 3300005468 Ga0070707_100011264 Ga0070707_1000112644 373
537 3300005530 Ga0070679_100090680 Ga0070679_1000906802 373
538 3300005536 Ga0070697_100050303 Ga0070697_1000503032 373
539 3300005539 Ga0068853_100049463 Ga0068853_1000494632 373
540 3300005545 Ga0070695_100000817 Ga0070695_1000008178 373
541 3300005563 Ga0068855_100002065 Ga0068855_10000206519 373
542 3300006844 Ga0075428_100002736 Ga0075428_1000027364 373
543 3300006846 Ga0075430_100015905 Ga0075430_1000159055 373
544 3300006847 Ga0075431_100010472 Ga0075431_1000104722 373
545 3300009093 Ga0105240_10221102 Ga0105240_102211022 373
546 3300010159 Ga0099796_10010200 Ga0099796_100102002 373
547 3300013297 Ga0157378_10039374 Ga0157378_100393742 373
548 3300013307 Ga0157372_10024142 Ga0157372_100241424 373
549 3300025910 Ga0207684_10119286 Ga0207684_101192862 373
550 3300025913 Ga0207695_10273788 Ga0207695_102737882 373
551 3300025921 Ga0207652_10082019 Ga0207652_100820192 373
552 3300025922 Ga0207646_10001823 Ga0207646_1000182314 373
553 3300025922 Ga0207646_10025374 Ga0207646_100253744 373
554 3300025928 Ga0207700_10004118 Ga0207700_100041183 373
555 3300025929 Ga0207664_10014464 Ga0207664_100144645 373
556 3300025949 Ga0207667_10007778 Ga0207667_100077784 373
557 3300026041 Ga0207639_10072799 Ga0207639_100727992 373
558 3300031548 Ga0307408_100035072 Ga0307408_1000350721 373
559 3300031824 Ga0307413_10121346 Ga0307413_101213462 373
560 3300031852 Ga0307410_10000406 Ga0307410_1000040615 373
561 3300031901 Ga0307406_10011407 Ga0307406_100114071 373
562 3300031903 Ga0307407_10003394 Ga0307407_100033945 373
563 3300031911 Ga0307412_10014392 Ga0307412_100143924 373
564 3300031995 Ga0307409_100029942 Ga0307409_1000299424 373
565 3300032002 Ga0307416_100000293 Ga0307416_10000029313 373
566 3300032004 Ga0307414_10063513 Ga0307414_100635132 373
567 3300032005 Ga0307411_10015123 Ga0307411_100151234 373
568 3300045051 Ga0451576_0179464 Ga0451576_0179464_284_1573 373
569 3300048915 Ga0496112_0091036 Ga0496112_0091036_1036_2325 373
570 3300050510 nmdc:mga06r32_11221_c1 nmdc:mga06r32_11221_c1_2091_3380 373
571 3300050510 nmdc:mga06r32_270345_c1 nmdc:mga06r32_270345_c1_139_1428 373
572 3300050513 nmdc:mga0rr50_54470_c1 nmdc:mga0rr50_54470_c1_1542_2831 373
573 3300005329 Ga0070683_100022900 Ga0070683_1000229002 374
574 3300005564 Ga0070664_100030867 Ga0070664_1000308673 374
575 3300025927 Ga0207687_10135521 Ga0207687_101355212 374
576 3300031251 Ga0265327_10005655 Ga0265327_100056553 374
577 3300031711 Ga0265314_10009257 Ga0265314_100092572 374
578 3300050515 nmdc:mga0a205_22607_c1 nmdc:mga0a205_22607_c1_3252_4541 374
579 3300005290 Ga0065712_10118316 Ga0065712_101183161 375
580 3300005327 Ga0070658_10003927 Ga0070658_100039274 375
581 3300005328 Ga0070676_10069492 Ga0070676_100694922 375
582 3300005335 Ga0070666_10113029 Ga0070666_101130292 375
583 3300005339 Ga0070660_100185224 Ga0070660_1001852242 375
584 3300005340 Ga0070689_100045006 Ga0070689_1000450062 375
585 3300005343 Ga0070687_100026118 Ga0070687_1000261182 375
586 3300005353 Ga0070669_100014947 Ga0070669_1000149474 375
587 3300005354 Ga0070675_100098687 Ga0070675_1000986872 375
588 3300005355 Ga0070671_100062509 Ga0070671_1000625092 375
589 3300005365 Ga0070688_100005942 Ga0070688_1000059424 375
590 3300005367 Ga0070667_100200725 Ga0070667_1002007252 375
591 3300005367 Ga0070667_100270132 Ga0070667_1002701321 375
592 3300005459 Ga0068867_100018001 Ga0068867_1000180014 375
593 3300005466 Ga0070685_10026695 Ga0070685_100266951 375
594 3300005543 Ga0070672_100002781 Ga0070672_1000027818 375
595 3300005543 Ga0070672_100019911 Ga0070672_1000199112 375
596 3300005577 Ga0068857_100023658 Ga0068857_1000236584 375
597 3300005834 Ga0068851_10030572 Ga0068851_100305722 375
598 3300005840 Ga0068870_10059539 Ga0068870_100595392 375
599 3300009177 Ga0105248_10208359 Ga0105248_102083592 375
600 3300009177 Ga0105248_10250434 Ga0105248_102504341 375
601 3300009177 Ga0105248_10273841 Ga0105248_102738412 375
602 3300014745 Ga0157377_10081574 Ga0157377_100815742 375
603 3300025321 Ga0207656_10065099 Ga0207656_100650992 375
604 3300025904 Ga0207647_10082828 Ga0207647_100828282 375
605 3300025907 Ga0207645_10011870 Ga0207645_100118703 375
606 3300025909 Ga0207705_10020700 Ga0207705_100207004 375
607 3300025918 Ga0207662_10019617 Ga0207662_100196173 375
608 3300025919 Ga0207657_10124715 Ga0207657_101247152 375
609 3300025923 Ga0207681_10007052 Ga0207681_100070521 375
610 3300025926 Ga0207659_10002226 Ga0207659_100022262 375
611 3300025934 Ga0207686_10038782 Ga0207686_100387821 375
612 3300025940 Ga0207691_10070979 Ga0207691_100709792 375
613 3300025940 Ga0207691_10119919 Ga0207691_101199192 375
614 3300025941 Ga0207711_10210757 Ga0207711_102107572 375
615 3300025944 Ga0207661_10021067 Ga0207661_100210674 375
616 3300025944 Ga0207661_10112683 Ga0207661_101126832 375
617 3300026095 Ga0207676_10186267 Ga0207676_101862672 375
618 3300026116 Ga0207674_10009905 Ga0207674_100099052 375
619 3300026116 Ga0207674_10042626 Ga0207674_100426264 375
620 3300028379 Ga0268266_10016390 Ga0268266_100163904 375
621 3300031731 Ga0307405_10002565 Ga0307405_100025653 375
622 3300031731 Ga0307405_10008225 Ga0307405_100082252 375
623 3300031852 Ga0307410_10002408 Ga0307410_100024085 375
624 3300031901 Ga0307406_10003825 Ga0307406_100038255 375
625 3300031903 Ga0307407_10002412 Ga0307407_100024124 375
626 3300031911 Ga0307412_10029034 Ga0307412_100290342 375
627 3300031995 Ga0307409_100003789 Ga0307409_1000037895 375
628 3300032002 Ga0307416_100126061 Ga0307416_1001260612 375
629 3300032004 Ga0307414_10012081 Ga0307414_100120813 375
630 3300032004 Ga0307414_10086585 Ga0307414_100865852 375
631 3300032005 Ga0307411_10011708 Ga0307411_100117082 375
632 3300045051 Ga0451576_0081376 Ga0451576_0081376_66_1349 375
633 3300046539 Ga0495621_0004550 Ga0495621_0004550_79_1362 375
634 3300048090 Ga0495615_0013186 Ga0495615_0013186_330_1613 375
635 3300048907 Ga0496104_0233546 Ga0496104_0233546_450_1730 375
636 3300000549 LJQas_1004512 LJQas_10045122 376
637 3300005327 Ga0070658_10001116 Ga0070658_100011164 376
638 3300005327 Ga0070658_10001610 Ga0070658_1000161012 376
639 3300005339 Ga0070660_100023520 Ga0070660_1000235203 376
640 3300005356 Ga0070674_100194195 Ga0070674_1001941952 376
641 3300005530 Ga0070679_100071411 Ga0070679_1000714112 376
642 3300005616 Ga0068852_100011168 Ga0068852_1000111684 376
643 3300005616 Ga0068852_100157233 Ga0068852_1001572332 376
644 3300006847 Ga0075431_100092265 Ga0075431_1000922652 376
645 3300006880 Ga0075429_100024903 Ga0075429_1000249035 376
646 3300013102 Ga0157371_10014535 Ga0157371_100145353 376
647 3300013105 Ga0157369_10023239 Ga0157369_100232395 376
648 3300013105 Ga0157369_10067494 Ga0157369_100674942 376
649 3300013307 Ga0157372_10001161 Ga0157372_100011619 376
650 3300013307 Ga0157372_10006620 Ga0157372_100066204 376
651 3300025909 Ga0207705_10001150 Ga0207705_100011504 376
652 3300025909 Ga0207705_10005894 Ga0207705_100058948 376
653 3300025919 Ga0207657_10001987 Ga0207657_100019874 376
654 3300025919 Ga0207657_10054966 Ga0207657_100549663 376
655 3300026089 Ga0207648_10033355 Ga0207648_100333554 376
656 3300026142 Ga0207698_10002882 Ga0207698_100028824 376
657 3300031731 Ga0307405_10059148 Ga0307405_100591482 376
658 3300031824 Ga0307413_10004330 Ga0307413_100043304 376
659 3300031911 Ga0307412_10166396 Ga0307412_101663962 376
660 3300032002 Ga0307416_100056918 Ga0307416_1000569182 376
661 3300032002 Ga0307416_100178347 Ga0307416_1001783472 376
662 3300046499 Ga0495594_0068855 Ga0495594_0068855_446_1729 376
663 3300048918 Ga0496115_0132833 Ga0496115_0132833_220_1503 376
664 3300049571 Ga0501034_0203830 Ga0501034_0203830_116_1396 376
665 3300049574 Ga0501038_0021849 Ga0501038_0021849_3490_4770 376
666 3300049579 Ga0501043_0032922 Ga0501043_0032922_991_2271 376
667 3300049581 Ga0501047_0002061 Ga0501047_0002061_4737_6017 376
668 3300049586 Ga0501070_0007886 Ga0501070_0007886_5371_6651 376
669 3300050508 nmdc:mga09592_21081_c1 nmdc:mga09592_21081_c1_3183_4472 376
670 3300050509 nmdc:mga0qj67_24446_c1 nmdc:mga0qj67_24446_c1_3240_4529 376
671 3300050510 nmdc:mga06r32_196984_c1 nmdc:mga06r32_196984_c1_186_1475 376

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

57

108

0.96

PF00529

CusB_dom_1

Cation efflux system protein CusB domain 1

8

397

0.79

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

44

302

0.79

PF13437

HlyD_3

HlyD family secretion protein

62

167

0.78

PF13437

HlyD_3

HlyD family secretion protein

186

302

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cdx-assembly1.cif.gz_B crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.8416 62 92
5vz0-assembly1.cif.gz_A crystal structure of lactococcus lactis pyruvate carboxylase g746a mutant in complex with cyclic-di-amp 0.8283 62 173
7ybu-assembly1.cif.gz_A human propionyl-coenzyme a carboxylase 0.8283 58 173
5gu9-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant 0.8256 62 172
7wta-assembly1.cif.gz_D cryo-em structure of human pyruvate carboxylase in apo state 0.8248 62 173
ID Description Score Start End Superfamily
3t51B01 Mainly Beta;Beta Barrel;conserved putative lor/sdh protein from methanococcus maripaludis s2 fold; 0.891 268 346 2.40.420.20
4l8jA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8887 59 175 2.40.50.100
4kkuA01 Mainly Beta;Beta Barrel;conserved putative lor/sdh protein from methanococcus maripaludis s2 fold; 0.8797 268 363 2.40.420.20
af_Q553S7_647_713_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8767 63 155 2.40.50.100
af_Q54KE6_633_699_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8762 63 172 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7Y5T1M2-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.7719 28 363 GO:0015562
GO:1990281
AF-A0A2D7SQW6-F1-model_v4 Efflux transporter periplasmic adaptor subunit 0.7678 30 362 GO:0015562
GO:1990281
AF-A0A1Y6KGQ7-F1-model_v4 Multidrug resistance efflux pump 0.767 45 261 GO:0016020
AF-A0A2E7GEI6-F1-model_v4 deleted 0.766 27 351
AF-Q6MGV3-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.7619 28 363 GO:0015562
GO:1990281

Feature Viewer

pLDDT pTM Quality
75.15 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map