F474172

General Info

Members Datasets Scaffolds Average Seq Length
671 283 671 164

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0107596|Ga0373931_0107596_295_867
Length 190
Sequence VSATDEERIEDRGLKIDETSARQNDSPSSVSKNMALEFSPETYKKFEETIARYPKKEAAMLPVLCLAQREFGHLGQEAIEYVAQLMDQSPARVQGVVSFYTMLNPKPIGRHHIQVCRTLPCALRGAEKLTSFLKKTLDIELGQTTGDGRFTLSEVECLASCGTAPMMQINDDYYENLTDEKVTEILAALK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
135 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
136 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
140 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
141 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
168 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
169 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
170 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
187 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
198 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
236 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
262 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.89
Rhizosphere 98.81
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10035096 3300003320 Bacteria 2716
2 rootH1_10072186 3300003323 Bacteria 2407
3 JGI25405J52794_10000874 3300003911 Bacteria 4705
4 Ga0065717_1010041 3300005276 Bacteria 632
5 Ga0065704_10008073 3300005289 Bacteria 5059
6 Ga0065704_10374914 3300005289 Bacteria 780
7 Ga0065715_10102569 3300005293 Bacteria 3062
8 Ga0065707_10003878 3300005295 Bacteria 5978
9 Ga0065707_10092570 3300005295 Bacteria 3748
10 Ga0070658_10120517 3300005327 Bacteria 2180
11 Ga0070658_10273866 3300005327 Bacteria 1436
12 Ga0070676_10076976 3300005328 Bacteria 2015
13 Ga0070683_100238398 3300005329 Unclassified 1730
14 Ga0070683_101652396 3300005329 Unclassified 616
15 Ga0070690_100332723 3300005330 Bacteria 1098
16 Ga0070680_100007262 3300005336 Bacteria 8443
17 Ga0070660_100021860 3300005339 Bacteria 4724
18 Ga0070660_100171307 3300005339 Bacteria 1753
19 Ga0070689_100176832 3300005340 Bacteria 1732
20 Ga0070689_100210854 3300005340 Bacteria 1590
21 Ga0070661_100426779 3300005344 Bacteria 1051
22 Ga0070668_100182326 3300005347 Unclassified 1716
23 Ga0070675_100705311 3300005354 Bacteria 919
24 Ga0070671_100214335 3300005355 Bacteria 1633
25 Ga0070674_100496881 3300005356 Unclassified 1015
26 Ga0070674_100834819 3300005356 Bacteria 798
27 Ga0070673_101023122 3300005364 Bacteria 770
28 Ga0070688_100985682 3300005365 Bacteria 669
29 Ga0070659_100116680 3300005366 Bacteria 2158
30 Ga0070659_100718977 3300005366 Unclassified 865
31 Ga0070659_101458029 3300005366 Bacteria 609
32 Ga0070703_10285674 3300005406 Bacteria 682
33 Ga0070713_100247274 3300005436 Bacteria 1626
34 Ga0070701_10059197 3300005438 Bacteria 2013
35 Ga0070711_100002821 3300005439 Bacteria 9974
36 Ga0070705_100290095 3300005440 Bacteria 1168
37 Ga0070700_101057291 3300005441 Unclassified 670
38 Ga0070694_100066050 3300005444 Bacteria 2481
39 Ga0070663_100224172 3300005455 Bacteria 1477
40 Ga0070662_100029032 3300005457 Bacteria 3856
41 Ga0070662_100228859 3300005457 Bacteria 1487
42 Ga0070681_10329466 3300005458 Bacteria 1436
43 Ga0070681_10478536 3300005458 Unclassified 1158
44 Ga0070681_10580972 3300005458 Bacteria 1034
45 Ga0068867_100244048 3300005459 Bacteria 1458
46 Ga0068867_100410895 3300005459 Bacteria 1144
47 Ga0070706_100169487 3300005467 Bacteria 2038
48 Ga0070707_100797031 3300005468 Bacteria 908
49 Ga0070698_100200378 3300005471 Bacteria 1932
50 Ga0070699_100137384 3300005518 Bacteria 2157
51 Ga0070699_101080395 3300005518 Unclassified 736
52 Ga0070679_100031128 3300005530 Bacteria 5270
53 Ga0070679_100163077 3300005530 Bacteria 2202
54 Ga0070679_100342609 3300005530 Bacteria 1443
55 Ga0070679_100768301 3300005530 Bacteria 906
56 Ga0070697_100013638 3300005536 Bacteria 6375
57 Ga0070697_101306969 3300005536 Bacteria 647
58 Ga0068853_100026471 3300005539 Bacteria 4870
59 Ga0070672_100378047 3300005543 Bacteria 1211
60 Ga0070686_100013098 3300005544 Bacteria 4734
61 Ga0070686_100200988 3300005544 Bacteria 1429
62 Ga0070686_100387757 3300005544 Bacteria 1059
63 Ga0070686_101076683 3300005544 Bacteria 663
64 Ga0070695_100822023 3300005545 Bacteria 746
65 Ga0070696_100557346 3300005546 Bacteria 919
66 Ga0070704_100101420 3300005549 Bacteria 2170
67 Ga0070704_100387832 3300005549 Bacteria 1189
68 Ga0070704_100665055 3300005549 Bacteria 921
69 Ga0068855_100019809 3300005563 Bacteria 8083
70 Ga0068855_100044981 3300005563 Bacteria 5223
71 Ga0068855_100132174 3300005563 Bacteria 2849
72 Ga0068855_100180493 3300005563 Bacteria 2387
73 Ga0068855_100505567 3300005563 Bacteria 1313
74 Ga0068855_100619972 3300005563 Bacteria 1165
75 Ga0070664_100004565 3300005564 Bacteria 11110
76 Ga0070664_100329546 3300005564 Bacteria 1385
77 Ga0068857_100619848 3300005577 Unclassified 1024
78 Ga0068856_100000058 3300005614 Bacteria 101767
79 Ga0068856_100145557 3300005614 Bacteria 2377
80 Ga0068856_100981778 3300005614 Bacteria 863
81 Ga0068856_101580387 3300005614 Bacteria 669
82 Ga0068859_100056294 3300005617 Bacteria 3957
83 Ga0068859_100553504 3300005617 Bacteria 1245
84 Ga0068859_101720199 3300005617 Bacteria 693
85 Ga0068859_101849658 3300005617 Bacteria 667
86 Ga0068859_101877372 3300005617 Bacteria 662
87 Ga0068864_100481137 3300005618 Bacteria 1192
88 Ga0068866_10591179 3300005718 Bacteria 748
89 Ga0068861_100281316 3300005719 Bacteria 1433
90 Ga0068861_100282978 3300005719 Bacteria 1429
91 Ga0068870_10235917 3300005840 Bacteria 1127
92 Ga0068863_101513405 3300005841 Bacteria 680
93 Ga0068858_100133244 3300005842 Bacteria 2331
94 Ga0068860_100642649 3300005843 Bacteria 1068
95 Ga0068862_100326998 3300005844 Bacteria 1417
96 Ga0081455_10000067 3300005937 Bacteria 112338
97 Ga0081538_10026589 3300005981 Bacteria 4042
98 Ga0070715_10276745 3300006163 Bacteria 888
99 Ga0070716_100038753 3300006173 Bacteria 2641
100 Ga0075428_100003743 3300006844 Bacteria 16685
101 Ga0075428_100033541 3300006844 Bacteria 5668
102 Ga0075428_100785356 3300006844 Bacteria 1012
103 Ga0075428_100803318 3300006844 Bacteria 1000
104 Ga0075428_101394360 3300006844 Bacteria 736
105 Ga0075428_102219524 3300006844 Bacteria 566
106 Ga0075430_100022482 3300006846 Bacteria 5366
107 Ga0075430_100064532 3300006846 Bacteria 3076
108 Ga0075430_100336789 3300006846 Bacteria 1246
109 Ga0075430_100561865 3300006846 Bacteria 941
110 Ga0075430_100602377 3300006846 Unclassified 906
111 Ga0075431_100045936 3300006847 Bacteria 4502
112 Ga0075431_100128194 3300006847 Bacteria 2618
113 Ga0075431_100223521 3300006847 Bacteria 1920
114 Ga0075431_100558356 3300006847 Bacteria 1132
115 Ga0075431_100814038 3300006847 Bacteria 907
116 Ga0075433_10000198 3300006852 Bacteria 33744
117 Ga0075433_10006171 3300006852 Bacteria 9451
118 Ga0075433_10144946 3300006852 Bacteria 2111
119 Ga0075433_10606409 3300006852 Bacteria 961
120 Ga0075434_100000499 3300006871 Bacteria 29689
121 Ga0075434_100035710 3300006871 Bacteria 4914
122 Ga0075434_100065270 3300006871 Bacteria 3625
123 Ga0075434_100106881 3300006871 Bacteria 2808
124 Ga0075434_101203975 3300006871 Unclassified 769
125 Ga0075429_100015520 3300006880 Bacteria 6600
126 Ga0075429_100103703 3300006880 Bacteria 2484
127 Ga0075429_100202317 3300006880 Bacteria 1740
128 Ga0075429_100351730 3300006880 Bacteria 1290
129 Ga0075429_100352545 3300006880 Bacteria 1288
130 Ga0075429_100790680 3300006880 Unclassified 831
131 Ga0075429_100914938 3300006880 Unclassified 767
132 Ga0075436_100747602 3300006914 Bacteria 726
133 Ga0075436_100768047 3300006914 Unclassified 716
134 Ga0075436_100869000 3300006914 Bacteria 674
135 Ga0097620_100056294 3300006931 Bacteria 3957
136 Ga0097620_100553453 3300006931 Bacteria 1245
137 Ga0097620_101720231 3300006931 Bacteria 693
138 Ga0097620_101849601 3300006931 Bacteria 667
139 Ga0097620_101877507 3300006931 Bacteria 662
140 Ga0075435_100015294 3300007076 Bacteria 5766
141 Ga0075435_100063745 3300007076 Bacteria 2993
142 Ga0075435_100103969 3300007076 Bacteria 2356
143 Ga0075435_100163133 3300007076 Bacteria 1878
144 Ga0075435_100353956 3300007076 Bacteria 1259
145 Ga0075435_100918035 3300007076 Bacteria 764
146 Ga0105240_10134769 3300009093 Bacteria 2958
147 Ga0105240_10167864 3300009093 Bacteria 2601
148 Ga0105240_10202948 3300009093 Bacteria 2322
149 Ga0105240_10442939 3300009093 Bacteria 1455
150 Ga0105240_11380586 3300009093 Unclassified 741
151 Ga0111539_10004958 3300009094 Bacteria 17316
152 Ga0111539_10494989 3300009094 Bacteria 1424
153 Ga0111539_10737525 3300009094 Bacteria 1147
154 Ga0114129_10147465 3300009147 Bacteria 3222
155 Ga0114129_10929001 3300009147 Bacteria 1100
156 Ga0114129_10948048 3300009147 Bacteria 1087
157 Ga0114129_11497166 3300009147 Unclassified 829
158 Ga0105243_10809286 3300009148 Bacteria 924
159 Ga0105241_10066720 3300009174 Bacteria 2783
160 Ga0105242_10295108 3300009176 Bacteria 1477
161 Ga0105242_10935549 3300009176 Bacteria 870
162 Ga0105248_11068070 3300009177 Bacteria 912
163 Ga0105237_10207788 3300009545 Bacteria 1958
164 Ga0105238_10027652 3300009551 Bacteria 5781
165 Ga0105238_10105220 3300009551 Bacteria 2803
166 Ga0105238_10325421 3300009551 Bacteria 1523
167 Ga0105238_11481675 3300009551 Bacteria 707
168 Ga0105249_10077893 3300009553 Bacteria 3075
169 Ga0105249_10330705 3300009553 Bacteria 1537
170 Ga0105239_11393119 3300010375 Bacteria 809
171 Ga0105246_10158891 3300011119 Bacteria 1720
172 Ga0105246_11025133 3300011119 Bacteria 749
173 Ga0157371_10284288 3300013102 Bacteria 1195
174 Ga0157370_10045311 3300013104 Bacteria 4220
175 Ga0157370_10500966 3300013104 Unclassified 1115
176 Ga0157374_10148125 3300013296 Bacteria 2281
177 Ga0157374_10497820 3300013296 Bacteria 1223
178 Ga0157374_10995042 3300013296 Bacteria 857
179 Ga0157378_10101242 3300013297 Bacteria 2631
180 Ga0157378_10294608 3300013297 Bacteria 1568
181 Ga0157378_10404458 3300013297 Bacteria 1346
182 Ga0157378_10681764 3300013297 Bacteria 1046
183 Ga0163162_10065901 3300013306 Bacteria 3670
184 Ga0163162_11007903 3300013306 Bacteria 942
185 Ga0163162_11302432 3300013306 Bacteria 825
186 Ga0157372_10187482 3300013307 Bacteria 2395
187 Ga0157375_10855522 3300013308 Unclassified 1056
188 Ga0157375_12744949 3300013308 Bacteria 589
189 Ga0163163_10131060 3300014325 Unclassified 2548
190 Ga0163163_11573677 3300014325 Bacteria 718
191 Ga0157379_11234793 3300014968 Unclassified 720
192 Ga0157376_12159843 3300014969 Bacteria 595
193 Ga0207642_10452660 3300025899 Bacteria 778
194 Ga0207645_10109541 3300025907 Unclassified 1787
195 Ga0207705_10213479 3300025909 Bacteria 1464
196 Ga0207654_10074411 3300025911 Bacteria 2027
197 Ga0207707_10002190 3300025912 Bacteria 17705
198 Ga0207707_10003311 3300025912 Bacteria 14317
199 Ga0207707_10399978 3300025912 Bacteria 1179
200 Ga0207695_10101741 3300025913 Bacteria 2867
201 Ga0207695_10119012 3300025913 Bacteria 2612
202 Ga0207695_10154957 3300025913 Bacteria 2226
203 Ga0207695_10246284 3300025913 Bacteria 1687
204 Ga0207663_10001010 3300025916 Bacteria 12879
205 Ga0207660_10002204 3300025917 Bacteria 12890
206 Ga0207660_10020490 3300025917 Bacteria 4438
207 Ga0207660_10327971 3300025917 Bacteria 1223
208 Ga0207657_10072423 3300025919 Bacteria 2915
209 Ga0207649_10177455 3300025920 Bacteria 1489
210 Ga0207652_10010626 3300025921 Bacteria 7412
211 Ga0207652_10128185 3300025921 Bacteria 2261
212 Ga0207652_10131207 3300025921 Bacteria 2235
213 Ga0207652_10510644 3300025921 Bacteria 1082
214 Ga0207646_10231723 3300025922 Bacteria 1668
215 Ga0207681_10329627 3300025923 Bacteria 1216
216 Ga0207694_10015363 3300025924 Bacteria 5775
217 Ga0207694_10044221 3300025924 Bacteria 3439
218 Ga0207694_10053022 3300025924 Bacteria 3144
219 Ga0207694_10308600 3300025924 Bacteria 1304
220 Ga0207650_10001410 3300025925 Bacteria 17316
221 Ga0207664_10005849 3300025929 Bacteria 8410
222 Ga0207644_10066257 3300025931 Bacteria 2629
223 Ga0207690_10004342 3300025932 Bacteria 8375
224 Ga0207706_10138572 3300025933 Bacteria 2140
225 Ga0207706_10236887 3300025933 Bacteria 1596
226 Ga0207686_10360841 3300025934 Bacteria 1097
227 Ga0207670_10055093 3300025936 Bacteria 2686
228 Ga0207670_10060592 3300025936 Bacteria 2579
229 Ga0207670_10531461 3300025936 Bacteria 959
230 Ga0207669_10680684 3300025937 Bacteria 844
231 Ga0207704_10122382 3300025938 Bacteria 1784
232 Ga0207711_11061386 3300025941 Bacteria 750
233 Ga0207661_10327449 3300025944 Bacteria 1378
234 Ga0207661_10376835 3300025944 Bacteria 1284
235 Ga0207679_10007766 3300025945 Bacteria 6818
236 Ga0207667_10034747 3300025949 Bacteria 5411
237 Ga0207667_10141572 3300025949 Bacteria 2476
238 Ga0207667_10168415 3300025949 Bacteria 2252
239 Ga0207667_10389931 3300025949 Bacteria 1418
240 Ga0207667_10531277 3300025949 Bacteria 1191
241 Ga0207712_11169369 3300025961 Unclassified 686
242 Ga0207668_10474681 3300025972 Bacteria 1072
243 Ga0207703_10088615 3300026035 Bacteria 2598
244 Ga0207678_10018177 3300026067 Bacteria 6173
245 Ga0207702_10002049 3300026078 Bacteria 19503
246 Ga0207702_10025697 3300026078 Bacteria 4888
247 Ga0207702_10697721 3300026078 Bacteria 1000
248 Ga0207641_10997168 3300026088 Bacteria 834
249 Ga0207676_10175131 3300026095 Unclassified 1873
250 Ga0207676_10419798 3300026095 Bacteria 1254
251 Ga0207676_11459380 3300026095 Unclassified 681
252 Ga0207683_10147110 3300026121 Bacteria 2125
253 Ga0210002_1057893 3300027617 Bacteria 674
254 Ga0209971_1012080 3300027682 Bacteria 2044
255 Ga0209974_10002328 3300027876 Bacteria 6894
256 Ga0207428_10013239 3300027907 Bacteria 7216
257 Ga0207428_10276090 3300027907 Bacteria 1248
258 Ga0268264_10452395 3300028381 Bacteria 1244
259 Ga0265337_1000140 3300028556 Bacteria 36107
260 Ga0265337_1001274 3300028556 Bacteria 12670
261 Ga0265337_1002167 3300028556 Bacteria 9209
262 Ga0265337_1006735 3300028556 Bacteria 4379
263 Ga0265337_1015350 3300028556 Bacteria 2509
264 Ga0265326_10001872 3300028558 Bacteria 7206
265 Ga0265326_10006429 3300028558 Bacteria 3652
266 Ga0265326_10106052 3300028558 Bacteria 797
267 Ga0265326_10170413 3300028558 Bacteria 623
268 Ga0265319_1000007 3300028563 Bacteria 217194
269 Ga0265319_1029444 3300028563 Bacteria 1927
270 Ga0265319_1043151 3300028563 Bacteria 1515
271 Ga0265319_1100430 3300028563 Bacteria 908
272 Ga0265334_10011533 3300028573 Bacteria 3719
273 Ga0265334_10052800 3300028573 Bacteria 1554
274 Ga0265334_10199677 3300028573 Bacteria 695
275 Ga0265318_10057750 3300028577 Bacteria 1449
276 Ga0265318_10235343 3300028577 Unclassified 668
277 Ga0265323_10000237 3300028653 Bacteria 32647
278 Ga0265323_10029666 3300028653 Bacteria 2044
279 Ga0265323_10123693 3300028653 Bacteria 841
280 Ga0265322_10088443 3300028654 Bacteria 879
281 Ga0265322_10125051 3300028654 Bacteria 733
282 Ga0265336_10000819 3300028666 Bacteria 16328
283 Ga0265336_10014566 3300028666 Bacteria 2603
284 Ga0265336_10052476 3300028666 Bacteria 1229
285 Ga0265336_10077152 3300028666 Bacteria 995
286 Ga0265338_10000075 3300028800 Bacteria 180334
287 Ga0265338_10000425 3300028800 Bacteria 75565
288 Ga0265338_10000431 3300028800 Bacteria 75210
289 Ga0265338_10000945 3300028800 Bacteria 48867
290 Ga0265338_10001555 3300028800 Bacteria 37061
291 Ga0265338_10002354 3300028800 Bacteria 28532
292 Ga0265338_10004123 3300028800 Bacteria 19904
293 Ga0265338_10009242 3300028800 Bacteria 11797
294 Ga0265338_10009353 3300028800 Bacteria 11706
295 Ga0265338_10010670 3300028800 Bacteria 10734
296 Ga0265338_10013146 3300028800 Bacteria 9375
297 Ga0265338_10018502 3300028800 Bacteria 7456
298 Ga0265338_10019978 3300028800 Bacteria 7071
299 Ga0265338_10020690 3300028800 Bacteria 6905
300 Ga0265338_10022140 3300028800 Bacteria 6596
301 Ga0265338_10052394 3300028800 Bacteria 3661
302 Ga0265338_10052887 3300028800 Bacteria 3639
303 Ga0265338_10073848 3300028800 Bacteria 2904
304 Ga0265338_10105052 3300028800 Bacteria 2290
305 Ga0265338_10107502 3300028800 Bacteria 2256
306 Ga0265338_10213267 3300028800 Bacteria 1447
307 Ga0265338_10233848 3300028800 Bacteria 1365
308 Ga0265338_10251731 3300028800 Bacteria 1303
309 Ga0265338_10298128 3300028800 Bacteria 1173
310 Ga0265338_10462476 3300028800 Bacteria 897
311 Ga0265338_10470376 3300028800 Bacteria 888
312 Ga0265324_10000515 3300029957 Bacteria 26598
313 Ga0265324_10005688 3300029957 Bacteria 5324
314 Ga0265324_10006339 3300029957 Bacteria 4950
315 Ga0265324_10009283 3300029957 Bacteria 3848
316 Ga0265324_10037961 3300029957 Bacteria 1672
317 Ga0265324_10042539 3300029957 Bacteria 1570
318 Ga0265324_10053490 3300029957 Bacteria 1386
319 Ga0265324_10058288 3300029957 Bacteria 1321
320 Ga0265324_10061213 3300029957 Bacteria 1286
321 Ga0265324_10095539 3300029957 Bacteria 1011
322 Ga0265324_10253310 3300029957 Unclassified 598
323 Ga0265330_10381445 3300031235 Bacteria 596
324 Ga0265330_10394163 3300031235 Bacteria 586
325 Ga0265332_10167872 3300031238 Bacteria 916
326 Ga0265320_10000188 3300031240 Bacteria 51229
327 Ga0265320_10004415 3300031240 Bacteria 9228
328 Ga0265320_10016271 3300031240 Bacteria 4173
329 Ga0265320_10025337 3300031240 Bacteria 3119
330 Ga0265320_10027037 3300031240 Bacteria 2996
331 Ga0265320_10027755 3300031240 Bacteria 2947
332 Ga0265320_10160543 3300031240 Bacteria 1012
333 Ga0265320_10192108 3300031240 Bacteria 913
334 Ga0265320_10341778 3300031240 Bacteria 661
335 Ga0265325_10085582 3300031241 Bacteria 1561
336 Ga0265325_10094847 3300031241 Bacteria 1467
337 Ga0265329_10100357 3300031242 Bacteria 921
338 Ga0265340_10000803 3300031247 Bacteria 17782
339 Ga0265340_10027009 3300031247 Bacteria 2896
340 Ga0265340_10057322 3300031247 Bacteria 1872
341 Ga0265340_10063435 3300031247 Bacteria 1763
342 Ga0265339_10014822 3300031249 Bacteria 4690
343 Ga0265339_10024832 3300031249 Bacteria 3448
344 Ga0265339_10025907 3300031249 Bacteria 3361
345 Ga0265339_10296789 3300031249 Bacteria 771
346 Ga0265339_10301890 3300031249 Bacteria 763
347 Ga0265339_10345557 3300031249 Bacteria 702
348 Ga0265331_10239305 3300031250 Bacteria 815
349 Ga0265331_10259269 3300031250 Bacteria 780
350 Ga0265327_10000752 3300031251 Bacteria 50420
351 Ga0265327_10003972 3300031251 Bacteria 13497
352 Ga0265327_10010095 3300031251 Bacteria 6695
353 Ga0265327_10030353 3300031251 Bacteria 3058
354 Ga0265316_10006885 3300031344 Bacteria 10789
355 Ga0265316_10017515 3300031344 Bacteria 6187
356 Ga0265316_10026957 3300031344 Bacteria 4769
357 Ga0265316_10028132 3300031344 Bacteria 4640
358 Ga0265316_10218174 3300031344 Bacteria 1408
359 Ga0265316_10399473 3300031344 Bacteria 990
360 Ga0265316_10484451 3300031344 Bacteria 885
361 Ga0307408_100073609 3300031548 Bacteria 2533
362 Ga0307408_100101694 3300031548 Bacteria 2191
363 Ga0307408_100103521 3300031548 Bacteria 2173
364 Ga0265313_10001008 3300031595 Bacteria 27543
365 Ga0265313_10079892 3300031595 Bacteria 1487
366 Ga0265313_10097366 3300031595 Bacteria 1311
367 Ga0265313_10114218 3300031595 Bacteria 1184
368 Ga0265313_10158762 3300031595 Bacteria 962
369 Ga0265314_10004107 3300031711 Bacteria 13720
370 Ga0265314_10014321 3300031711 Bacteria 6356
371 Ga0265314_10046910 3300031711 Bacteria 3045
372 Ga0265314_10299710 3300031711 Bacteria 902
373 Ga0307405_10690205 3300031731 Unclassified 844
374 Ga0316577_10193797 3300031733 Bacteria 1149
375 Ga0307413_10023725 3300031824 Bacteria 3329
376 Ga0307413_10181231 3300031824 Bacteria 1502
377 Ga0307410_10020407 3300031852 Bacteria 4052
378 Ga0307410_10109075 3300031852 Bacteria 2000
379 Ga0307406_10017625 3300031901 Bacteria 4161
380 Ga0307406_10116626 3300031901 Bacteria 1848
381 Ga0307412_10046977 3300031911 Bacteria 2832
382 Ga0307409_100022840 3300031995 Bacteria 4319
383 Ga0307409_100156826 3300031995 Bacteria 1985
384 Ga0307416_100009264 3300032002 Bacteria 6431
385 Ga0307416_100208409 3300032002 Bacteria 1862
386 Ga0307414_10015643 3300032004 Bacteria 4585
387 Ga0307414_10017900 3300032004 Bacteria 4347
388 Ga0307415_100064304 3300032126 Bacteria 2552
389 Ga0307415_100073290 3300032126 Bacteria 2415
390 Ga0373930_0021703 3300034816 Bacteria 1263
391 Ga0373938_0020453 3300034957 Bacteria 1333
392 Ga0373938_0026517 3300034957 Bacteria 1213
393 Ga0373928_0000124 3300035084 Bacteria 14419
394 Ga0373929_0006750 3300035085 Bacteria 2080
395 Ga0373934_0070470 3300035086 Bacteria 1398
396 Ga0373944_0001296 3300035089 Bacteria 6287
397 Ga0373944_0229717 3300035089 Bacteria 680
398 Ga0373949_0019648 3300035090 Bacteria 1540
399 Ga0373951_0003865 3300035091 Bacteria 3600
400 Ga0373923_0066729 3300035111 Bacteria 1538
401 Ga0373932_0000001 3300035112 Bacteria 1459067
402 Ga0373932_0196402 3300035112 Unclassified 715
403 Ga0373936_0154362 3300035113 Bacteria 997
404 Ga0373939_0087473 3300035114 Bacteria 1047
405 Ga0373945_0025773 3300035116 Bacteria 2045
406 Ga0373945_0027439 3300035116 Bacteria 1989
407 Ga0373953_0155983 3300035117 Bacteria 980
408 Ga0373954_0003285 3300035118 Bacteria 6828
409 Ga0373954_0068773 3300035118 Bacteria 1680
410 Ga0373954_0070100 3300035118 Bacteria 1665
411 Ga0373956_0057609 3300035119 Bacteria 1756
412 Ga0373943_0187804 3300035170 Bacteria 1139
413 Ga0373946_0115194 3300035171 Bacteria 1221
414 Ga0373946_0187661 3300035171 Unclassified 984
415 Ga0373955_0062252 3300035172 Bacteria 2063
416 Ga0373955_0345438 3300035172 Bacteria 901
417 Ga0373961_0045640 3300035241 Bacteria 1282
418 Ga0373962_0000018 3300035242 Bacteria 47177
419 Ga0373962_0076478 3300035242 Bacteria 1009
420 Ga0373931_0000002 3300035691 Bacteria 599830
421 Ga0373931_0005703 3300035691 Bacteria 5782
422 Ga0373931_0107596 3300035691 Bacteria 1577
423 Ga0373931_0271840 3300035691 Bacteria 1038
424 Ga0373935_0091703 3300035692 Bacteria 1990
425 Ga0373935_0392744 3300035692 Bacteria 995
426 Ga0373935_0643648 3300035692 Unclassified 777
427 Ga0373927_0026587 3300035695 Bacteria 3782
428 Ga0373933_0764336 3300035724 Unclassified 636
429 Ga0373947_0025116 3300035725 Bacteria 3474
430 Ga0373947_0049735 3300035725 Bacteria 2518
431 Ga0373937_0025480 3300036401 Bacteria 5338
432 Ga0373937_0090294 3300036401 Bacteria 2837
433 Ga0373925_0000552 3300037068 Bacteria 36801
434 Ga0373925_0011834 3300037068 Bacteria 6313
435 Ga0373925_0127189 3300037068 Bacteria 1983
436 Ga0436361_0889442 3300039447 Bacteria 544
437 Ga0451807_0982052 3300041486 Bacteria 1605
438 Ga0439446_0280187 3300042156 Unclassified 581
439 Ga0439444_0100589 3300042437 Bacteria 655
440 Ga0451577_0008522 3300042876 Bacteria 9973
441 Ga0451577_0064048 3300042876 Bacteria 3279
442 Ga0451577_0150176 3300042876 Bacteria 2096
443 Ga0451577_0963850 3300042876 Bacteria 767
444 Ga0451577_1203803 3300042876 Bacteria 676
445 Ga0466966_0094958 3300044684 Bacteria 1848
446 Ga0453684_0002848 3300044712 Bacteria 40690
447 Ga0453684_0006217 3300044712 Bacteria 22893
448 Ga0453684_0009645 3300044712 Bacteria 16823
449 Ga0453684_0650786 3300044712 Bacteria 1150
450 Ga0453684_0741856 3300044712 Bacteria 1064
451 Ga0453684_1257617 3300044712 Unclassified 774
452 Ga0453684_1460504 3300044712 Bacteria 707
453 Ga0453684_1861747 3300044712 Bacteria 610
454 Ga0451576_0029877 3300045051 Bacteria 5830
455 Ga0451576_0074622 3300045051 Bacteria 3530
456 Ga0451576_0090765 3300045051 Bacteria 3178
457 Ga0451576_0477792 3300045051 Bacteria 1309
458 Ga0451576_0500750 3300045051 Bacteria 1276
459 Ga0451576_0729402 3300045051 Bacteria 1041
460 Ga0451576_0892923 3300045051 Bacteria 932
461 Ga0451576_1051311 3300045051 Bacteria 853
462 Ga0495592_0000023 3300046454 Bacteria 137490
463 Ga0495592_0198406 3300046454 Unclassified 1356
464 Ga0495592_0290727 3300046454 Bacteria 1065
465 Ga0495629_0196643 3300046459 Bacteria 1394
466 Ga0495580_0045476 3300046472 Bacteria 3118
467 Ga0495580_0377969 3300046472 Bacteria 957
468 Ga0495662_0005799 3300046476 Bacteria 6180
469 Ga0495664_0042121 3300046477 Bacteria 2703
470 Ga0495664_0364839 3300046477 Bacteria 869
471 Ga0495608_0333478 3300046511 Bacteria 935
472 Ga0495618_0002603 3300046514 Bacteria 11562
473 Ga0495618_0002646 3300046514 Bacteria 11456
474 Ga0495628_0005164 3300046516 Bacteria 11475
475 Ga0495630_0017877 3300046517 Bacteria 5201
476 Ga0495630_0029891 3300046517 Bacteria 4052
477 Ga0495630_0085176 3300046517 Bacteria 2386
478 Ga0495630_1180276 3300046517 Unclassified 579
479 Ga0495666_0050773 3300046526 Bacteria 1993
480 Ga0495666_0162477 3300046526 Bacteria 1035
481 Ga0495652_0058251 3300046529 Bacteria 3272
482 Ga0495652_0177386 3300046529 Bacteria 1639
483 Ga0495652_0666337 3300046529 Unclassified 703
484 Ga0495640_0006702 3300046533 Bacteria 9088
485 Ga0495640_0189425 3300046533 Bacteria 1308
486 Ga0495586_0001744 3300046535 Bacteria 11869
487 Ga0495586_0002311 3300046535 Bacteria 10358
488 Ga0495586_0650176 3300046535 Unclassified 609
489 Ga0495586_0833867 3300046535 Unclassified 532
490 Ga0495645_0013766 3300046543 Bacteria 5731
491 Ga0495645_0320781 3300046543 Bacteria 1006
492 Ga0495622_0256937 3300046557 Bacteria 767
493 Ga0495667_0371595 3300046559 Bacteria 902
494 Ga0495634_0002060 3300046642 Bacteria 17002
495 Ga0495634_0333356 3300046642 Bacteria 911
496 Ga0495635_0045785 3300046663 Bacteria 3018
497 Ga0495599_0024402 3300046678 Bacteria 3781
498 Ga0495599_0526627 3300046678 Bacteria 694
499 Ga0495646_0154966 3300046680 Bacteria 1272
500 Ga0495647_0014088 3300046681 Bacteria 2782
501 Ga0495658_0100819 3300046683 Unclassified 1723
502 Ga0495658_0506635 3300046683 Bacteria 772
503 Ga0495613_0021151 3300046689 Bacteria 4851
504 Ga0495674_0003916 3300047319 Bacteria 14458
505 Ga0495674_0298603 3300047319 Bacteria 1316
506 Ga0495674_0461380 3300047319 Bacteria 1020
507 Ga0495680_0013067 3300047322 Bacteria 7262
508 Ga0495675_0123348 3300047444 Bacteria 1613
509 Ga0495684_0081704 3300047471 Bacteria 2452
510 Ga0495684_0822836 3300047471 Unclassified 605
511 Ga0496107_1015181 3300048910 Unclassified 602
512 Ga0496112_0024139 3300048915 Bacteria 5819
513 Ga0496113_0757783 3300048916 Unclassified 773
514 Ga0496115_0009632 3300048918 Bacteria 7188
515 Ga0496115_0633157 3300048918 Bacteria 847
516 Ga0495682_0079226 3300049460 Unclassified 1182
517 Ga0495682_0141220 3300049460 Bacteria 860
518 Ga0501295_109821 3300049518 Unclassified 654
519 Ga0501299_091844 3300049522 Unclassified 691
520 Ga0501031_0009653 3300049568 Bacteria 6282
521 Ga0501031_0014139 3300049568 Bacteria 5193
522 Ga0501031_0077144 3300049568 Bacteria 2170
523 Ga0501032_0001311 3300049569 Bacteria 19950
524 Ga0501032_0016191 3300049569 Bacteria 5247
525 Ga0501032_0291327 3300049569 Unclassified 1056
526 Ga0501033_0019944 3300049570 Bacteria 5067
527 Ga0501033_0032774 3300049570 Bacteria 3902
528 Ga0501033_0033260 3300049570 Bacteria 3872
529 Ga0501033_0035291 3300049570 Bacteria 3749
530 Ga0501036_0022376 3300049572 Bacteria 5316
531 Ga0501036_0091030 3300049572 Bacteria 2576
532 Ga0501036_0660942 3300049572 Bacteria 865
533 Ga0501036_1052451 3300049572 Unclassified 665
534 Ga0501037_0006668 3300049573 Bacteria 8444
535 Ga0501037_0013416 3300049573 Bacteria 6035
536 Ga0501038_0000711 3300049574 Bacteria 29730
537 Ga0501038_0076426 3300049574 Bacteria 2828
538 Ga0501039_0000653 3300049575 Bacteria 25018
539 Ga0501039_0048829 3300049575 Bacteria 3271
540 Ga0501039_0072172 3300049575 Bacteria 2683
541 Ga0501039_0714604 3300049575 Bacteria 783
542 Ga0501040_0003940 3300049576 Bacteria 9635
543 Ga0501040_0010864 3300049576 Bacteria 5952
544 Ga0501040_1400912 3300049576 Bacteria 507
545 Ga0501041_0003089 3300049577 Bacteria 9572
546 Ga0501041_0045704 3300049577 Bacteria 2662
547 Ga0501042_0000287 3300049578 Bacteria 24863
548 Ga0501042_0038831 3300049578 Bacteria 3380
549 Ga0501042_0976764 3300049578 Bacteria 617
550 Ga0501043_0051520 3300049579 Bacteria 3234
551 Ga0501043_0119866 3300049579 Bacteria 2063
552 Ga0501043_0639110 3300049579 Bacteria 782
553 Ga0501046_0004354 3300049580 Bacteria 12889
554 Ga0501046_0054316 3300049580 Bacteria 3151
555 Ga0501047_0328080 3300049581 Bacteria 1369
556 Ga0501048_0005739 3300049582 Bacteria 9431
557 Ga0501048_0061167 3300049582 Bacteria 2667
558 Ga0501048_0477633 3300049582 Bacteria 893
559 Ga0501067_0637780 3300049583 Unclassified 598
560 Ga0501068_0061096 3300049584 Bacteria 2289
561 Ga0501068_0099804 3300049584 Bacteria 1798
562 Ga0501068_1023511 3300049584 Unclassified 545
563 Ga0501070_0018565 3300049586 Bacteria 5834
564 Ga0501071_0002376 3300049587 Bacteria 11401
565 Ga0501071_0316429 3300049587 Bacteria 1185
566 Ga0501071_0431543 3300049587 Bacteria 1007
567 Ga0501072_0006216 3300049588 Bacteria 9093
568 Ga0501072_0147828 3300049588 Bacteria 1873
569 Ga0501073_0008091 3300049589 Bacteria 7801
570 Ga0501073_0482742 3300049589 Bacteria 857
571 Ga0501074_0103566 3300049590 Bacteria 2037
572 Ga0501074_0142025 3300049590 Bacteria 1717
573 Ga0501075_0004248 3300049591 Bacteria 9680
574 Ga0501075_0030598 3300049591 Bacteria 3988
575 Ga0501075_0036470 3300049591 Bacteria 3670
576 Ga0501075_0270451 3300049591 Bacteria 1295
577 Ga0501075_1469321 3300049591 Unclassified 516
578 Ga0501076_0000283 3300049592 Bacteria 31600
579 Ga0501076_0036684 3300049592 Bacteria 3841
580 Ga0501076_0097683 3300049592 Bacteria 2366
581 Ga0501076_0267881 3300049592 Bacteria 1399
582 Ga0501076_0350441 3300049592 Bacteria 1212
583 Ga0501077_0001639 3300049593 Bacteria 13451
584 Ga0501077_0205099 3300049593 Bacteria 1252
585 Ga0501209_063413 3300049656 Bacteria 1036
586 Ga0501209_089932 3300049656 Unclassified 892
587 Ga0501216_021464 3300049660 Bacteria 1135
588 Ga0501079_0000512 3300049741 Bacteria 25207
589 Ga0501079_0251077 3300049741 Bacteria 1382
590 Ga0501079_1475788 3300049741 Bacteria 535
591 Ga0501080_0009637 3300049742 Bacteria 8817
592 Ga0501080_0056823 3300049742 Bacteria 3643
593 Ga0501081_0003790 3300049743 Bacteria 9686
594 Ga0501081_0120391 3300049743 Bacteria 1869
595 Ga0501081_0164952 3300049743 Bacteria 1597
596 Ga0501083_0076634 3300049744 Bacteria 2219
597 Ga0501083_0764710 3300049744 Bacteria 628
598 Ga0501265_060378 3300049762 Bacteria 618
599 Ga0501035_0003191 3300049822 Bacteria 15717
600 Ga0501035_0150953 3300049822 Bacteria 2016
601 Ga0501044_0000125 3300049823 Bacteria 92969
602 Ga0501044_0043199 3300049823 Bacteria 4684
603 Ga0501044_0269897 3300049823 Bacteria 1637
604 Ga0501045_0009849 3300049824 Bacteria 6687
605 Ga0501045_0021456 3300049824 Bacteria 4619
606 Ga0501045_0241307 3300049824 Unclassified 1345
607 Ga0501045_1027930 3300049824 Bacteria 604
608 nmdc:mga05p37_10647_c1 3300050507 Bacteria 10913
609 nmdc:mga05p37_150462_c1 3300050507 Bacteria 2847
610 nmdc:mga05p37_25264_c1 3300050507 Bacteria 7224
611 nmdc:mga05p37_304073_c1 3300050507 Bacteria 1894
612 nmdc:mga05p37_426191_c1 3300050507 Bacteria 1543
613 nmdc:mga05p37_432054_c1 3300050507 Bacteria 1530
614 nmdc:mga05p37_479207_c1 3300050507 Bacteria 1434
615 nmdc:mga05p37_591405_c1 3300050507 Bacteria 1254
616 nmdc:mga05p37_776902_c1 3300050507 Bacteria 1052
617 nmdc:mga05p37_82057_c1 3300050507 Bacteria 3972
618 nmdc:mga09592_175584_c1 3300050508 Bacteria 1853
619 nmdc:mga09592_281741_c1 3300050508 Bacteria 1442
620 nmdc:mga09592_40252_c1 3300050508 Bacteria 3926
621 nmdc:mga09592_930559_c1 3300050508 Bacteria 729
622 nmdc:mga0qj67_391149_c1 3300050509 Bacteria 1122
623 nmdc:mga0qj67_414230_c1 3300050509 Unclassified 1087
624 nmdc:mga0qj67_43185_c1 3300050509 Bacteria 3550
625 nmdc:mga0qj67_60441_c1 3300050509 Bacteria 3007
626 nmdc:mga0qj67_63601_c1 3300050509 Bacteria 2934
627 nmdc:mga06r32_1007073_c1 3300050510 Unclassified 786
628 nmdc:mga06r32_190624_c1 3300050510 Bacteria 2038
629 nmdc:mga06r32_58404_c1 3300050510 Bacteria 3708
630 nmdc:mga06r32_66135_c1 3300050510 Bacteria 3488
631 nmdc:mga08y16_1151042_c1 3300050511 Unclassified 748
632 nmdc:mga08y16_21179_c1 3300050511 Bacteria 6865
633 nmdc:mga08y16_44782_c1 3300050511 Bacteria 4638
634 nmdc:mga08y16_581182_c1 3300050511 Bacteria 1131
635 nmdc:mga0n895_1236867_c1 3300050512 Unclassified 720
636 nmdc:mga0n895_29629_c1 3300050512 Bacteria 5224
637 nmdc:mga0n895_375008_c1 3300050512 Unclassified 1440
638 nmdc:mga0n895_65874_c1 3300050512 Bacteria 3587
639 nmdc:mga0rr50_103572_c1 3300050513 Bacteria 2240
640 nmdc:mga0rr50_1281606_c1 3300050513 Unclassified 622
641 nmdc:mga0rr50_129206_c1 3300050513 Bacteria 2021
642 nmdc:mga0rr50_288139_c1 3300050513 Bacteria 1371
643 nmdc:mga0rr50_549190_c1 3300050513 Bacteria 984
644 nmdc:mga0rr50_807610_c1 3300050513 Unclassified 800
645 nmdc:mga0rr50_820901_c1 3300050513 Bacteria 793
646 nmdc:mga0rr50_9440_c1 3300050513 Bacteria 6133
647 nmdc:mga08x19_179094_c1 3300050514 Bacteria 1446
648 nmdc:mga08x19_31519_c1 3300050514 Bacteria 3335
649 nmdc:mga08x19_707980_c1 3300050514 Bacteria 715
650 nmdc:mga08x19_710374_c1 3300050514 Bacteria 713
651 nmdc:mga0a205_118432_c1 3300050515 Bacteria 2547
652 nmdc:mga0a205_129445_c1 3300050515 Bacteria 2425
653 nmdc:mga0a205_363_c1 3300050515 Bacteria 34199
654 nmdc:mga0a205_3769_c1 3300050515 Bacteria 13565
655 nmdc:mga0a205_57041_c1 3300050515 Bacteria 3771
656 nmdc:mga0a205_604531_c1 3300050515 Unclassified 950
657 nmdc:mga0a205_66355_c1 3300050515 Bacteria 3487
658 Ga0501084_0021601 3300054114 Bacteria 5366
659 Ga0501084_0172491 3300054114 Bacteria 1826
660 Ga0501084_0239772 3300054114 Bacteria 1530
661 Ga0590075_004941 3300059424 Bacteria 3152
662 Ga0501082_0003633 3300060353 Bacteria 13476
663 Ga0501082_0051809 3300060353 Bacteria 3537
664 Ga0501082_0198922 3300060353 Bacteria 1743
665 Ga0501082_0241257 3300060353 Bacteria 1573
666 Ga0501082_1919262 3300060353 Bacteria 516
667 Ga0530510_0035010 3300061734 Bacteria 3618
668 Ga0530510_0136733 3300061734 Bacteria 1804
669 Ga0530510_0222989 3300061734 Bacteria 1401
670 Ga0530510_0281175 3300061734 Bacteria 1243
671 Ga0530510_0381789 3300061734 Bacteria 1060

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003911 JGI25405J52794_10000874 JGI25405J52794_100008744 157
2 3300005276 Ga0065717_1010041 Ga0065717_10100411 157
3 3300005289 Ga0065704_10008073 Ga0065704_100080734 157
4 3300005289 Ga0065704_10374914 Ga0065704_103749141 157
5 3300005293 Ga0065715_10102569 Ga0065715_101025693 157
6 3300005295 Ga0065707_10003878 Ga0065707_100038784 157
7 3300005295 Ga0065707_10092570 Ga0065707_100925703 157
8 3300005328 Ga0070676_10076976 Ga0070676_100769762 157
9 3300005329 Ga0070683_101652396 Ga0070683_1016523961 157
10 3300005330 Ga0070690_100332723 Ga0070690_1003327232 157
11 3300005336 Ga0070680_100007262 Ga0070680_1000072627 157
12 3300005339 Ga0070660_100021860 Ga0070660_1000218603 157
13 3300005339 Ga0070660_100171307 Ga0070660_1001713072 157
14 3300005344 Ga0070661_100426779 Ga0070661_1004267792 157
15 3300005347 Ga0070668_100182326 Ga0070668_1001823262 157
16 3300005354 Ga0070675_100705311 Ga0070675_1007053111 157
17 3300005355 Ga0070671_100214335 Ga0070671_1002143352 157
18 3300005356 Ga0070674_100834819 Ga0070674_1008348191 157
19 3300005366 Ga0070659_100116680 Ga0070659_1001166802 157
20 3300005366 Ga0070659_100718977 Ga0070659_1007189772 157
21 3300005366 Ga0070659_101458029 Ga0070659_1014580291 157
22 3300005455 Ga0070663_100224172 Ga0070663_1002241721 157
23 3300005457 Ga0070662_100029032 Ga0070662_1000290322 157
24 3300005457 Ga0070662_100228859 Ga0070662_1002288592 157
25 3300005458 Ga0070681_10580972 Ga0070681_105809722 157
26 3300005467 Ga0070706_100169487 Ga0070706_1001694873 157
27 3300005468 Ga0070707_100797031 Ga0070707_1007970312 157
28 3300005471 Ga0070698_100200378 Ga0070698_1002003782 157
29 3300005518 Ga0070699_100137384 Ga0070699_1001373843 157
30 3300005518 Ga0070699_101080395 Ga0070699_1010803951 157
31 3300005530 Ga0070679_100163077 Ga0070679_1001630772 157
32 3300005530 Ga0070679_100768301 Ga0070679_1007683012 157
33 3300005536 Ga0070697_100013638 Ga0070697_1000136382 157
34 3300005543 Ga0070672_100378047 Ga0070672_1003780472 157
35 3300005544 Ga0070686_100387757 Ga0070686_1003877572 157
36 3300005546 Ga0070696_100557346 Ga0070696_1005573462 157
37 3300005549 Ga0070704_100665055 Ga0070704_1006650552 157
38 3300005563 Ga0068855_100132174 Ga0068855_1001321742 157
39 3300005564 Ga0070664_100004565 Ga0070664_1000045659 157
40 3300005564 Ga0070664_100329546 Ga0070664_1003295462 157
41 3300005614 Ga0068856_101580387 Ga0068856_1015803871 157
42 3300005617 Ga0068859_100553504 Ga0068859_1005535042 157
43 3300005840 Ga0068870_10235917 Ga0068870_102359172 157
44 3300005843 Ga0068860_100642649 Ga0068860_1006426492 157
45 3300005937 Ga0081455_10000067 Ga0081455_10000067104 157
46 3300005981 Ga0081538_10026589 Ga0081538_100265892 157
47 3300006163 Ga0070715_10276745 Ga0070715_102767452 157
48 3300006173 Ga0070716_100038753 Ga0070716_1000387534 157
49 3300006844 Ga0075428_100033541 Ga0075428_1000335416 157
50 3300006844 Ga0075428_100785356 Ga0075428_1007853562 157
51 3300006844 Ga0075428_100803318 Ga0075428_1008033182 157
52 3300006844 Ga0075428_101394360 Ga0075428_1013943601 157
53 3300006844 Ga0075428_102219524 Ga0075428_1022195241 157
54 3300006846 Ga0075430_100022482 Ga0075430_1000224822 157
55 3300006846 Ga0075430_100064532 Ga0075430_1000645324 157
56 3300006846 Ga0075430_100336789 Ga0075430_1003367891 157
57 3300006846 Ga0075430_100561865 Ga0075430_1005618651 157
58 3300006846 Ga0075430_100602377 Ga0075430_1006023772 157
59 3300006847 Ga0075431_100045936 Ga0075431_1000459362 157
60 3300006847 Ga0075431_100128194 Ga0075431_1001281942 157
61 3300006847 Ga0075431_100223521 Ga0075431_1002235212 157
62 3300006847 Ga0075431_100814038 Ga0075431_1008140382 157
63 3300006852 Ga0075433_10000198 Ga0075433_1000019814 157
64 3300006852 Ga0075433_10006171 Ga0075433_100061712 157
65 3300006852 Ga0075433_10144946 Ga0075433_101449463 157
66 3300006852 Ga0075433_10606409 Ga0075433_106064092 157
67 3300006871 Ga0075434_100000499 Ga0075434_10000049914 157
68 3300006871 Ga0075434_100035710 Ga0075434_1000357102 157
69 3300006871 Ga0075434_100065270 Ga0075434_1000652703 157
70 3300006871 Ga0075434_100106881 Ga0075434_1001068813 157
71 3300006871 Ga0075434_101203975 Ga0075434_1012039751 157
72 3300006880 Ga0075429_100015520 Ga0075429_1000155206 157
73 3300006880 Ga0075429_100103703 Ga0075429_1001037033 157
74 3300006880 Ga0075429_100202317 Ga0075429_1002023172 157
75 3300006880 Ga0075429_100351730 Ga0075429_1003517302 157
76 3300006880 Ga0075429_100352545 Ga0075429_1003525452 157
77 3300006880 Ga0075429_100790680 Ga0075429_1007906801 157
78 3300006880 Ga0075429_100914938 Ga0075429_1009149382 157
79 3300006914 Ga0075436_100747602 Ga0075436_1007476021 157
80 3300006914 Ga0075436_100768047 Ga0075436_1007680472 157
81 3300006914 Ga0075436_100869000 Ga0075436_1008690002 157
82 3300006931 Ga0097620_100553453 Ga0097620_1005534532 157
83 3300007076 Ga0075435_100015294 Ga0075435_1000152942 157
84 3300007076 Ga0075435_100063745 Ga0075435_1000637452 157
85 3300007076 Ga0075435_100103969 Ga0075435_1001039692 157
86 3300007076 Ga0075435_100353956 Ga0075435_1003539562 157
87 3300007076 Ga0075435_100918035 Ga0075435_1009180351 157
88 3300009093 Ga0105240_11380586 Ga0105240_113805861 157
89 3300009094 Ga0111539_10737525 Ga0111539_107375252 157
90 3300009147 Ga0114129_10147465 Ga0114129_101474652 157
91 3300009147 Ga0114129_10929001 Ga0114129_109290012 157
92 3300009147 Ga0114129_11497166 Ga0114129_114971662 157
93 3300009148 Ga0105243_10809286 Ga0105243_108092862 157
94 3300009545 Ga0105237_10207788 Ga0105237_102077882 157
95 3300009553 Ga0105249_10330705 Ga0105249_103307052 157
96 3300010375 Ga0105239_11393119 Ga0105239_113931191 157
97 3300011119 Ga0105246_10158891 Ga0105246_101588912 157
98 3300013297 Ga0157378_10101242 Ga0157378_101012423 157
99 3300013297 Ga0157378_10294608 Ga0157378_102946082 157
100 3300013297 Ga0157378_10404458 Ga0157378_104044581 157
101 3300013306 Ga0163162_10065901 Ga0163162_100659014 157
102 3300013308 Ga0157375_10855522 Ga0157375_108555222 157
103 3300025907 Ga0207645_10109541 Ga0207645_101095412 157
104 3300025912 Ga0207707_10002190 Ga0207707_1000219011 157
105 3300025912 Ga0207707_10003311 Ga0207707_100033112 157
106 3300025917 Ga0207660_10002204 Ga0207660_1000220410 157
107 3300025917 Ga0207660_10020490 Ga0207660_100204902 157
108 3300025917 Ga0207660_10327971 Ga0207660_103279712 157
109 3300025919 Ga0207657_10072423 Ga0207657_100724233 157
110 3300025920 Ga0207649_10177455 Ga0207649_101774551 157
111 3300025921 Ga0207652_10010626 Ga0207652_100106267 157
112 3300025921 Ga0207652_10131207 Ga0207652_101312072 157
113 3300025922 Ga0207646_10231723 Ga0207646_102317232 157
114 3300025923 Ga0207681_10329627 Ga0207681_103296271 157
115 3300025925 Ga0207650_10001410 Ga0207650_1000141018 157
116 3300025931 Ga0207644_10066257 Ga0207644_100662573 157
117 3300025932 Ga0207690_10004342 Ga0207690_100043424 157
118 3300025933 Ga0207706_10138572 Ga0207706_101385722 157
119 3300025933 Ga0207706_10236887 Ga0207706_102368872 157
120 3300025936 Ga0207670_10055093 Ga0207670_100550932 157
121 3300025937 Ga0207669_10680684 Ga0207669_106806842 157
122 3300025938 Ga0207704_10122382 Ga0207704_101223822 157
123 3300025944 Ga0207661_10376835 Ga0207661_103768351 157
124 3300025945 Ga0207679_10007766 Ga0207679_100077667 157
125 3300025972 Ga0207668_10474681 Ga0207668_104746812 157
126 3300026067 Ga0207678_10018177 Ga0207678_100181772 157
127 3300026121 Ga0207683_10147110 Ga0207683_101471102 157
128 3300027617 Ga0210002_1057893 Ga0210002_10578931 157
129 3300027682 Ga0209971_1012080 Ga0209971_10120802 157
130 3300027876 Ga0209974_10002328 Ga0209974_100023285 157
131 3300027907 Ga0207428_10013239 Ga0207428_100132395 157
132 3300028381 Ga0268264_10452395 Ga0268264_104523952 157
133 3300031548 Ga0307408_100073609 Ga0307408_1000736092 157
134 3300031548 Ga0307408_100101694 Ga0307408_1001016942 157
135 3300031548 Ga0307408_100103521 Ga0307408_1001035212 157
136 3300031731 Ga0307405_10690205 Ga0307405_106902052 157
137 3300031824 Ga0307413_10023725 Ga0307413_100237252 157
138 3300031824 Ga0307413_10181231 Ga0307413_101812311 157
139 3300031852 Ga0307410_10020407 Ga0307410_100204073 157
140 3300031852 Ga0307410_10109075 Ga0307410_101090752 157
141 3300031901 Ga0307406_10017625 Ga0307406_100176253 157
142 3300031901 Ga0307406_10116626 Ga0307406_101166261 157
143 3300031911 Ga0307412_10046977 Ga0307412_100469773 157
144 3300031995 Ga0307409_100022840 Ga0307409_1000228403 157
145 3300031995 Ga0307409_100156826 Ga0307409_1001568262 157
146 3300032002 Ga0307416_100009264 Ga0307416_1000092643 157
147 3300032002 Ga0307416_100208409 Ga0307416_1002084091 157
148 3300032004 Ga0307414_10015643 Ga0307414_100156433 157
149 3300032004 Ga0307414_10017900 Ga0307414_100179002 157
150 3300032126 Ga0307415_100064304 Ga0307415_1000643043 157
151 3300032126 Ga0307415_100073290 Ga0307415_1000732903 157
152 3300035089 Ga0373944_0229717 Ga0373944_0229717_19_492 157
153 3300035112 Ga0373932_0196402 Ga0373932_0196402_30_503 157
154 3300035114 Ga0373939_0087473 Ga0373939_0087473_10_483 157
155 3300035116 Ga0373945_0025773 Ga0373945_0025773_254_727 157
156 3300035119 Ga0373956_0057609 Ga0373956_0057609_695_1168 157
157 3300035170 Ga0373943_0187804 Ga0373943_0187804_338_811 157
158 3300035242 Ga0373962_0076478 Ga0373962_0076478_499_972 157
159 3300035691 Ga0373931_0005703 Ga0373931_0005703_63_536 157
160 3300035691 Ga0373931_0107596 Ga0373931_0107596_295_867 157
161 3300035692 Ga0373935_0392744 Ga0373935_0392744_473_946 157
162 3300035725 Ga0373947_0025116 Ga0373947_0025116_2298_2771 157
163 3300036401 Ga0373937_0090294 Ga0373937_0090294_2326_2799 157
164 3300037068 Ga0373925_0127189 Ga0373925_0127189_980_1453 157
165 3300042156 Ga0439446_0280187 Ga0439446_0280187_80_553 157
166 3300042437 Ga0439444_0100589 Ga0439444_0100589_64_537 157
167 3300042876 Ga0451577_0963850 Ga0451577_0963850_183_659 157
168 3300042876 Ga0451577_1203803 Ga0451577_1203803_131_607 157
169 3300044712 Ga0453684_1257617 Ga0453684_1257617_225_698 157
170 3300045051 Ga0451576_0477792 Ga0451576_0477792_371_844 157
171 3300045051 Ga0451576_0892923 Ga0451576_0892923_373_846 157
172 3300046472 Ga0495580_0045476 Ga0495580_0045476_2345_2818 157
173 3300048910 Ga0496107_1015181 Ga0496107_1015181_60_533 157
174 3300048915 Ga0496112_0024139 Ga0496112_0024139_121_594 157
175 3300048916 Ga0496113_0757783 Ga0496113_0757783_167_640 157
176 3300049518 Ga0501295_109821 Ga0501295_109821_158_631 157
177 3300049522 Ga0501299_091844 Ga0501299_091844_170_643 157
178 3300049568 Ga0501031_0014139 Ga0501031_0014139_2864_3337 157
179 3300049568 Ga0501031_0077144 Ga0501031_0077144_490_963 157
180 3300049569 Ga0501032_0016191 Ga0501032_0016191_3114_3587 157
181 3300049569 Ga0501032_0291327 Ga0501032_0291327_140_613 157
182 3300049570 Ga0501033_0032774 Ga0501033_0032774_149_622 157
183 3300049570 Ga0501033_0035291 Ga0501033_0035291_806_1279 157
184 3300049572 Ga0501036_0022376 Ga0501036_0022376_111_584 157
185 3300049572 Ga0501036_0091030 Ga0501036_0091030_1033_1506 157
186 3300049572 Ga0501036_0660942 Ga0501036_0660942_122_595 157
187 3300049572 Ga0501036_1052451 Ga0501036_1052451_117_590 157
188 3300049573 Ga0501037_0006668 Ga0501037_0006668_5723_6196 157
189 3300049574 Ga0501038_0000711 Ga0501038_0000711_12171_12644 157
190 3300049574 Ga0501038_0076426 Ga0501038_0076426_1777_2250 157
191 3300049575 Ga0501039_0000653 Ga0501039_0000653_5250_5723 157
192 3300049575 Ga0501039_0048829 Ga0501039_0048829_1923_2396 157
193 3300049576 Ga0501040_0003940 Ga0501040_0003940_5199_5672 157
194 3300049576 Ga0501040_0010864 Ga0501040_0010864_3119_3592 157
195 3300049576 Ga0501040_1400912 Ga0501040_1400912_14_487 157
196 3300049577 Ga0501041_0003089 Ga0501041_0003089_5239_5712 157
197 3300049577 Ga0501041_0045704 Ga0501041_0045704_1874_2347 157
198 3300049578 Ga0501042_0000287 Ga0501042_0000287_937_1410 157
199 3300049578 Ga0501042_0038831 Ga0501042_0038831_2857_3330 157
200 3300049578 Ga0501042_0976764 Ga0501042_0976764_110_589 157
201 3300049579 Ga0501043_0051520 Ga0501043_0051520_1592_2065 157
202 3300049579 Ga0501043_0119866 Ga0501043_0119866_240_713 157
203 3300049580 Ga0501046_0004354 Ga0501046_0004354_12236_12709 157
204 3300049580 Ga0501046_0054316 Ga0501046_0054316_1931_2404 157
205 3300049581 Ga0501047_0328080 Ga0501047_0328080_112_585 157
206 3300049582 Ga0501048_0005739 Ga0501048_0005739_51_524 157
207 3300049582 Ga0501048_0061167 Ga0501048_0061167_1398_1871 157
208 3300049582 Ga0501048_0477633 Ga0501048_0477633_350_823 157
209 3300049583 Ga0501067_0637780 Ga0501067_0637780_63_536 157
210 3300049584 Ga0501068_0061096 Ga0501068_0061096_1474_1947 157
211 3300049584 Ga0501068_0099804 Ga0501068_0099804_875_1348 157
212 3300049584 Ga0501068_1023511 Ga0501068_1023511_51_524 157
213 3300049586 Ga0501070_0018565 Ga0501070_0018565_2658_3131 157
214 3300049587 Ga0501071_0002376 Ga0501071_0002376_10750_11223 157
215 3300049587 Ga0501071_0316429 Ga0501071_0316429_118_591 157
216 3300049587 Ga0501071_0431543 Ga0501071_0431543_272_745 157
217 3300049588 Ga0501072_0006216 Ga0501072_0006216_5221_5694 157
218 3300049588 Ga0501072_0147828 Ga0501072_0147828_1308_1781 157
219 3300049589 Ga0501073_0008091 Ga0501073_0008091_2717_3190 157
220 3300049590 Ga0501074_0103566 Ga0501074_0103566_817_1290 157
221 3300049590 Ga0501074_0142025 Ga0501074_0142025_1183_1656 157
222 3300049591 Ga0501075_0004248 Ga0501075_0004248_3964_4437 157
223 3300049591 Ga0501075_0030598 Ga0501075_0030598_247_720 157
224 3300049591 Ga0501075_0036470 Ga0501075_0036470_1994_2467 157
225 3300049591 Ga0501075_0270451 Ga0501075_0270451_156_629 157
226 3300049591 Ga0501075_1469321 Ga0501075_1469321_25_498 157
227 3300049592 Ga0501076_0000283 Ga0501076_0000283_25058_25531 157
228 3300049592 Ga0501076_0036684 Ga0501076_0036684_1777_2250 157
229 3300049592 Ga0501076_0097683 Ga0501076_0097683_692_1165 157
230 3300049592 Ga0501076_0267881 Ga0501076_0267881_889_1362 157
231 3300049592 Ga0501076_0350441 Ga0501076_0350441_423_896 157
232 3300049593 Ga0501077_0001639 Ga0501077_0001639_7729_8202 157
233 3300049593 Ga0501077_0205099 Ga0501077_0205099_182_655 157
234 3300049656 Ga0501209_063413 Ga0501209_063413_196_669 157
235 3300049656 Ga0501209_089932 Ga0501209_089932_239_712 157
236 3300049660 Ga0501216_021464 Ga0501216_021464_474_947 157
237 3300049741 Ga0501079_0000512 Ga0501079_0000512_7648_8121 157
238 3300049741 Ga0501079_0251077 Ga0501079_0251077_34_507 157
239 3300049741 Ga0501079_1475788 Ga0501079_1475788_12_485 157
240 3300049742 Ga0501080_0009637 Ga0501080_0009637_7228_7701 157
241 3300049742 Ga0501080_0056823 Ga0501080_0056823_618_1091 157
242 3300049743 Ga0501081_0003790 Ga0501081_0003790_5250_5723 157
243 3300049743 Ga0501081_0120391 Ga0501081_0120391_196_669 157
244 3300049743 Ga0501081_0164952 Ga0501081_0164952_182_655 157
245 3300049744 Ga0501083_0076634 Ga0501083_0076634_1183_1656 157
246 3300049744 Ga0501083_0764710 Ga0501083_0764710_101_574 157
247 3300049762 Ga0501265_060378 Ga0501265_060378_16_489 157
248 3300049822 Ga0501035_0150953 Ga0501035_0150953_486_959 157
249 3300049823 Ga0501044_0043199 Ga0501044_0043199_1556_2029 157
250 3300049824 Ga0501045_0009849 Ga0501045_0009849_1004_1477 157
251 3300049824 Ga0501045_0021456 Ga0501045_0021456_2522_2995 157
252 3300049824 Ga0501045_0241307 Ga0501045_0241307_813_1286 157
253 3300049824 Ga0501045_1027930 Ga0501045_1027930_54_527 157
254 3300050507 nmdc:mga05p37_10647_c1 nmdc:mga05p37_10647_c1_10118_10591 157
255 3300050507 nmdc:mga05p37_150462_c1 nmdc:mga05p37_150462_c1_407_886 157
256 3300050507 nmdc:mga05p37_25264_c1 nmdc:mga05p37_25264_c1_1373_1846 157
257 3300050507 nmdc:mga05p37_304073_c1 nmdc:mga05p37_304073_c1_1359_1832 157
258 3300050507 nmdc:mga05p37_426191_c1 nmdc:mga05p37_426191_c1_831_1304 157
259 3300050507 nmdc:mga05p37_432054_c1 nmdc:mga05p37_432054_c1_166_639 157
260 3300050507 nmdc:mga05p37_479207_c1 nmdc:mga05p37_479207_c1_912_1385 157
261 3300050507 nmdc:mga05p37_591405_c1 nmdc:mga05p37_591405_c1_179_652 157
262 3300050507 nmdc:mga05p37_776902_c1 nmdc:mga05p37_776902_c1_376_849 157
263 3300050507 nmdc:mga05p37_82057_c1 nmdc:mga05p37_82057_c1_3456_3929 157
264 3300050508 nmdc:mga09592_175584_c1 nmdc:mga09592_175584_c1_1011_1484 157
265 3300050508 nmdc:mga09592_281741_c1 nmdc:mga09592_281741_c1_838_1311 157
266 3300050508 nmdc:mga09592_40252_c1 nmdc:mga09592_40252_c1_3204_3677 157
267 3300050508 nmdc:mga09592_930559_c1 nmdc:mga09592_930559_c1_136_609 157
268 3300050509 nmdc:mga0qj67_391149_c1 nmdc:mga0qj67_391149_c1_565_1038 157
269 3300050509 nmdc:mga0qj67_414230_c1 nmdc:mga0qj67_414230_c1_164_637 157
270 3300050509 nmdc:mga0qj67_43185_c1 nmdc:mga0qj67_43185_c1_3021_3494 157
271 3300050509 nmdc:mga0qj67_60441_c1 nmdc:mga0qj67_60441_c1_620_1093 157
272 3300050509 nmdc:mga0qj67_63601_c1 nmdc:mga0qj67_63601_c1_1234_1782 157
273 3300050510 nmdc:mga06r32_1007073_c1 nmdc:mga06r32_1007073_c1_61_534 157
274 3300050510 nmdc:mga06r32_190624_c1 nmdc:mga06r32_190624_c1_77_550 157
275 3300050510 nmdc:mga06r32_58404_c1 nmdc:mga06r32_58404_c1_327_800 157
276 3300050510 nmdc:mga06r32_66135_c1 nmdc:mga06r32_66135_c1_606_1079 157
277 3300050511 nmdc:mga08y16_1151042_c1 nmdc:mga08y16_1151042_c1_10_483 157
278 3300050511 nmdc:mga08y16_21179_c1 nmdc:mga08y16_21179_c1_3046_3519 157
279 3300050512 nmdc:mga0n895_1236867_c1 nmdc:mga0n895_1236867_c1_49_522 157
280 3300050512 nmdc:mga0n895_29629_c1 nmdc:mga0n895_29629_c1_4555_5028 157
281 3300050512 nmdc:mga0n895_375008_c1 nmdc:mga0n895_375008_c1_25_498 157
282 3300050512 nmdc:mga0n895_65874_c1 nmdc:mga0n895_65874_c1_2073_2546 157
283 3300050513 nmdc:mga0rr50_103572_c1 nmdc:mga0rr50_103572_c1_508_981 157
284 3300050513 nmdc:mga0rr50_1281606_c1 nmdc:mga0rr50_1281606_c1_133_606 157
285 3300050513 nmdc:mga0rr50_129206_c1 nmdc:mga0rr50_129206_c1_352_825 157
286 3300050513 nmdc:mga0rr50_549190_c1 nmdc:mga0rr50_549190_c1_374_847 157
287 3300050513 nmdc:mga0rr50_807610_c1 nmdc:mga0rr50_807610_c1_40_513 157
288 3300050513 nmdc:mga0rr50_820901_c1 nmdc:mga0rr50_820901_c1_277_750 157
289 3300050513 nmdc:mga0rr50_9440_c1 nmdc:mga0rr50_9440_c1_699_1172 157
290 3300050514 nmdc:mga08x19_179094_c1 nmdc:mga08x19_179094_c1_190_663 157
291 3300050514 nmdc:mga08x19_31519_c1 nmdc:mga08x19_31519_c1_2809_3282 157
292 3300050514 nmdc:mga08x19_707980_c1 nmdc:mga08x19_707980_c1_188_661 157
293 3300050514 nmdc:mga08x19_710374_c1 nmdc:mga08x19_710374_c1_92_565 157
294 3300050515 nmdc:mga0a205_118432_c1 nmdc:mga0a205_118432_c1_1928_2401 157
295 3300050515 nmdc:mga0a205_129445_c1 nmdc:mga0a205_129445_c1_283_756 157
296 3300050515 nmdc:mga0a205_363_c1 nmdc:mga0a205_363_c1_4121_4594 157
297 3300050515 nmdc:mga0a205_3769_c1 nmdc:mga0a205_3769_c1_3545_4018 157
298 3300050515 nmdc:mga0a205_57041_c1 nmdc:mga0a205_57041_c1_1158_1634 157
299 3300050515 nmdc:mga0a205_604531_c1 nmdc:mga0a205_604531_c1_429_902 157
300 3300050515 nmdc:mga0a205_66355_c1 nmdc:mga0a205_66355_c1_2358_2831 157
301 3300054114 Ga0501084_0021601 Ga0501084_0021601_4770_5243 157
302 3300054114 Ga0501084_0172491 Ga0501084_0172491_984_1457 157
303 3300054114 Ga0501084_0239772 Ga0501084_0239772_876_1349 157
304 3300059424 Ga0590075_004941 Ga0590075_004941_368_841 157
305 3300060353 Ga0501082_0003633 Ga0501082_0003633_5147_5620 157
306 3300060353 Ga0501082_0051809 Ga0501082_0051809_2317_2790 157
307 3300060353 Ga0501082_0198922 Ga0501082_0198922_142_615 157
308 3300060353 Ga0501082_0241257 Ga0501082_0241257_967_1440 157
309 3300060353 Ga0501082_1919262 Ga0501082_1919262_23_496 157
310 3300061734 Ga0530510_0035010 Ga0530510_0035010_2905_3378 157
311 3300061734 Ga0530510_0136733 Ga0530510_0136733_195_668 157
312 3300061734 Ga0530510_0222989 Ga0530510_0222989_51_524 157
313 3300061734 Ga0530510_0281175 Ga0530510_0281175_145_618 157
314 3300061734 Ga0530510_0381789 Ga0530510_0381789_182_655 157
315 3300005365 Ga0070688_100985682 Ga0070688_1009856821 159
316 3300005406 Ga0070703_10285674 Ga0070703_102856741 159
317 3300005438 Ga0070701_10059197 Ga0070701_100591972 159
318 3300005440 Ga0070705_100290095 Ga0070705_1002900952 159
319 3300005444 Ga0070694_100066050 Ga0070694_1000660503 159
320 3300005544 Ga0070686_100013098 Ga0070686_1000130984 159
321 3300005617 Ga0068859_101720199 Ga0068859_1017201991 159
322 3300005617 Ga0068859_101849658 Ga0068859_1018496582 159
323 3300005618 Ga0068864_100481137 Ga0068864_1004811372 159
324 3300005719 Ga0068861_100282978 Ga0068861_1002829782 159
325 3300005844 Ga0068862_100326998 Ga0068862_1003269982 159
326 3300006931 Ga0097620_101720231 Ga0097620_1017202311 159
327 3300006931 Ga0097620_101849601 Ga0097620_1018496012 159
328 3300009176 Ga0105242_10935549 Ga0105242_109355491 159
329 3300009177 Ga0105248_11068070 Ga0105248_110680702 159
330 3300009553 Ga0105249_10077893 Ga0105249_100778934 159
331 3300014325 Ga0163163_10131060 Ga0163163_101310603 159
332 3300025934 Ga0207686_10360841 Ga0207686_103608412 159
333 3300025941 Ga0207711_11061386 Ga0207711_110613862 159
334 3300025961 Ga0207712_11169369 Ga0207712_111693691 159
335 3300026095 Ga0207676_10419798 Ga0207676_104197982 159
336 3300035691 Ga0373931_0271840 Ga0373931_0271840_175_660 159
337 3300039447 Ga0436361_0889442 Ga0436361_0889442_34_519 159
338 3300044712 Ga0453684_1460504 Ga0453684_1460504_175_660 159
339 3300046454 Ga0495592_0000023 Ga0495592_0000023_57759_58244 159
340 3300046476 Ga0495662_0005799 Ga0495662_0005799_5511_5996 159
341 3300046477 Ga0495664_0042121 Ga0495664_0042121_1045_1530 159
342 3300046514 Ga0495618_0002603 Ga0495618_0002603_4816_5301 159
343 3300046516 Ga0495628_0005164 Ga0495628_0005164_8975_9460 159
344 3300046517 Ga0495630_0029891 Ga0495630_0029891_3022_3507 159
345 3300046526 Ga0495666_0050773 Ga0495666_0050773_339_824 159
346 3300046529 Ga0495652_0058251 Ga0495652_0058251_1714_2199 159
347 3300046533 Ga0495640_0006702 Ga0495640_0006702_4854_5339 159
348 3300046535 Ga0495586_0001744 Ga0495586_0001744_1285_1770 159
349 3300046543 Ga0495645_0013766 Ga0495645_0013766_1396_1881 159
350 3300046642 Ga0495634_0333356 Ga0495634_0333356_255_740 159
351 3300046678 Ga0495599_0024402 Ga0495599_0024402_1820_2305 159
352 3300046680 Ga0495646_0154966 Ga0495646_0154966_246_731 159
353 3300046683 Ga0495658_0506635 Ga0495658_0506635_150_635 159
354 3300047319 Ga0495674_0003916 Ga0495674_0003916_9896_10381 159
355 3300050511 nmdc:mga08y16_581182_c1 nmdc:mga08y16_581182_c1_78_569 159
356 3300013296 Ga0157374_10497820 Ga0157374_104978202 160
357 3300013306 Ga0163162_11302432 Ga0163162_113024321 160
358 3300013308 Ga0157375_12744949 Ga0157375_127449491 160
359 3300035171 Ga0373946_0187661 Ga0373946_0187661_220_714 160
360 3300046683 Ga0495658_0100819 Ga0495658_0100819_407_901 160
361 3300003320 rootH2_10035096 rootH2_100350962 161
362 3300003323 rootH1_10072186 rootH1_100721862 161
363 3300005327 Ga0070658_10120517 Ga0070658_101205173 161
364 3300005327 Ga0070658_10273866 Ga0070658_102738662 161
365 3300005329 Ga0070683_100238398 Ga0070683_1002383983 161
366 3300005340 Ga0070689_100176832 Ga0070689_1001768322 161
367 3300005340 Ga0070689_100210854 Ga0070689_1002108542 161
368 3300005356 Ga0070674_100496881 Ga0070674_1004968811 161
369 3300005364 Ga0070673_101023122 Ga0070673_1010231221 161
370 3300005436 Ga0070713_100247274 Ga0070713_1002472742 161
371 3300005439 Ga0070711_100002821 Ga0070711_1000028219 161
372 3300005441 Ga0070700_101057291 Ga0070700_1010572911 161
373 3300005458 Ga0070681_10329466 Ga0070681_103294663 161
374 3300005458 Ga0070681_10478536 Ga0070681_104785362 161
375 3300005459 Ga0068867_100244048 Ga0068867_1002440482 161
376 3300005459 Ga0068867_100410895 Ga0068867_1004108953 161
377 3300005530 Ga0070679_100031128 Ga0070679_1000311284 161
378 3300005530 Ga0070679_100342609 Ga0070679_1003426091 161
379 3300005536 Ga0070697_101306969 Ga0070697_1013069691 161
380 3300005539 Ga0068853_100026471 Ga0068853_1000264717 161
381 3300005544 Ga0070686_100200988 Ga0070686_1002009882 161
382 3300005544 Ga0070686_101076683 Ga0070686_1010766831 161
383 3300005545 Ga0070695_100822023 Ga0070695_1008220231 161
384 3300005549 Ga0070704_100101420 Ga0070704_1001014203 161
385 3300005549 Ga0070704_100387832 Ga0070704_1003878323 161
386 3300005563 Ga0068855_100019809 Ga0068855_10001980910 161
387 3300005563 Ga0068855_100044981 Ga0068855_1000449816 161
388 3300005563 Ga0068855_100180493 Ga0068855_1001804934 161
389 3300005563 Ga0068855_100505567 Ga0068855_1005055672 161
390 3300005563 Ga0068855_100619972 Ga0068855_1006199722 161
391 3300005577 Ga0068857_100619848 Ga0068857_1006198482 161
392 3300005614 Ga0068856_100000058 Ga0068856_100000058104 161
393 3300005614 Ga0068856_100145557 Ga0068856_1001455573 161
394 3300005614 Ga0068856_100981778 Ga0068856_1009817782 161
395 3300005617 Ga0068859_100056294 Ga0068859_1000562942 161
396 3300005617 Ga0068859_101877372 Ga0068859_1018773722 161
397 3300005718 Ga0068866_10591179 Ga0068866_105911791 161
398 3300005719 Ga0068861_100281316 Ga0068861_1002813163 161
399 3300005841 Ga0068863_101513405 Ga0068863_1015134052 161
400 3300005842 Ga0068858_100133244 Ga0068858_1001332442 161
401 3300006844 Ga0075428_100003743 Ga0075428_10000374316 161
402 3300006847 Ga0075431_100558356 Ga0075431_1005583563 161
403 3300006931 Ga0097620_100056294 Ga0097620_1000562942 161
404 3300006931 Ga0097620_101877507 Ga0097620_1018775072 161
405 3300007076 Ga0075435_100163133 Ga0075435_1001631332 161
406 3300009093 Ga0105240_10134769 Ga0105240_101347692 161
407 3300009093 Ga0105240_10167864 Ga0105240_101678643 161
408 3300009093 Ga0105240_10202948 Ga0105240_102029483 161
409 3300009093 Ga0105240_10442939 Ga0105240_104429392 161
410 3300009094 Ga0111539_10004958 Ga0111539_1000495810 161
411 3300009094 Ga0111539_10494989 Ga0111539_104949891 161
412 3300009147 Ga0114129_10948048 Ga0114129_109480482 161
413 3300009174 Ga0105241_10066720 Ga0105241_100667205 161
414 3300009176 Ga0105242_10295108 Ga0105242_102951081 161
415 3300009551 Ga0105238_10027652 Ga0105238_100276527 161
416 3300009551 Ga0105238_10105220 Ga0105238_101052202 161
417 3300009551 Ga0105238_10325421 Ga0105238_103254212 161
418 3300009551 Ga0105238_11481675 Ga0105238_114816752 161
419 3300011119 Ga0105246_11025133 Ga0105246_110251332 161
420 3300013102 Ga0157371_10284288 Ga0157371_102842882 161
421 3300013104 Ga0157370_10045311 Ga0157370_100453114 161
422 3300013104 Ga0157370_10500966 Ga0157370_105009662 161
423 3300013296 Ga0157374_10148125 Ga0157374_101481252 161
424 3300013296 Ga0157374_10995042 Ga0157374_109950422 161
425 3300013297 Ga0157378_10681764 Ga0157378_106817641 161
426 3300013306 Ga0163162_11007903 Ga0163162_110079031 161
427 3300013307 Ga0157372_10187482 Ga0157372_101874825 161
428 3300014325 Ga0163163_11573677 Ga0163163_115736772 161
429 3300014968 Ga0157379_11234793 Ga0157379_112347931 161
430 3300014969 Ga0157376_12159843 Ga0157376_121598431 161
431 3300025899 Ga0207642_10452660 Ga0207642_104526602 161
432 3300025909 Ga0207705_10213479 Ga0207705_102134792 161
433 3300025911 Ga0207654_10074411 Ga0207654_100744112 161
434 3300025912 Ga0207707_10399978 Ga0207707_103999781 161
435 3300025913 Ga0207695_10101741 Ga0207695_101017412 161
436 3300025913 Ga0207695_10119012 Ga0207695_101190123 161
437 3300025913 Ga0207695_10154957 Ga0207695_101549573 161
438 3300025913 Ga0207695_10246284 Ga0207695_102462845 161
439 3300025916 Ga0207663_10001010 Ga0207663_1000101011 161
440 3300025921 Ga0207652_10128185 Ga0207652_101281854 161
441 3300025921 Ga0207652_10510644 Ga0207652_105106442 161
442 3300025924 Ga0207694_10015363 Ga0207694_100153632 161
443 3300025924 Ga0207694_10044221 Ga0207694_100442214 161
444 3300025924 Ga0207694_10053022 Ga0207694_100530224 161
445 3300025924 Ga0207694_10308600 Ga0207694_103086003 161
446 3300025929 Ga0207664_10005849 Ga0207664_100058495 161
447 3300025936 Ga0207670_10060592 Ga0207670_100605924 161
448 3300025936 Ga0207670_10531461 Ga0207670_105314612 161
449 3300025944 Ga0207661_10327449 Ga0207661_103274492 161
450 3300025949 Ga0207667_10034747 Ga0207667_100347475 161
451 3300025949 Ga0207667_10141572 Ga0207667_101415723 161
452 3300025949 Ga0207667_10168415 Ga0207667_101684154 161
453 3300025949 Ga0207667_10389931 Ga0207667_103899312 161
454 3300025949 Ga0207667_10531277 Ga0207667_105312772 161
455 3300026035 Ga0207703_10088615 Ga0207703_100886152 161
456 3300026078 Ga0207702_10002049 Ga0207702_1000204919 161
457 3300026078 Ga0207702_10025697 Ga0207702_100256974 161
458 3300026078 Ga0207702_10697721 Ga0207702_106977213 161
459 3300026088 Ga0207641_10997168 Ga0207641_109971682 161
460 3300026095 Ga0207676_10175131 Ga0207676_101751313 161
461 3300026095 Ga0207676_11459380 Ga0207676_114593801 161
462 3300027907 Ga0207428_10276090 Ga0207428_102760902 161
463 3300028556 Ga0265337_1000140 Ga0265337_100014021 161
464 3300028556 Ga0265337_1001274 Ga0265337_10012745 161
465 3300028556 Ga0265337_1002167 Ga0265337_10021676 161
466 3300028556 Ga0265337_1006735 Ga0265337_10067355 161
467 3300028556 Ga0265337_1015350 Ga0265337_10153502 161
468 3300028558 Ga0265326_10001872 Ga0265326_100018728 161
469 3300028558 Ga0265326_10006429 Ga0265326_100064293 161
470 3300028558 Ga0265326_10106052 Ga0265326_101060522 161
471 3300028558 Ga0265326_10170413 Ga0265326_101704132 161
472 3300028563 Ga0265319_1000007 Ga0265319_100000796 161
473 3300028563 Ga0265319_1029444 Ga0265319_10294443 161
474 3300028563 Ga0265319_1043151 Ga0265319_10431513 161
475 3300028563 Ga0265319_1100430 Ga0265319_11004302 161
476 3300028573 Ga0265334_10011533 Ga0265334_100115333 161
477 3300028573 Ga0265334_10052800 Ga0265334_100528002 161
478 3300028573 Ga0265334_10199677 Ga0265334_101996771 161
479 3300028577 Ga0265318_10057750 Ga0265318_100577503 161
480 3300028577 Ga0265318_10235343 Ga0265318_102353431 161
481 3300028653 Ga0265323_10000237 Ga0265323_1000023730 161
482 3300028653 Ga0265323_10029666 Ga0265323_100296662 161
483 3300028653 Ga0265323_10123693 Ga0265323_101236932 161
484 3300028654 Ga0265322_10088443 Ga0265322_100884431 161
485 3300028654 Ga0265322_10125051 Ga0265322_101250512 161
486 3300028666 Ga0265336_10000819 Ga0265336_100008195 161
487 3300028666 Ga0265336_10014566 Ga0265336_100145663 161
488 3300028666 Ga0265336_10052476 Ga0265336_100524763 161
489 3300028666 Ga0265336_10077152 Ga0265336_100771522 161
490 3300028800 Ga0265338_10000075 Ga0265338_1000007559 161
491 3300028800 Ga0265338_10000425 Ga0265338_1000042536 161
492 3300028800 Ga0265338_10000431 Ga0265338_1000043111 161
493 3300028800 Ga0265338_10000945 Ga0265338_1000094514 161
494 3300028800 Ga0265338_10001555 Ga0265338_1000155517 161
495 3300028800 Ga0265338_10002354 Ga0265338_100023544 161
496 3300028800 Ga0265338_10004123 Ga0265338_100041238 161
497 3300028800 Ga0265338_10009242 Ga0265338_100092428 161
498 3300028800 Ga0265338_10009353 Ga0265338_100093534 161
499 3300028800 Ga0265338_10010670 Ga0265338_1001067010 161
500 3300028800 Ga0265338_10013146 Ga0265338_100131468 161
501 3300028800 Ga0265338_10018502 Ga0265338_100185027 161
502 3300028800 Ga0265338_10019978 Ga0265338_100199783 161
503 3300028800 Ga0265338_10020690 Ga0265338_1002069012 161
504 3300028800 Ga0265338_10022140 Ga0265338_100221403 161
505 3300028800 Ga0265338_10052394 Ga0265338_100523946 161
506 3300028800 Ga0265338_10052887 Ga0265338_100528875 161
507 3300028800 Ga0265338_10073848 Ga0265338_100738482 161
508 3300028800 Ga0265338_10105052 Ga0265338_101050522 161
509 3300028800 Ga0265338_10107502 Ga0265338_101075022 161
510 3300028800 Ga0265338_10213267 Ga0265338_102132672 161
511 3300028800 Ga0265338_10233848 Ga0265338_102338482 161
512 3300028800 Ga0265338_10251731 Ga0265338_102517312 161
513 3300028800 Ga0265338_10298128 Ga0265338_102981283 161
514 3300028800 Ga0265338_10462476 Ga0265338_104624762 161
515 3300028800 Ga0265338_10470376 Ga0265338_104703762 161
516 3300029957 Ga0265324_10000515 Ga0265324_1000051523 161
517 3300029957 Ga0265324_10005688 Ga0265324_100056885 161
518 3300029957 Ga0265324_10006339 Ga0265324_100063393 161
519 3300029957 Ga0265324_10009283 Ga0265324_100092832 161
520 3300029957 Ga0265324_10037961 Ga0265324_100379612 161
521 3300029957 Ga0265324_10042539 Ga0265324_100425393 161
522 3300029957 Ga0265324_10053490 Ga0265324_100534902 161
523 3300029957 Ga0265324_10058288 Ga0265324_100582882 161
524 3300029957 Ga0265324_10061213 Ga0265324_100612132 161
525 3300029957 Ga0265324_10095539 Ga0265324_100955392 161
526 3300029957 Ga0265324_10253310 Ga0265324_102533101 161
527 3300031235 Ga0265330_10381445 Ga0265330_103814451 161
528 3300031235 Ga0265330_10394163 Ga0265330_103941632 161
529 3300031238 Ga0265332_10167872 Ga0265332_101678722 161
530 3300031240 Ga0265320_10000188 Ga0265320_1000018811 161
531 3300031240 Ga0265320_10004415 Ga0265320_1000441510 161
532 3300031240 Ga0265320_10016271 Ga0265320_100162713 161
533 3300031240 Ga0265320_10025337 Ga0265320_100253372 161
534 3300031240 Ga0265320_10027037 Ga0265320_100270373 161
535 3300031240 Ga0265320_10027755 Ga0265320_100277553 161
536 3300031240 Ga0265320_10160543 Ga0265320_101605432 161
537 3300031240 Ga0265320_10192108 Ga0265320_101921082 161
538 3300031240 Ga0265320_10341778 Ga0265320_103417781 161
539 3300031241 Ga0265325_10085582 Ga0265325_100855822 161
540 3300031241 Ga0265325_10094847 Ga0265325_100948472 161
541 3300031242 Ga0265329_10100357 Ga0265329_101003572 161
542 3300031247 Ga0265340_10000803 Ga0265340_100008039 161
543 3300031247 Ga0265340_10027009 Ga0265340_100270091 161
544 3300031247 Ga0265340_10057322 Ga0265340_100573223 161
545 3300031247 Ga0265340_10063435 Ga0265340_100634354 161
546 3300031249 Ga0265339_10014822 Ga0265339_100148226 161
547 3300031249 Ga0265339_10024832 Ga0265339_100248324 161
548 3300031249 Ga0265339_10025907 Ga0265339_100259074 161
549 3300031249 Ga0265339_10296789 Ga0265339_102967892 161
550 3300031249 Ga0265339_10301890 Ga0265339_103018902 161
551 3300031249 Ga0265339_10345557 Ga0265339_103455572 161
552 3300031250 Ga0265331_10239305 Ga0265331_102393052 161
553 3300031250 Ga0265331_10259269 Ga0265331_102592691 161
554 3300031251 Ga0265327_10000752 Ga0265327_1000075216 161
555 3300031251 Ga0265327_10003972 Ga0265327_100039723 161
556 3300031251 Ga0265327_10010095 Ga0265327_100100956 161
557 3300031251 Ga0265327_10030353 Ga0265327_100303533 161
558 3300031344 Ga0265316_10006885 Ga0265316_1000688511 161
559 3300031344 Ga0265316_10017515 Ga0265316_100175152 161
560 3300031344 Ga0265316_10026957 Ga0265316_100269574 161
561 3300031344 Ga0265316_10028132 Ga0265316_100281326 161
562 3300031344 Ga0265316_10218174 Ga0265316_102181742 161
563 3300031344 Ga0265316_10399473 Ga0265316_103994732 161
564 3300031344 Ga0265316_10484451 Ga0265316_104844512 161
565 3300031595 Ga0265313_10001008 Ga0265313_1000100823 161
566 3300031595 Ga0265313_10079892 Ga0265313_100798922 161
567 3300031595 Ga0265313_10097366 Ga0265313_100973663 161
568 3300031595 Ga0265313_10114218 Ga0265313_101142182 161
569 3300031595 Ga0265313_10158762 Ga0265313_101587622 161
570 3300031711 Ga0265314_10004107 Ga0265314_1000410715 161
571 3300031711 Ga0265314_10014321 Ga0265314_100143214 161
572 3300031711 Ga0265314_10046910 Ga0265314_100469103 161
573 3300031711 Ga0265314_10299710 Ga0265314_102997102 161
574 3300031733 Ga0316577_10193797 Ga0316577_101937971 161
575 3300034816 Ga0373930_0021703 Ga0373930_0021703_115_600 161
576 3300034957 Ga0373938_0020453 Ga0373938_0020453_695_1180 161
577 3300034957 Ga0373938_0026517 Ga0373938_0026517_63_548 161
578 3300035084 Ga0373928_0000124 Ga0373928_0000124_6967_7452 161
579 3300035085 Ga0373929_0006750 Ga0373929_0006750_1416_1901 161
580 3300035086 Ga0373934_0070470 Ga0373934_0070470_794_1327 161
581 3300035089 Ga0373944_0001296 Ga0373944_0001296_3980_4465 161
582 3300035090 Ga0373949_0019648 Ga0373949_0019648_270_755 161
583 3300035091 Ga0373951_0003865 Ga0373951_0003865_3030_3515 161
584 3300035111 Ga0373923_0066729 Ga0373923_0066729_661_1194 161
585 3300035112 Ga0373932_0000001 Ga0373932_0000001_1154181_1154666 161
586 3300035113 Ga0373936_0154362 Ga0373936_0154362_417_902 161
587 3300035116 Ga0373945_0027439 Ga0373945_0027439_408_893 161
588 3300035117 Ga0373953_0155983 Ga0373953_0155983_327_860 161
589 3300035118 Ga0373954_0003285 Ga0373954_0003285_257_790 161
590 3300035118 Ga0373954_0068773 Ga0373954_0068773_165_695 161
591 3300035118 Ga0373954_0070100 Ga0373954_0070100_737_1273 161
592 3300035171 Ga0373946_0115194 Ga0373946_0115194_440_925 161
593 3300035172 Ga0373955_0062252 Ga0373955_0062252_1509_2051 161
594 3300035172 Ga0373955_0345438 Ga0373955_0345438_74_610 161
595 3300035241 Ga0373961_0045640 Ga0373961_0045640_650_1135 161
596 3300035242 Ga0373962_0000018 Ga0373962_0000018_30102_30587 161
597 3300035691 Ga0373931_0000002 Ga0373931_0000002_340732_341217 161
598 3300035692 Ga0373935_0091703 Ga0373935_0091703_712_1197 161
599 3300035692 Ga0373935_0643648 Ga0373935_0643648_25_510 161
600 3300035695 Ga0373927_0026587 Ga0373927_0026587_2663_3148 161
601 3300035724 Ga0373933_0764336 Ga0373933_0764336_51_536 161
602 3300035725 Ga0373947_0049735 Ga0373947_0049735_1622_2107 161
603 3300036401 Ga0373937_0025480 Ga0373937_0025480_3088_3630 161
604 3300037068 Ga0373925_0000552 Ga0373925_0000552_20659_21144 161
605 3300037068 Ga0373925_0011834 Ga0373925_0011834_3183_3668 161
606 3300041486 Ga0451807_0982052 Ga0451807_0982052_827_1312 161
607 3300042876 Ga0451577_0008522 Ga0451577_0008522_5343_5888 161
608 3300042876 Ga0451577_0064048 Ga0451577_0064048_988_1473 161
609 3300042876 Ga0451577_0150176 Ga0451577_0150176_841_1335 161
610 3300044684 Ga0466966_0094958 Ga0466966_0094958_1069_1602 161
611 3300044712 Ga0453684_0002848 Ga0453684_0002848_14170_14709 161
612 3300044712 Ga0453684_0006217 Ga0453684_0006217_3330_3824 161
613 3300044712 Ga0453684_0009645 Ga0453684_0009645_11588_12133 161
614 3300044712 Ga0453684_0650786 Ga0453684_0650786_646_1131 161
615 3300044712 Ga0453684_0741856 Ga0453684_0741856_117_692 161
616 3300044712 Ga0453684_1861747 Ga0453684_1861747_59_544 161
617 3300045051 Ga0451576_0029877 Ga0451576_0029877_3202_3696 161
618 3300045051 Ga0451576_0074622 Ga0451576_0074622_1435_1971 161
619 3300045051 Ga0451576_0090765 Ga0451576_0090765_147_683 161
620 3300045051 Ga0451576_0500750 Ga0451576_0500750_709_1194 161
621 3300045051 Ga0451576_0729402 Ga0451576_0729402_58_543 161
622 3300045051 Ga0451576_1051311 Ga0451576_1051311_249_782 161
623 3300046454 Ga0495592_0198406 Ga0495592_0198406_787_1323 161
624 3300046454 Ga0495592_0290727 Ga0495592_0290727_29_562 161
625 3300046459 Ga0495629_0196643 Ga0495629_0196643_51_593 161
626 3300046472 Ga0495580_0377969 Ga0495580_0377969_227_712 161
627 3300046477 Ga0495664_0364839 Ga0495664_0364839_63_548 161
628 3300046511 Ga0495608_0333478 Ga0495608_0333478_66_554 161
629 3300046514 Ga0495618_0002646 Ga0495618_0002646_9469_10002 161
630 3300046517 Ga0495630_0017877 Ga0495630_0017877_4541_5026 161
631 3300046517 Ga0495630_0085176 Ga0495630_0085176_875_1408 161
632 3300046517 Ga0495630_1180276 Ga0495630_1180276_52_537 161
633 3300046526 Ga0495666_0162477 Ga0495666_0162477_368_901 161
634 3300046529 Ga0495652_0177386 Ga0495652_0177386_730_1263 161
635 3300046529 Ga0495652_0666337 Ga0495652_0666337_136_621 161
636 3300046533 Ga0495640_0189425 Ga0495640_0189425_92_625 161
637 3300046535 Ga0495586_0002311 Ga0495586_0002311_398_940 161
638 3300046535 Ga0495586_0650176 Ga0495586_0650176_11_496 161
639 3300046535 Ga0495586_0833867 Ga0495586_0833867_11_496 161
640 3300046543 Ga0495645_0320781 Ga0495645_0320781_52_585 161
641 3300046557 Ga0495622_0256937 Ga0495622_0256937_148_684 161
642 3300046559 Ga0495667_0371595 Ga0495667_0371595_299_832 161
643 3300046642 Ga0495634_0002060 Ga0495634_0002060_6233_6775 161
644 3300046663 Ga0495635_0045785 Ga0495635_0045785_1329_1862 161
645 3300046678 Ga0495599_0526627 Ga0495599_0526627_32_568 161
646 3300046681 Ga0495647_0014088 Ga0495647_0014088_1363_1896 161
647 3300046689 Ga0495613_0021151 Ga0495613_0021151_3240_3782 161
648 3300047319 Ga0495674_0298603 Ga0495674_0298603_17_553 161
649 3300047319 Ga0495674_0461380 Ga0495674_0461380_313_846 161
650 3300047322 Ga0495680_0013067 Ga0495680_0013067_5535_6068 161
651 3300047444 Ga0495675_0123348 Ga0495675_0123348_896_1432 161
652 3300047471 Ga0495684_0081704 Ga0495684_0081704_1569_2102 161
653 3300047471 Ga0495684_0822836 Ga0495684_0822836_55_588 161
654 3300048918 Ga0496115_0009632 Ga0496115_0009632_5206_5805 161
655 3300048918 Ga0496115_0633157 Ga0496115_0633157_18_551 161
656 3300049460 Ga0495682_0079226 Ga0495682_0079226_334_867 161
657 3300049460 Ga0495682_0141220 Ga0495682_0141220_275_808 161
658 3300049568 Ga0501031_0009653 Ga0501031_0009653_1344_1829 161
659 3300049569 Ga0501032_0001311 Ga0501032_0001311_1479_1964 161
660 3300049570 Ga0501033_0019944 Ga0501033_0019944_78_563 161
661 3300049570 Ga0501033_0033260 Ga0501033_0033260_3285_3770 161
662 3300049573 Ga0501037_0013416 Ga0501037_0013416_3246_3731 161
663 3300049575 Ga0501039_0072172 Ga0501039_0072172_790_1275 161
664 3300049575 Ga0501039_0714604 Ga0501039_0714604_177_716 161
665 3300049579 Ga0501043_0639110 Ga0501043_0639110_87_572 161
666 3300049589 Ga0501073_0482742 Ga0501073_0482742_135_668 161
667 3300049822 Ga0501035_0003191 Ga0501035_0003191_11819_12304 161
668 3300049823 Ga0501044_0000125 Ga0501044_0000125_60223_60708 161
669 3300049823 Ga0501044_0269897 Ga0501044_0269897_979_1464 161
670 3300050511 nmdc:mga08y16_44782_c1 nmdc:mga08y16_44782_c1_2801_3286 161
671 3300050513 nmdc:mga0rr50_288139_c1 nmdc:mga0rr50_288139_c1_772_1308 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

46

190

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o2k-assembly1.cif.gz_B crystal structure of the activation domain of human methionine synthase isoform/mutant d963e/k1071n 0.8719 40 73
2o2k-assembly1.cif.gz_A crystal structure of the activation domain of human methionine synthase isoform/mutant d963e/k1071n 0.8618 40 73
7p8n-assembly1.cif.gz_B tmhydabc- t. maritima hydrogenase with bridge closed 0.8409 78 158
7p5h-assembly1.cif.gz_b tmhydabc- d2 map 0.833 76 158
8oh5-assembly1.cif.gz_A cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) 0.8277 11 161
ID Description Score Start End Superfamily
af_O13691_6_74_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9437 4 68 1.10.10.1590
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9426 76 158 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9371 74 158 3.40.30.10
af_P9WIV5_106_200_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9065 75 160 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9053 74 158 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A645D7E5-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9625 69 161 GO:0003954
AF-A0A645D7E5-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9524 69 161 GO:0003954
AF-A0A661A0L8-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9126 1 160 GO:0046872
GO:0051536
AF-Q46505-F1-model_v4 NADP-reducing hydrogenase subunit HndA (EC 1.12.1.3) (Hydrogen dehydrogenase (NADP(+))) 0.8903 5 158 GO:0046872
GO:0050583
GO:0051537
AF-A0A5D0RIZ2-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.8882 7 160 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
92.75 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map