F474172
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 671 | 283 | 671 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300035691|Ga0373931_0107596|Ga0373931_0107596_295_867 |
| Length | 190 |
| Sequence | VSATDEERIEDRGLKIDETSARQNDSPSSVSKNMALEFSPETYKKFEETIARYPKKEAAMLPVLCLAQREFGHLGQEAIEYVAQLMDQSPARVQGVVSFYTMLNPKPIGRHHIQVCRTLPCALRGAEKLTSFLKKTLDIELGQTTGDGRFTLSEVECLASCGTAPMMQINDDYYENLTDEKVTEILAALK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 135 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 136 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 137 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 139 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 140 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 141 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 147 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 148 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 150 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 168 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 169 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 171 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 179 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 196 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 197 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 198 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 199 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 200 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 201 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 231 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 234 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 236 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 237 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 262 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 263 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 268 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.89 |
| Rhizosphere | 98.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10035096 | 3300003320 | Bacteria | 2716 |
| 2 | rootH1_10072186 | 3300003323 | Bacteria | 2407 |
| 3 | JGI25405J52794_10000874 | 3300003911 | Bacteria | 4705 |
| 4 | Ga0065717_1010041 | 3300005276 | Bacteria | 632 |
| 5 | Ga0065704_10008073 | 3300005289 | Bacteria | 5059 |
| 6 | Ga0065704_10374914 | 3300005289 | Bacteria | 780 |
| 7 | Ga0065715_10102569 | 3300005293 | Bacteria | 3062 |
| 8 | Ga0065707_10003878 | 3300005295 | Bacteria | 5978 |
| 9 | Ga0065707_10092570 | 3300005295 | Bacteria | 3748 |
| 10 | Ga0070658_10120517 | 3300005327 | Bacteria | 2180 |
| 11 | Ga0070658_10273866 | 3300005327 | Bacteria | 1436 |
| 12 | Ga0070676_10076976 | 3300005328 | Bacteria | 2015 |
| 13 | Ga0070683_100238398 | 3300005329 | Unclassified | 1730 |
| 14 | Ga0070683_101652396 | 3300005329 | Unclassified | 616 |
| 15 | Ga0070690_100332723 | 3300005330 | Bacteria | 1098 |
| 16 | Ga0070680_100007262 | 3300005336 | Bacteria | 8443 |
| 17 | Ga0070660_100021860 | 3300005339 | Bacteria | 4724 |
| 18 | Ga0070660_100171307 | 3300005339 | Bacteria | 1753 |
| 19 | Ga0070689_100176832 | 3300005340 | Bacteria | 1732 |
| 20 | Ga0070689_100210854 | 3300005340 | Bacteria | 1590 |
| 21 | Ga0070661_100426779 | 3300005344 | Bacteria | 1051 |
| 22 | Ga0070668_100182326 | 3300005347 | Unclassified | 1716 |
| 23 | Ga0070675_100705311 | 3300005354 | Bacteria | 919 |
| 24 | Ga0070671_100214335 | 3300005355 | Bacteria | 1633 |
| 25 | Ga0070674_100496881 | 3300005356 | Unclassified | 1015 |
| 26 | Ga0070674_100834819 | 3300005356 | Bacteria | 798 |
| 27 | Ga0070673_101023122 | 3300005364 | Bacteria | 770 |
| 28 | Ga0070688_100985682 | 3300005365 | Bacteria | 669 |
| 29 | Ga0070659_100116680 | 3300005366 | Bacteria | 2158 |
| 30 | Ga0070659_100718977 | 3300005366 | Unclassified | 865 |
| 31 | Ga0070659_101458029 | 3300005366 | Bacteria | 609 |
| 32 | Ga0070703_10285674 | 3300005406 | Bacteria | 682 |
| 33 | Ga0070713_100247274 | 3300005436 | Bacteria | 1626 |
| 34 | Ga0070701_10059197 | 3300005438 | Bacteria | 2013 |
| 35 | Ga0070711_100002821 | 3300005439 | Bacteria | 9974 |
| 36 | Ga0070705_100290095 | 3300005440 | Bacteria | 1168 |
| 37 | Ga0070700_101057291 | 3300005441 | Unclassified | 670 |
| 38 | Ga0070694_100066050 | 3300005444 | Bacteria | 2481 |
| 39 | Ga0070663_100224172 | 3300005455 | Bacteria | 1477 |
| 40 | Ga0070662_100029032 | 3300005457 | Bacteria | 3856 |
| 41 | Ga0070662_100228859 | 3300005457 | Bacteria | 1487 |
| 42 | Ga0070681_10329466 | 3300005458 | Bacteria | 1436 |
| 43 | Ga0070681_10478536 | 3300005458 | Unclassified | 1158 |
| 44 | Ga0070681_10580972 | 3300005458 | Bacteria | 1034 |
| 45 | Ga0068867_100244048 | 3300005459 | Bacteria | 1458 |
| 46 | Ga0068867_100410895 | 3300005459 | Bacteria | 1144 |
| 47 | Ga0070706_100169487 | 3300005467 | Bacteria | 2038 |
| 48 | Ga0070707_100797031 | 3300005468 | Bacteria | 908 |
| 49 | Ga0070698_100200378 | 3300005471 | Bacteria | 1932 |
| 50 | Ga0070699_100137384 | 3300005518 | Bacteria | 2157 |
| 51 | Ga0070699_101080395 | 3300005518 | Unclassified | 736 |
| 52 | Ga0070679_100031128 | 3300005530 | Bacteria | 5270 |
| 53 | Ga0070679_100163077 | 3300005530 | Bacteria | 2202 |
| 54 | Ga0070679_100342609 | 3300005530 | Bacteria | 1443 |
| 55 | Ga0070679_100768301 | 3300005530 | Bacteria | 906 |
| 56 | Ga0070697_100013638 | 3300005536 | Bacteria | 6375 |
| 57 | Ga0070697_101306969 | 3300005536 | Bacteria | 647 |
| 58 | Ga0068853_100026471 | 3300005539 | Bacteria | 4870 |
| 59 | Ga0070672_100378047 | 3300005543 | Bacteria | 1211 |
| 60 | Ga0070686_100013098 | 3300005544 | Bacteria | 4734 |
| 61 | Ga0070686_100200988 | 3300005544 | Bacteria | 1429 |
| 62 | Ga0070686_100387757 | 3300005544 | Bacteria | 1059 |
| 63 | Ga0070686_101076683 | 3300005544 | Bacteria | 663 |
| 64 | Ga0070695_100822023 | 3300005545 | Bacteria | 746 |
| 65 | Ga0070696_100557346 | 3300005546 | Bacteria | 919 |
| 66 | Ga0070704_100101420 | 3300005549 | Bacteria | 2170 |
| 67 | Ga0070704_100387832 | 3300005549 | Bacteria | 1189 |
| 68 | Ga0070704_100665055 | 3300005549 | Bacteria | 921 |
| 69 | Ga0068855_100019809 | 3300005563 | Bacteria | 8083 |
| 70 | Ga0068855_100044981 | 3300005563 | Bacteria | 5223 |
| 71 | Ga0068855_100132174 | 3300005563 | Bacteria | 2849 |
| 72 | Ga0068855_100180493 | 3300005563 | Bacteria | 2387 |
| 73 | Ga0068855_100505567 | 3300005563 | Bacteria | 1313 |
| 74 | Ga0068855_100619972 | 3300005563 | Bacteria | 1165 |
| 75 | Ga0070664_100004565 | 3300005564 | Bacteria | 11110 |
| 76 | Ga0070664_100329546 | 3300005564 | Bacteria | 1385 |
| 77 | Ga0068857_100619848 | 3300005577 | Unclassified | 1024 |
| 78 | Ga0068856_100000058 | 3300005614 | Bacteria | 101767 |
| 79 | Ga0068856_100145557 | 3300005614 | Bacteria | 2377 |
| 80 | Ga0068856_100981778 | 3300005614 | Bacteria | 863 |
| 81 | Ga0068856_101580387 | 3300005614 | Bacteria | 669 |
| 82 | Ga0068859_100056294 | 3300005617 | Bacteria | 3957 |
| 83 | Ga0068859_100553504 | 3300005617 | Bacteria | 1245 |
| 84 | Ga0068859_101720199 | 3300005617 | Bacteria | 693 |
| 85 | Ga0068859_101849658 | 3300005617 | Bacteria | 667 |
| 86 | Ga0068859_101877372 | 3300005617 | Bacteria | 662 |
| 87 | Ga0068864_100481137 | 3300005618 | Bacteria | 1192 |
| 88 | Ga0068866_10591179 | 3300005718 | Bacteria | 748 |
| 89 | Ga0068861_100281316 | 3300005719 | Bacteria | 1433 |
| 90 | Ga0068861_100282978 | 3300005719 | Bacteria | 1429 |
| 91 | Ga0068870_10235917 | 3300005840 | Bacteria | 1127 |
| 92 | Ga0068863_101513405 | 3300005841 | Bacteria | 680 |
| 93 | Ga0068858_100133244 | 3300005842 | Bacteria | 2331 |
| 94 | Ga0068860_100642649 | 3300005843 | Bacteria | 1068 |
| 95 | Ga0068862_100326998 | 3300005844 | Bacteria | 1417 |
| 96 | Ga0081455_10000067 | 3300005937 | Bacteria | 112338 |
| 97 | Ga0081538_10026589 | 3300005981 | Bacteria | 4042 |
| 98 | Ga0070715_10276745 | 3300006163 | Bacteria | 888 |
| 99 | Ga0070716_100038753 | 3300006173 | Bacteria | 2641 |
| 100 | Ga0075428_100003743 | 3300006844 | Bacteria | 16685 |
| 101 | Ga0075428_100033541 | 3300006844 | Bacteria | 5668 |
| 102 | Ga0075428_100785356 | 3300006844 | Bacteria | 1012 |
| 103 | Ga0075428_100803318 | 3300006844 | Bacteria | 1000 |
| 104 | Ga0075428_101394360 | 3300006844 | Bacteria | 736 |
| 105 | Ga0075428_102219524 | 3300006844 | Bacteria | 566 |
| 106 | Ga0075430_100022482 | 3300006846 | Bacteria | 5366 |
| 107 | Ga0075430_100064532 | 3300006846 | Bacteria | 3076 |
| 108 | Ga0075430_100336789 | 3300006846 | Bacteria | 1246 |
| 109 | Ga0075430_100561865 | 3300006846 | Bacteria | 941 |
| 110 | Ga0075430_100602377 | 3300006846 | Unclassified | 906 |
| 111 | Ga0075431_100045936 | 3300006847 | Bacteria | 4502 |
| 112 | Ga0075431_100128194 | 3300006847 | Bacteria | 2618 |
| 113 | Ga0075431_100223521 | 3300006847 | Bacteria | 1920 |
| 114 | Ga0075431_100558356 | 3300006847 | Bacteria | 1132 |
| 115 | Ga0075431_100814038 | 3300006847 | Bacteria | 907 |
| 116 | Ga0075433_10000198 | 3300006852 | Bacteria | 33744 |
| 117 | Ga0075433_10006171 | 3300006852 | Bacteria | 9451 |
| 118 | Ga0075433_10144946 | 3300006852 | Bacteria | 2111 |
| 119 | Ga0075433_10606409 | 3300006852 | Bacteria | 961 |
| 120 | Ga0075434_100000499 | 3300006871 | Bacteria | 29689 |
| 121 | Ga0075434_100035710 | 3300006871 | Bacteria | 4914 |
| 122 | Ga0075434_100065270 | 3300006871 | Bacteria | 3625 |
| 123 | Ga0075434_100106881 | 3300006871 | Bacteria | 2808 |
| 124 | Ga0075434_101203975 | 3300006871 | Unclassified | 769 |
| 125 | Ga0075429_100015520 | 3300006880 | Bacteria | 6600 |
| 126 | Ga0075429_100103703 | 3300006880 | Bacteria | 2484 |
| 127 | Ga0075429_100202317 | 3300006880 | Bacteria | 1740 |
| 128 | Ga0075429_100351730 | 3300006880 | Bacteria | 1290 |
| 129 | Ga0075429_100352545 | 3300006880 | Bacteria | 1288 |
| 130 | Ga0075429_100790680 | 3300006880 | Unclassified | 831 |
| 131 | Ga0075429_100914938 | 3300006880 | Unclassified | 767 |
| 132 | Ga0075436_100747602 | 3300006914 | Bacteria | 726 |
| 133 | Ga0075436_100768047 | 3300006914 | Unclassified | 716 |
| 134 | Ga0075436_100869000 | 3300006914 | Bacteria | 674 |
| 135 | Ga0097620_100056294 | 3300006931 | Bacteria | 3957 |
| 136 | Ga0097620_100553453 | 3300006931 | Bacteria | 1245 |
| 137 | Ga0097620_101720231 | 3300006931 | Bacteria | 693 |
| 138 | Ga0097620_101849601 | 3300006931 | Bacteria | 667 |
| 139 | Ga0097620_101877507 | 3300006931 | Bacteria | 662 |
| 140 | Ga0075435_100015294 | 3300007076 | Bacteria | 5766 |
| 141 | Ga0075435_100063745 | 3300007076 | Bacteria | 2993 |
| 142 | Ga0075435_100103969 | 3300007076 | Bacteria | 2356 |
| 143 | Ga0075435_100163133 | 3300007076 | Bacteria | 1878 |
| 144 | Ga0075435_100353956 | 3300007076 | Bacteria | 1259 |
| 145 | Ga0075435_100918035 | 3300007076 | Bacteria | 764 |
| 146 | Ga0105240_10134769 | 3300009093 | Bacteria | 2958 |
| 147 | Ga0105240_10167864 | 3300009093 | Bacteria | 2601 |
| 148 | Ga0105240_10202948 | 3300009093 | Bacteria | 2322 |
| 149 | Ga0105240_10442939 | 3300009093 | Bacteria | 1455 |
| 150 | Ga0105240_11380586 | 3300009093 | Unclassified | 741 |
| 151 | Ga0111539_10004958 | 3300009094 | Bacteria | 17316 |
| 152 | Ga0111539_10494989 | 3300009094 | Bacteria | 1424 |
| 153 | Ga0111539_10737525 | 3300009094 | Bacteria | 1147 |
| 154 | Ga0114129_10147465 | 3300009147 | Bacteria | 3222 |
| 155 | Ga0114129_10929001 | 3300009147 | Bacteria | 1100 |
| 156 | Ga0114129_10948048 | 3300009147 | Bacteria | 1087 |
| 157 | Ga0114129_11497166 | 3300009147 | Unclassified | 829 |
| 158 | Ga0105243_10809286 | 3300009148 | Bacteria | 924 |
| 159 | Ga0105241_10066720 | 3300009174 | Bacteria | 2783 |
| 160 | Ga0105242_10295108 | 3300009176 | Bacteria | 1477 |
| 161 | Ga0105242_10935549 | 3300009176 | Bacteria | 870 |
| 162 | Ga0105248_11068070 | 3300009177 | Bacteria | 912 |
| 163 | Ga0105237_10207788 | 3300009545 | Bacteria | 1958 |
| 164 | Ga0105238_10027652 | 3300009551 | Bacteria | 5781 |
| 165 | Ga0105238_10105220 | 3300009551 | Bacteria | 2803 |
| 166 | Ga0105238_10325421 | 3300009551 | Bacteria | 1523 |
| 167 | Ga0105238_11481675 | 3300009551 | Bacteria | 707 |
| 168 | Ga0105249_10077893 | 3300009553 | Bacteria | 3075 |
| 169 | Ga0105249_10330705 | 3300009553 | Bacteria | 1537 |
| 170 | Ga0105239_11393119 | 3300010375 | Bacteria | 809 |
| 171 | Ga0105246_10158891 | 3300011119 | Bacteria | 1720 |
| 172 | Ga0105246_11025133 | 3300011119 | Bacteria | 749 |
| 173 | Ga0157371_10284288 | 3300013102 | Bacteria | 1195 |
| 174 | Ga0157370_10045311 | 3300013104 | Bacteria | 4220 |
| 175 | Ga0157370_10500966 | 3300013104 | Unclassified | 1115 |
| 176 | Ga0157374_10148125 | 3300013296 | Bacteria | 2281 |
| 177 | Ga0157374_10497820 | 3300013296 | Bacteria | 1223 |
| 178 | Ga0157374_10995042 | 3300013296 | Bacteria | 857 |
| 179 | Ga0157378_10101242 | 3300013297 | Bacteria | 2631 |
| 180 | Ga0157378_10294608 | 3300013297 | Bacteria | 1568 |
| 181 | Ga0157378_10404458 | 3300013297 | Bacteria | 1346 |
| 182 | Ga0157378_10681764 | 3300013297 | Bacteria | 1046 |
| 183 | Ga0163162_10065901 | 3300013306 | Bacteria | 3670 |
| 184 | Ga0163162_11007903 | 3300013306 | Bacteria | 942 |
| 185 | Ga0163162_11302432 | 3300013306 | Bacteria | 825 |
| 186 | Ga0157372_10187482 | 3300013307 | Bacteria | 2395 |
| 187 | Ga0157375_10855522 | 3300013308 | Unclassified | 1056 |
| 188 | Ga0157375_12744949 | 3300013308 | Bacteria | 589 |
| 189 | Ga0163163_10131060 | 3300014325 | Unclassified | 2548 |
| 190 | Ga0163163_11573677 | 3300014325 | Bacteria | 718 |
| 191 | Ga0157379_11234793 | 3300014968 | Unclassified | 720 |
| 192 | Ga0157376_12159843 | 3300014969 | Bacteria | 595 |
| 193 | Ga0207642_10452660 | 3300025899 | Bacteria | 778 |
| 194 | Ga0207645_10109541 | 3300025907 | Unclassified | 1787 |
| 195 | Ga0207705_10213479 | 3300025909 | Bacteria | 1464 |
| 196 | Ga0207654_10074411 | 3300025911 | Bacteria | 2027 |
| 197 | Ga0207707_10002190 | 3300025912 | Bacteria | 17705 |
| 198 | Ga0207707_10003311 | 3300025912 | Bacteria | 14317 |
| 199 | Ga0207707_10399978 | 3300025912 | Bacteria | 1179 |
| 200 | Ga0207695_10101741 | 3300025913 | Bacteria | 2867 |
| 201 | Ga0207695_10119012 | 3300025913 | Bacteria | 2612 |
| 202 | Ga0207695_10154957 | 3300025913 | Bacteria | 2226 |
| 203 | Ga0207695_10246284 | 3300025913 | Bacteria | 1687 |
| 204 | Ga0207663_10001010 | 3300025916 | Bacteria | 12879 |
| 205 | Ga0207660_10002204 | 3300025917 | Bacteria | 12890 |
| 206 | Ga0207660_10020490 | 3300025917 | Bacteria | 4438 |
| 207 | Ga0207660_10327971 | 3300025917 | Bacteria | 1223 |
| 208 | Ga0207657_10072423 | 3300025919 | Bacteria | 2915 |
| 209 | Ga0207649_10177455 | 3300025920 | Bacteria | 1489 |
| 210 | Ga0207652_10010626 | 3300025921 | Bacteria | 7412 |
| 211 | Ga0207652_10128185 | 3300025921 | Bacteria | 2261 |
| 212 | Ga0207652_10131207 | 3300025921 | Bacteria | 2235 |
| 213 | Ga0207652_10510644 | 3300025921 | Bacteria | 1082 |
| 214 | Ga0207646_10231723 | 3300025922 | Bacteria | 1668 |
| 215 | Ga0207681_10329627 | 3300025923 | Bacteria | 1216 |
| 216 | Ga0207694_10015363 | 3300025924 | Bacteria | 5775 |
| 217 | Ga0207694_10044221 | 3300025924 | Bacteria | 3439 |
| 218 | Ga0207694_10053022 | 3300025924 | Bacteria | 3144 |
| 219 | Ga0207694_10308600 | 3300025924 | Bacteria | 1304 |
| 220 | Ga0207650_10001410 | 3300025925 | Bacteria | 17316 |
| 221 | Ga0207664_10005849 | 3300025929 | Bacteria | 8410 |
| 222 | Ga0207644_10066257 | 3300025931 | Bacteria | 2629 |
| 223 | Ga0207690_10004342 | 3300025932 | Bacteria | 8375 |
| 224 | Ga0207706_10138572 | 3300025933 | Bacteria | 2140 |
| 225 | Ga0207706_10236887 | 3300025933 | Bacteria | 1596 |
| 226 | Ga0207686_10360841 | 3300025934 | Bacteria | 1097 |
| 227 | Ga0207670_10055093 | 3300025936 | Bacteria | 2686 |
| 228 | Ga0207670_10060592 | 3300025936 | Bacteria | 2579 |
| 229 | Ga0207670_10531461 | 3300025936 | Bacteria | 959 |
| 230 | Ga0207669_10680684 | 3300025937 | Bacteria | 844 |
| 231 | Ga0207704_10122382 | 3300025938 | Bacteria | 1784 |
| 232 | Ga0207711_11061386 | 3300025941 | Bacteria | 750 |
| 233 | Ga0207661_10327449 | 3300025944 | Bacteria | 1378 |
| 234 | Ga0207661_10376835 | 3300025944 | Bacteria | 1284 |
| 235 | Ga0207679_10007766 | 3300025945 | Bacteria | 6818 |
| 236 | Ga0207667_10034747 | 3300025949 | Bacteria | 5411 |
| 237 | Ga0207667_10141572 | 3300025949 | Bacteria | 2476 |
| 238 | Ga0207667_10168415 | 3300025949 | Bacteria | 2252 |
| 239 | Ga0207667_10389931 | 3300025949 | Bacteria | 1418 |
| 240 | Ga0207667_10531277 | 3300025949 | Bacteria | 1191 |
| 241 | Ga0207712_11169369 | 3300025961 | Unclassified | 686 |
| 242 | Ga0207668_10474681 | 3300025972 | Bacteria | 1072 |
| 243 | Ga0207703_10088615 | 3300026035 | Bacteria | 2598 |
| 244 | Ga0207678_10018177 | 3300026067 | Bacteria | 6173 |
| 245 | Ga0207702_10002049 | 3300026078 | Bacteria | 19503 |
| 246 | Ga0207702_10025697 | 3300026078 | Bacteria | 4888 |
| 247 | Ga0207702_10697721 | 3300026078 | Bacteria | 1000 |
| 248 | Ga0207641_10997168 | 3300026088 | Bacteria | 834 |
| 249 | Ga0207676_10175131 | 3300026095 | Unclassified | 1873 |
| 250 | Ga0207676_10419798 | 3300026095 | Bacteria | 1254 |
| 251 | Ga0207676_11459380 | 3300026095 | Unclassified | 681 |
| 252 | Ga0207683_10147110 | 3300026121 | Bacteria | 2125 |
| 253 | Ga0210002_1057893 | 3300027617 | Bacteria | 674 |
| 254 | Ga0209971_1012080 | 3300027682 | Bacteria | 2044 |
| 255 | Ga0209974_10002328 | 3300027876 | Bacteria | 6894 |
| 256 | Ga0207428_10013239 | 3300027907 | Bacteria | 7216 |
| 257 | Ga0207428_10276090 | 3300027907 | Bacteria | 1248 |
| 258 | Ga0268264_10452395 | 3300028381 | Bacteria | 1244 |
| 259 | Ga0265337_1000140 | 3300028556 | Bacteria | 36107 |
| 260 | Ga0265337_1001274 | 3300028556 | Bacteria | 12670 |
| 261 | Ga0265337_1002167 | 3300028556 | Bacteria | 9209 |
| 262 | Ga0265337_1006735 | 3300028556 | Bacteria | 4379 |
| 263 | Ga0265337_1015350 | 3300028556 | Bacteria | 2509 |
| 264 | Ga0265326_10001872 | 3300028558 | Bacteria | 7206 |
| 265 | Ga0265326_10006429 | 3300028558 | Bacteria | 3652 |
| 266 | Ga0265326_10106052 | 3300028558 | Bacteria | 797 |
| 267 | Ga0265326_10170413 | 3300028558 | Bacteria | 623 |
| 268 | Ga0265319_1000007 | 3300028563 | Bacteria | 217194 |
| 269 | Ga0265319_1029444 | 3300028563 | Bacteria | 1927 |
| 270 | Ga0265319_1043151 | 3300028563 | Bacteria | 1515 |
| 271 | Ga0265319_1100430 | 3300028563 | Bacteria | 908 |
| 272 | Ga0265334_10011533 | 3300028573 | Bacteria | 3719 |
| 273 | Ga0265334_10052800 | 3300028573 | Bacteria | 1554 |
| 274 | Ga0265334_10199677 | 3300028573 | Bacteria | 695 |
| 275 | Ga0265318_10057750 | 3300028577 | Bacteria | 1449 |
| 276 | Ga0265318_10235343 | 3300028577 | Unclassified | 668 |
| 277 | Ga0265323_10000237 | 3300028653 | Bacteria | 32647 |
| 278 | Ga0265323_10029666 | 3300028653 | Bacteria | 2044 |
| 279 | Ga0265323_10123693 | 3300028653 | Bacteria | 841 |
| 280 | Ga0265322_10088443 | 3300028654 | Bacteria | 879 |
| 281 | Ga0265322_10125051 | 3300028654 | Bacteria | 733 |
| 282 | Ga0265336_10000819 | 3300028666 | Bacteria | 16328 |
| 283 | Ga0265336_10014566 | 3300028666 | Bacteria | 2603 |
| 284 | Ga0265336_10052476 | 3300028666 | Bacteria | 1229 |
| 285 | Ga0265336_10077152 | 3300028666 | Bacteria | 995 |
| 286 | Ga0265338_10000075 | 3300028800 | Bacteria | 180334 |
| 287 | Ga0265338_10000425 | 3300028800 | Bacteria | 75565 |
| 288 | Ga0265338_10000431 | 3300028800 | Bacteria | 75210 |
| 289 | Ga0265338_10000945 | 3300028800 | Bacteria | 48867 |
| 290 | Ga0265338_10001555 | 3300028800 | Bacteria | 37061 |
| 291 | Ga0265338_10002354 | 3300028800 | Bacteria | 28532 |
| 292 | Ga0265338_10004123 | 3300028800 | Bacteria | 19904 |
| 293 | Ga0265338_10009242 | 3300028800 | Bacteria | 11797 |
| 294 | Ga0265338_10009353 | 3300028800 | Bacteria | 11706 |
| 295 | Ga0265338_10010670 | 3300028800 | Bacteria | 10734 |
| 296 | Ga0265338_10013146 | 3300028800 | Bacteria | 9375 |
| 297 | Ga0265338_10018502 | 3300028800 | Bacteria | 7456 |
| 298 | Ga0265338_10019978 | 3300028800 | Bacteria | 7071 |
| 299 | Ga0265338_10020690 | 3300028800 | Bacteria | 6905 |
| 300 | Ga0265338_10022140 | 3300028800 | Bacteria | 6596 |
| 301 | Ga0265338_10052394 | 3300028800 | Bacteria | 3661 |
| 302 | Ga0265338_10052887 | 3300028800 | Bacteria | 3639 |
| 303 | Ga0265338_10073848 | 3300028800 | Bacteria | 2904 |
| 304 | Ga0265338_10105052 | 3300028800 | Bacteria | 2290 |
| 305 | Ga0265338_10107502 | 3300028800 | Bacteria | 2256 |
| 306 | Ga0265338_10213267 | 3300028800 | Bacteria | 1447 |
| 307 | Ga0265338_10233848 | 3300028800 | Bacteria | 1365 |
| 308 | Ga0265338_10251731 | 3300028800 | Bacteria | 1303 |
| 309 | Ga0265338_10298128 | 3300028800 | Bacteria | 1173 |
| 310 | Ga0265338_10462476 | 3300028800 | Bacteria | 897 |
| 311 | Ga0265338_10470376 | 3300028800 | Bacteria | 888 |
| 312 | Ga0265324_10000515 | 3300029957 | Bacteria | 26598 |
| 313 | Ga0265324_10005688 | 3300029957 | Bacteria | 5324 |
| 314 | Ga0265324_10006339 | 3300029957 | Bacteria | 4950 |
| 315 | Ga0265324_10009283 | 3300029957 | Bacteria | 3848 |
| 316 | Ga0265324_10037961 | 3300029957 | Bacteria | 1672 |
| 317 | Ga0265324_10042539 | 3300029957 | Bacteria | 1570 |
| 318 | Ga0265324_10053490 | 3300029957 | Bacteria | 1386 |
| 319 | Ga0265324_10058288 | 3300029957 | Bacteria | 1321 |
| 320 | Ga0265324_10061213 | 3300029957 | Bacteria | 1286 |
| 321 | Ga0265324_10095539 | 3300029957 | Bacteria | 1011 |
| 322 | Ga0265324_10253310 | 3300029957 | Unclassified | 598 |
| 323 | Ga0265330_10381445 | 3300031235 | Bacteria | 596 |
| 324 | Ga0265330_10394163 | 3300031235 | Bacteria | 586 |
| 325 | Ga0265332_10167872 | 3300031238 | Bacteria | 916 |
| 326 | Ga0265320_10000188 | 3300031240 | Bacteria | 51229 |
| 327 | Ga0265320_10004415 | 3300031240 | Bacteria | 9228 |
| 328 | Ga0265320_10016271 | 3300031240 | Bacteria | 4173 |
| 329 | Ga0265320_10025337 | 3300031240 | Bacteria | 3119 |
| 330 | Ga0265320_10027037 | 3300031240 | Bacteria | 2996 |
| 331 | Ga0265320_10027755 | 3300031240 | Bacteria | 2947 |
| 332 | Ga0265320_10160543 | 3300031240 | Bacteria | 1012 |
| 333 | Ga0265320_10192108 | 3300031240 | Bacteria | 913 |
| 334 | Ga0265320_10341778 | 3300031240 | Bacteria | 661 |
| 335 | Ga0265325_10085582 | 3300031241 | Bacteria | 1561 |
| 336 | Ga0265325_10094847 | 3300031241 | Bacteria | 1467 |
| 337 | Ga0265329_10100357 | 3300031242 | Bacteria | 921 |
| 338 | Ga0265340_10000803 | 3300031247 | Bacteria | 17782 |
| 339 | Ga0265340_10027009 | 3300031247 | Bacteria | 2896 |
| 340 | Ga0265340_10057322 | 3300031247 | Bacteria | 1872 |
| 341 | Ga0265340_10063435 | 3300031247 | Bacteria | 1763 |
| 342 | Ga0265339_10014822 | 3300031249 | Bacteria | 4690 |
| 343 | Ga0265339_10024832 | 3300031249 | Bacteria | 3448 |
| 344 | Ga0265339_10025907 | 3300031249 | Bacteria | 3361 |
| 345 | Ga0265339_10296789 | 3300031249 | Bacteria | 771 |
| 346 | Ga0265339_10301890 | 3300031249 | Bacteria | 763 |
| 347 | Ga0265339_10345557 | 3300031249 | Bacteria | 702 |
| 348 | Ga0265331_10239305 | 3300031250 | Bacteria | 815 |
| 349 | Ga0265331_10259269 | 3300031250 | Bacteria | 780 |
| 350 | Ga0265327_10000752 | 3300031251 | Bacteria | 50420 |
| 351 | Ga0265327_10003972 | 3300031251 | Bacteria | 13497 |
| 352 | Ga0265327_10010095 | 3300031251 | Bacteria | 6695 |
| 353 | Ga0265327_10030353 | 3300031251 | Bacteria | 3058 |
| 354 | Ga0265316_10006885 | 3300031344 | Bacteria | 10789 |
| 355 | Ga0265316_10017515 | 3300031344 | Bacteria | 6187 |
| 356 | Ga0265316_10026957 | 3300031344 | Bacteria | 4769 |
| 357 | Ga0265316_10028132 | 3300031344 | Bacteria | 4640 |
| 358 | Ga0265316_10218174 | 3300031344 | Bacteria | 1408 |
| 359 | Ga0265316_10399473 | 3300031344 | Bacteria | 990 |
| 360 | Ga0265316_10484451 | 3300031344 | Bacteria | 885 |
| 361 | Ga0307408_100073609 | 3300031548 | Bacteria | 2533 |
| 362 | Ga0307408_100101694 | 3300031548 | Bacteria | 2191 |
| 363 | Ga0307408_100103521 | 3300031548 | Bacteria | 2173 |
| 364 | Ga0265313_10001008 | 3300031595 | Bacteria | 27543 |
| 365 | Ga0265313_10079892 | 3300031595 | Bacteria | 1487 |
| 366 | Ga0265313_10097366 | 3300031595 | Bacteria | 1311 |
| 367 | Ga0265313_10114218 | 3300031595 | Bacteria | 1184 |
| 368 | Ga0265313_10158762 | 3300031595 | Bacteria | 962 |
| 369 | Ga0265314_10004107 | 3300031711 | Bacteria | 13720 |
| 370 | Ga0265314_10014321 | 3300031711 | Bacteria | 6356 |
| 371 | Ga0265314_10046910 | 3300031711 | Bacteria | 3045 |
| 372 | Ga0265314_10299710 | 3300031711 | Bacteria | 902 |
| 373 | Ga0307405_10690205 | 3300031731 | Unclassified | 844 |
| 374 | Ga0316577_10193797 | 3300031733 | Bacteria | 1149 |
| 375 | Ga0307413_10023725 | 3300031824 | Bacteria | 3329 |
| 376 | Ga0307413_10181231 | 3300031824 | Bacteria | 1502 |
| 377 | Ga0307410_10020407 | 3300031852 | Bacteria | 4052 |
| 378 | Ga0307410_10109075 | 3300031852 | Bacteria | 2000 |
| 379 | Ga0307406_10017625 | 3300031901 | Bacteria | 4161 |
| 380 | Ga0307406_10116626 | 3300031901 | Bacteria | 1848 |
| 381 | Ga0307412_10046977 | 3300031911 | Bacteria | 2832 |
| 382 | Ga0307409_100022840 | 3300031995 | Bacteria | 4319 |
| 383 | Ga0307409_100156826 | 3300031995 | Bacteria | 1985 |
| 384 | Ga0307416_100009264 | 3300032002 | Bacteria | 6431 |
| 385 | Ga0307416_100208409 | 3300032002 | Bacteria | 1862 |
| 386 | Ga0307414_10015643 | 3300032004 | Bacteria | 4585 |
| 387 | Ga0307414_10017900 | 3300032004 | Bacteria | 4347 |
| 388 | Ga0307415_100064304 | 3300032126 | Bacteria | 2552 |
| 389 | Ga0307415_100073290 | 3300032126 | Bacteria | 2415 |
| 390 | Ga0373930_0021703 | 3300034816 | Bacteria | 1263 |
| 391 | Ga0373938_0020453 | 3300034957 | Bacteria | 1333 |
| 392 | Ga0373938_0026517 | 3300034957 | Bacteria | 1213 |
| 393 | Ga0373928_0000124 | 3300035084 | Bacteria | 14419 |
| 394 | Ga0373929_0006750 | 3300035085 | Bacteria | 2080 |
| 395 | Ga0373934_0070470 | 3300035086 | Bacteria | 1398 |
| 396 | Ga0373944_0001296 | 3300035089 | Bacteria | 6287 |
| 397 | Ga0373944_0229717 | 3300035089 | Bacteria | 680 |
| 398 | Ga0373949_0019648 | 3300035090 | Bacteria | 1540 |
| 399 | Ga0373951_0003865 | 3300035091 | Bacteria | 3600 |
| 400 | Ga0373923_0066729 | 3300035111 | Bacteria | 1538 |
| 401 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 402 | Ga0373932_0196402 | 3300035112 | Unclassified | 715 |
| 403 | Ga0373936_0154362 | 3300035113 | Bacteria | 997 |
| 404 | Ga0373939_0087473 | 3300035114 | Bacteria | 1047 |
| 405 | Ga0373945_0025773 | 3300035116 | Bacteria | 2045 |
| 406 | Ga0373945_0027439 | 3300035116 | Bacteria | 1989 |
| 407 | Ga0373953_0155983 | 3300035117 | Bacteria | 980 |
| 408 | Ga0373954_0003285 | 3300035118 | Bacteria | 6828 |
| 409 | Ga0373954_0068773 | 3300035118 | Bacteria | 1680 |
| 410 | Ga0373954_0070100 | 3300035118 | Bacteria | 1665 |
| 411 | Ga0373956_0057609 | 3300035119 | Bacteria | 1756 |
| 412 | Ga0373943_0187804 | 3300035170 | Bacteria | 1139 |
| 413 | Ga0373946_0115194 | 3300035171 | Bacteria | 1221 |
| 414 | Ga0373946_0187661 | 3300035171 | Unclassified | 984 |
| 415 | Ga0373955_0062252 | 3300035172 | Bacteria | 2063 |
| 416 | Ga0373955_0345438 | 3300035172 | Bacteria | 901 |
| 417 | Ga0373961_0045640 | 3300035241 | Bacteria | 1282 |
| 418 | Ga0373962_0000018 | 3300035242 | Bacteria | 47177 |
| 419 | Ga0373962_0076478 | 3300035242 | Bacteria | 1009 |
| 420 | Ga0373931_0000002 | 3300035691 | Bacteria | 599830 |
| 421 | Ga0373931_0005703 | 3300035691 | Bacteria | 5782 |
| 422 | Ga0373931_0107596 | 3300035691 | Bacteria | 1577 |
| 423 | Ga0373931_0271840 | 3300035691 | Bacteria | 1038 |
| 424 | Ga0373935_0091703 | 3300035692 | Bacteria | 1990 |
| 425 | Ga0373935_0392744 | 3300035692 | Bacteria | 995 |
| 426 | Ga0373935_0643648 | 3300035692 | Unclassified | 777 |
| 427 | Ga0373927_0026587 | 3300035695 | Bacteria | 3782 |
| 428 | Ga0373933_0764336 | 3300035724 | Unclassified | 636 |
| 429 | Ga0373947_0025116 | 3300035725 | Bacteria | 3474 |
| 430 | Ga0373947_0049735 | 3300035725 | Bacteria | 2518 |
| 431 | Ga0373937_0025480 | 3300036401 | Bacteria | 5338 |
| 432 | Ga0373937_0090294 | 3300036401 | Bacteria | 2837 |
| 433 | Ga0373925_0000552 | 3300037068 | Bacteria | 36801 |
| 434 | Ga0373925_0011834 | 3300037068 | Bacteria | 6313 |
| 435 | Ga0373925_0127189 | 3300037068 | Bacteria | 1983 |
| 436 | Ga0436361_0889442 | 3300039447 | Bacteria | 544 |
| 437 | Ga0451807_0982052 | 3300041486 | Bacteria | 1605 |
| 438 | Ga0439446_0280187 | 3300042156 | Unclassified | 581 |
| 439 | Ga0439444_0100589 | 3300042437 | Bacteria | 655 |
| 440 | Ga0451577_0008522 | 3300042876 | Bacteria | 9973 |
| 441 | Ga0451577_0064048 | 3300042876 | Bacteria | 3279 |
| 442 | Ga0451577_0150176 | 3300042876 | Bacteria | 2096 |
| 443 | Ga0451577_0963850 | 3300042876 | Bacteria | 767 |
| 444 | Ga0451577_1203803 | 3300042876 | Bacteria | 676 |
| 445 | Ga0466966_0094958 | 3300044684 | Bacteria | 1848 |
| 446 | Ga0453684_0002848 | 3300044712 | Bacteria | 40690 |
| 447 | Ga0453684_0006217 | 3300044712 | Bacteria | 22893 |
| 448 | Ga0453684_0009645 | 3300044712 | Bacteria | 16823 |
| 449 | Ga0453684_0650786 | 3300044712 | Bacteria | 1150 |
| 450 | Ga0453684_0741856 | 3300044712 | Bacteria | 1064 |
| 451 | Ga0453684_1257617 | 3300044712 | Unclassified | 774 |
| 452 | Ga0453684_1460504 | 3300044712 | Bacteria | 707 |
| 453 | Ga0453684_1861747 | 3300044712 | Bacteria | 610 |
| 454 | Ga0451576_0029877 | 3300045051 | Bacteria | 5830 |
| 455 | Ga0451576_0074622 | 3300045051 | Bacteria | 3530 |
| 456 | Ga0451576_0090765 | 3300045051 | Bacteria | 3178 |
| 457 | Ga0451576_0477792 | 3300045051 | Bacteria | 1309 |
| 458 | Ga0451576_0500750 | 3300045051 | Bacteria | 1276 |
| 459 | Ga0451576_0729402 | 3300045051 | Bacteria | 1041 |
| 460 | Ga0451576_0892923 | 3300045051 | Bacteria | 932 |
| 461 | Ga0451576_1051311 | 3300045051 | Bacteria | 853 |
| 462 | Ga0495592_0000023 | 3300046454 | Bacteria | 137490 |
| 463 | Ga0495592_0198406 | 3300046454 | Unclassified | 1356 |
| 464 | Ga0495592_0290727 | 3300046454 | Bacteria | 1065 |
| 465 | Ga0495629_0196643 | 3300046459 | Bacteria | 1394 |
| 466 | Ga0495580_0045476 | 3300046472 | Bacteria | 3118 |
| 467 | Ga0495580_0377969 | 3300046472 | Bacteria | 957 |
| 468 | Ga0495662_0005799 | 3300046476 | Bacteria | 6180 |
| 469 | Ga0495664_0042121 | 3300046477 | Bacteria | 2703 |
| 470 | Ga0495664_0364839 | 3300046477 | Bacteria | 869 |
| 471 | Ga0495608_0333478 | 3300046511 | Bacteria | 935 |
| 472 | Ga0495618_0002603 | 3300046514 | Bacteria | 11562 |
| 473 | Ga0495618_0002646 | 3300046514 | Bacteria | 11456 |
| 474 | Ga0495628_0005164 | 3300046516 | Bacteria | 11475 |
| 475 | Ga0495630_0017877 | 3300046517 | Bacteria | 5201 |
| 476 | Ga0495630_0029891 | 3300046517 | Bacteria | 4052 |
| 477 | Ga0495630_0085176 | 3300046517 | Bacteria | 2386 |
| 478 | Ga0495630_1180276 | 3300046517 | Unclassified | 579 |
| 479 | Ga0495666_0050773 | 3300046526 | Bacteria | 1993 |
| 480 | Ga0495666_0162477 | 3300046526 | Bacteria | 1035 |
| 481 | Ga0495652_0058251 | 3300046529 | Bacteria | 3272 |
| 482 | Ga0495652_0177386 | 3300046529 | Bacteria | 1639 |
| 483 | Ga0495652_0666337 | 3300046529 | Unclassified | 703 |
| 484 | Ga0495640_0006702 | 3300046533 | Bacteria | 9088 |
| 485 | Ga0495640_0189425 | 3300046533 | Bacteria | 1308 |
| 486 | Ga0495586_0001744 | 3300046535 | Bacteria | 11869 |
| 487 | Ga0495586_0002311 | 3300046535 | Bacteria | 10358 |
| 488 | Ga0495586_0650176 | 3300046535 | Unclassified | 609 |
| 489 | Ga0495586_0833867 | 3300046535 | Unclassified | 532 |
| 490 | Ga0495645_0013766 | 3300046543 | Bacteria | 5731 |
| 491 | Ga0495645_0320781 | 3300046543 | Bacteria | 1006 |
| 492 | Ga0495622_0256937 | 3300046557 | Bacteria | 767 |
| 493 | Ga0495667_0371595 | 3300046559 | Bacteria | 902 |
| 494 | Ga0495634_0002060 | 3300046642 | Bacteria | 17002 |
| 495 | Ga0495634_0333356 | 3300046642 | Bacteria | 911 |
| 496 | Ga0495635_0045785 | 3300046663 | Bacteria | 3018 |
| 497 | Ga0495599_0024402 | 3300046678 | Bacteria | 3781 |
| 498 | Ga0495599_0526627 | 3300046678 | Bacteria | 694 |
| 499 | Ga0495646_0154966 | 3300046680 | Bacteria | 1272 |
| 500 | Ga0495647_0014088 | 3300046681 | Bacteria | 2782 |
| 501 | Ga0495658_0100819 | 3300046683 | Unclassified | 1723 |
| 502 | Ga0495658_0506635 | 3300046683 | Bacteria | 772 |
| 503 | Ga0495613_0021151 | 3300046689 | Bacteria | 4851 |
| 504 | Ga0495674_0003916 | 3300047319 | Bacteria | 14458 |
| 505 | Ga0495674_0298603 | 3300047319 | Bacteria | 1316 |
| 506 | Ga0495674_0461380 | 3300047319 | Bacteria | 1020 |
| 507 | Ga0495680_0013067 | 3300047322 | Bacteria | 7262 |
| 508 | Ga0495675_0123348 | 3300047444 | Bacteria | 1613 |
| 509 | Ga0495684_0081704 | 3300047471 | Bacteria | 2452 |
| 510 | Ga0495684_0822836 | 3300047471 | Unclassified | 605 |
| 511 | Ga0496107_1015181 | 3300048910 | Unclassified | 602 |
| 512 | Ga0496112_0024139 | 3300048915 | Bacteria | 5819 |
| 513 | Ga0496113_0757783 | 3300048916 | Unclassified | 773 |
| 514 | Ga0496115_0009632 | 3300048918 | Bacteria | 7188 |
| 515 | Ga0496115_0633157 | 3300048918 | Bacteria | 847 |
| 516 | Ga0495682_0079226 | 3300049460 | Unclassified | 1182 |
| 517 | Ga0495682_0141220 | 3300049460 | Bacteria | 860 |
| 518 | Ga0501295_109821 | 3300049518 | Unclassified | 654 |
| 519 | Ga0501299_091844 | 3300049522 | Unclassified | 691 |
| 520 | Ga0501031_0009653 | 3300049568 | Bacteria | 6282 |
| 521 | Ga0501031_0014139 | 3300049568 | Bacteria | 5193 |
| 522 | Ga0501031_0077144 | 3300049568 | Bacteria | 2170 |
| 523 | Ga0501032_0001311 | 3300049569 | Bacteria | 19950 |
| 524 | Ga0501032_0016191 | 3300049569 | Bacteria | 5247 |
| 525 | Ga0501032_0291327 | 3300049569 | Unclassified | 1056 |
| 526 | Ga0501033_0019944 | 3300049570 | Bacteria | 5067 |
| 527 | Ga0501033_0032774 | 3300049570 | Bacteria | 3902 |
| 528 | Ga0501033_0033260 | 3300049570 | Bacteria | 3872 |
| 529 | Ga0501033_0035291 | 3300049570 | Bacteria | 3749 |
| 530 | Ga0501036_0022376 | 3300049572 | Bacteria | 5316 |
| 531 | Ga0501036_0091030 | 3300049572 | Bacteria | 2576 |
| 532 | Ga0501036_0660942 | 3300049572 | Bacteria | 865 |
| 533 | Ga0501036_1052451 | 3300049572 | Unclassified | 665 |
| 534 | Ga0501037_0006668 | 3300049573 | Bacteria | 8444 |
| 535 | Ga0501037_0013416 | 3300049573 | Bacteria | 6035 |
| 536 | Ga0501038_0000711 | 3300049574 | Bacteria | 29730 |
| 537 | Ga0501038_0076426 | 3300049574 | Bacteria | 2828 |
| 538 | Ga0501039_0000653 | 3300049575 | Bacteria | 25018 |
| 539 | Ga0501039_0048829 | 3300049575 | Bacteria | 3271 |
| 540 | Ga0501039_0072172 | 3300049575 | Bacteria | 2683 |
| 541 | Ga0501039_0714604 | 3300049575 | Bacteria | 783 |
| 542 | Ga0501040_0003940 | 3300049576 | Bacteria | 9635 |
| 543 | Ga0501040_0010864 | 3300049576 | Bacteria | 5952 |
| 544 | Ga0501040_1400912 | 3300049576 | Bacteria | 507 |
| 545 | Ga0501041_0003089 | 3300049577 | Bacteria | 9572 |
| 546 | Ga0501041_0045704 | 3300049577 | Bacteria | 2662 |
| 547 | Ga0501042_0000287 | 3300049578 | Bacteria | 24863 |
| 548 | Ga0501042_0038831 | 3300049578 | Bacteria | 3380 |
| 549 | Ga0501042_0976764 | 3300049578 | Bacteria | 617 |
| 550 | Ga0501043_0051520 | 3300049579 | Bacteria | 3234 |
| 551 | Ga0501043_0119866 | 3300049579 | Bacteria | 2063 |
| 552 | Ga0501043_0639110 | 3300049579 | Bacteria | 782 |
| 553 | Ga0501046_0004354 | 3300049580 | Bacteria | 12889 |
| 554 | Ga0501046_0054316 | 3300049580 | Bacteria | 3151 |
| 555 | Ga0501047_0328080 | 3300049581 | Bacteria | 1369 |
| 556 | Ga0501048_0005739 | 3300049582 | Bacteria | 9431 |
| 557 | Ga0501048_0061167 | 3300049582 | Bacteria | 2667 |
| 558 | Ga0501048_0477633 | 3300049582 | Bacteria | 893 |
| 559 | Ga0501067_0637780 | 3300049583 | Unclassified | 598 |
| 560 | Ga0501068_0061096 | 3300049584 | Bacteria | 2289 |
| 561 | Ga0501068_0099804 | 3300049584 | Bacteria | 1798 |
| 562 | Ga0501068_1023511 | 3300049584 | Unclassified | 545 |
| 563 | Ga0501070_0018565 | 3300049586 | Bacteria | 5834 |
| 564 | Ga0501071_0002376 | 3300049587 | Bacteria | 11401 |
| 565 | Ga0501071_0316429 | 3300049587 | Bacteria | 1185 |
| 566 | Ga0501071_0431543 | 3300049587 | Bacteria | 1007 |
| 567 | Ga0501072_0006216 | 3300049588 | Bacteria | 9093 |
| 568 | Ga0501072_0147828 | 3300049588 | Bacteria | 1873 |
| 569 | Ga0501073_0008091 | 3300049589 | Bacteria | 7801 |
| 570 | Ga0501073_0482742 | 3300049589 | Bacteria | 857 |
| 571 | Ga0501074_0103566 | 3300049590 | Bacteria | 2037 |
| 572 | Ga0501074_0142025 | 3300049590 | Bacteria | 1717 |
| 573 | Ga0501075_0004248 | 3300049591 | Bacteria | 9680 |
| 574 | Ga0501075_0030598 | 3300049591 | Bacteria | 3988 |
| 575 | Ga0501075_0036470 | 3300049591 | Bacteria | 3670 |
| 576 | Ga0501075_0270451 | 3300049591 | Bacteria | 1295 |
| 577 | Ga0501075_1469321 | 3300049591 | Unclassified | 516 |
| 578 | Ga0501076_0000283 | 3300049592 | Bacteria | 31600 |
| 579 | Ga0501076_0036684 | 3300049592 | Bacteria | 3841 |
| 580 | Ga0501076_0097683 | 3300049592 | Bacteria | 2366 |
| 581 | Ga0501076_0267881 | 3300049592 | Bacteria | 1399 |
| 582 | Ga0501076_0350441 | 3300049592 | Bacteria | 1212 |
| 583 | Ga0501077_0001639 | 3300049593 | Bacteria | 13451 |
| 584 | Ga0501077_0205099 | 3300049593 | Bacteria | 1252 |
| 585 | Ga0501209_063413 | 3300049656 | Bacteria | 1036 |
| 586 | Ga0501209_089932 | 3300049656 | Unclassified | 892 |
| 587 | Ga0501216_021464 | 3300049660 | Bacteria | 1135 |
| 588 | Ga0501079_0000512 | 3300049741 | Bacteria | 25207 |
| 589 | Ga0501079_0251077 | 3300049741 | Bacteria | 1382 |
| 590 | Ga0501079_1475788 | 3300049741 | Bacteria | 535 |
| 591 | Ga0501080_0009637 | 3300049742 | Bacteria | 8817 |
| 592 | Ga0501080_0056823 | 3300049742 | Bacteria | 3643 |
| 593 | Ga0501081_0003790 | 3300049743 | Bacteria | 9686 |
| 594 | Ga0501081_0120391 | 3300049743 | Bacteria | 1869 |
| 595 | Ga0501081_0164952 | 3300049743 | Bacteria | 1597 |
| 596 | Ga0501083_0076634 | 3300049744 | Bacteria | 2219 |
| 597 | Ga0501083_0764710 | 3300049744 | Bacteria | 628 |
| 598 | Ga0501265_060378 | 3300049762 | Bacteria | 618 |
| 599 | Ga0501035_0003191 | 3300049822 | Bacteria | 15717 |
| 600 | Ga0501035_0150953 | 3300049822 | Bacteria | 2016 |
| 601 | Ga0501044_0000125 | 3300049823 | Bacteria | 92969 |
| 602 | Ga0501044_0043199 | 3300049823 | Bacteria | 4684 |
| 603 | Ga0501044_0269897 | 3300049823 | Bacteria | 1637 |
| 604 | Ga0501045_0009849 | 3300049824 | Bacteria | 6687 |
| 605 | Ga0501045_0021456 | 3300049824 | Bacteria | 4619 |
| 606 | Ga0501045_0241307 | 3300049824 | Unclassified | 1345 |
| 607 | Ga0501045_1027930 | 3300049824 | Bacteria | 604 |
| 608 | nmdc:mga05p37_10647_c1 | 3300050507 | Bacteria | 10913 |
| 609 | nmdc:mga05p37_150462_c1 | 3300050507 | Bacteria | 2847 |
| 610 | nmdc:mga05p37_25264_c1 | 3300050507 | Bacteria | 7224 |
| 611 | nmdc:mga05p37_304073_c1 | 3300050507 | Bacteria | 1894 |
| 612 | nmdc:mga05p37_426191_c1 | 3300050507 | Bacteria | 1543 |
| 613 | nmdc:mga05p37_432054_c1 | 3300050507 | Bacteria | 1530 |
| 614 | nmdc:mga05p37_479207_c1 | 3300050507 | Bacteria | 1434 |
| 615 | nmdc:mga05p37_591405_c1 | 3300050507 | Bacteria | 1254 |
| 616 | nmdc:mga05p37_776902_c1 | 3300050507 | Bacteria | 1052 |
| 617 | nmdc:mga05p37_82057_c1 | 3300050507 | Bacteria | 3972 |
| 618 | nmdc:mga09592_175584_c1 | 3300050508 | Bacteria | 1853 |
| 619 | nmdc:mga09592_281741_c1 | 3300050508 | Bacteria | 1442 |
| 620 | nmdc:mga09592_40252_c1 | 3300050508 | Bacteria | 3926 |
| 621 | nmdc:mga09592_930559_c1 | 3300050508 | Bacteria | 729 |
| 622 | nmdc:mga0qj67_391149_c1 | 3300050509 | Bacteria | 1122 |
| 623 | nmdc:mga0qj67_414230_c1 | 3300050509 | Unclassified | 1087 |
| 624 | nmdc:mga0qj67_43185_c1 | 3300050509 | Bacteria | 3550 |
| 625 | nmdc:mga0qj67_60441_c1 | 3300050509 | Bacteria | 3007 |
| 626 | nmdc:mga0qj67_63601_c1 | 3300050509 | Bacteria | 2934 |
| 627 | nmdc:mga06r32_1007073_c1 | 3300050510 | Unclassified | 786 |
| 628 | nmdc:mga06r32_190624_c1 | 3300050510 | Bacteria | 2038 |
| 629 | nmdc:mga06r32_58404_c1 | 3300050510 | Bacteria | 3708 |
| 630 | nmdc:mga06r32_66135_c1 | 3300050510 | Bacteria | 3488 |
| 631 | nmdc:mga08y16_1151042_c1 | 3300050511 | Unclassified | 748 |
| 632 | nmdc:mga08y16_21179_c1 | 3300050511 | Bacteria | 6865 |
| 633 | nmdc:mga08y16_44782_c1 | 3300050511 | Bacteria | 4638 |
| 634 | nmdc:mga08y16_581182_c1 | 3300050511 | Bacteria | 1131 |
| 635 | nmdc:mga0n895_1236867_c1 | 3300050512 | Unclassified | 720 |
| 636 | nmdc:mga0n895_29629_c1 | 3300050512 | Bacteria | 5224 |
| 637 | nmdc:mga0n895_375008_c1 | 3300050512 | Unclassified | 1440 |
| 638 | nmdc:mga0n895_65874_c1 | 3300050512 | Bacteria | 3587 |
| 639 | nmdc:mga0rr50_103572_c1 | 3300050513 | Bacteria | 2240 |
| 640 | nmdc:mga0rr50_1281606_c1 | 3300050513 | Unclassified | 622 |
| 641 | nmdc:mga0rr50_129206_c1 | 3300050513 | Bacteria | 2021 |
| 642 | nmdc:mga0rr50_288139_c1 | 3300050513 | Bacteria | 1371 |
| 643 | nmdc:mga0rr50_549190_c1 | 3300050513 | Bacteria | 984 |
| 644 | nmdc:mga0rr50_807610_c1 | 3300050513 | Unclassified | 800 |
| 645 | nmdc:mga0rr50_820901_c1 | 3300050513 | Bacteria | 793 |
| 646 | nmdc:mga0rr50_9440_c1 | 3300050513 | Bacteria | 6133 |
| 647 | nmdc:mga08x19_179094_c1 | 3300050514 | Bacteria | 1446 |
| 648 | nmdc:mga08x19_31519_c1 | 3300050514 | Bacteria | 3335 |
| 649 | nmdc:mga08x19_707980_c1 | 3300050514 | Bacteria | 715 |
| 650 | nmdc:mga08x19_710374_c1 | 3300050514 | Bacteria | 713 |
| 651 | nmdc:mga0a205_118432_c1 | 3300050515 | Bacteria | 2547 |
| 652 | nmdc:mga0a205_129445_c1 | 3300050515 | Bacteria | 2425 |
| 653 | nmdc:mga0a205_363_c1 | 3300050515 | Bacteria | 34199 |
| 654 | nmdc:mga0a205_3769_c1 | 3300050515 | Bacteria | 13565 |
| 655 | nmdc:mga0a205_57041_c1 | 3300050515 | Bacteria | 3771 |
| 656 | nmdc:mga0a205_604531_c1 | 3300050515 | Unclassified | 950 |
| 657 | nmdc:mga0a205_66355_c1 | 3300050515 | Bacteria | 3487 |
| 658 | Ga0501084_0021601 | 3300054114 | Bacteria | 5366 |
| 659 | Ga0501084_0172491 | 3300054114 | Bacteria | 1826 |
| 660 | Ga0501084_0239772 | 3300054114 | Bacteria | 1530 |
| 661 | Ga0590075_004941 | 3300059424 | Bacteria | 3152 |
| 662 | Ga0501082_0003633 | 3300060353 | Bacteria | 13476 |
| 663 | Ga0501082_0051809 | 3300060353 | Bacteria | 3537 |
| 664 | Ga0501082_0198922 | 3300060353 | Bacteria | 1743 |
| 665 | Ga0501082_0241257 | 3300060353 | Bacteria | 1573 |
| 666 | Ga0501082_1919262 | 3300060353 | Bacteria | 516 |
| 667 | Ga0530510_0035010 | 3300061734 | Bacteria | 3618 |
| 668 | Ga0530510_0136733 | 3300061734 | Bacteria | 1804 |
| 669 | Ga0530510_0222989 | 3300061734 | Bacteria | 1401 |
| 670 | Ga0530510_0281175 | 3300061734 | Bacteria | 1243 |
| 671 | Ga0530510_0381789 | 3300061734 | Bacteria | 1060 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003911 | JGI25405J52794_10000874 | JGI25405J52794_100008744 | 157 |
| 2 | 3300005276 | Ga0065717_1010041 | Ga0065717_10100411 | 157 |
| 3 | 3300005289 | Ga0065704_10008073 | Ga0065704_100080734 | 157 |
| 4 | 3300005289 | Ga0065704_10374914 | Ga0065704_103749141 | 157 |
| 5 | 3300005293 | Ga0065715_10102569 | Ga0065715_101025693 | 157 |
| 6 | 3300005295 | Ga0065707_10003878 | Ga0065707_100038784 | 157 |
| 7 | 3300005295 | Ga0065707_10092570 | Ga0065707_100925703 | 157 |
| 8 | 3300005328 | Ga0070676_10076976 | Ga0070676_100769762 | 157 |
| 9 | 3300005329 | Ga0070683_101652396 | Ga0070683_1016523961 | 157 |
| 10 | 3300005330 | Ga0070690_100332723 | Ga0070690_1003327232 | 157 |
| 11 | 3300005336 | Ga0070680_100007262 | Ga0070680_1000072627 | 157 |
| 12 | 3300005339 | Ga0070660_100021860 | Ga0070660_1000218603 | 157 |
| 13 | 3300005339 | Ga0070660_100171307 | Ga0070660_1001713072 | 157 |
| 14 | 3300005344 | Ga0070661_100426779 | Ga0070661_1004267792 | 157 |
| 15 | 3300005347 | Ga0070668_100182326 | Ga0070668_1001823262 | 157 |
| 16 | 3300005354 | Ga0070675_100705311 | Ga0070675_1007053111 | 157 |
| 17 | 3300005355 | Ga0070671_100214335 | Ga0070671_1002143352 | 157 |
| 18 | 3300005356 | Ga0070674_100834819 | Ga0070674_1008348191 | 157 |
| 19 | 3300005366 | Ga0070659_100116680 | Ga0070659_1001166802 | 157 |
| 20 | 3300005366 | Ga0070659_100718977 | Ga0070659_1007189772 | 157 |
| 21 | 3300005366 | Ga0070659_101458029 | Ga0070659_1014580291 | 157 |
| 22 | 3300005455 | Ga0070663_100224172 | Ga0070663_1002241721 | 157 |
| 23 | 3300005457 | Ga0070662_100029032 | Ga0070662_1000290322 | 157 |
| 24 | 3300005457 | Ga0070662_100228859 | Ga0070662_1002288592 | 157 |
| 25 | 3300005458 | Ga0070681_10580972 | Ga0070681_105809722 | 157 |
| 26 | 3300005467 | Ga0070706_100169487 | Ga0070706_1001694873 | 157 |
| 27 | 3300005468 | Ga0070707_100797031 | Ga0070707_1007970312 | 157 |
| 28 | 3300005471 | Ga0070698_100200378 | Ga0070698_1002003782 | 157 |
| 29 | 3300005518 | Ga0070699_100137384 | Ga0070699_1001373843 | 157 |
| 30 | 3300005518 | Ga0070699_101080395 | Ga0070699_1010803951 | 157 |
| 31 | 3300005530 | Ga0070679_100163077 | Ga0070679_1001630772 | 157 |
| 32 | 3300005530 | Ga0070679_100768301 | Ga0070679_1007683012 | 157 |
| 33 | 3300005536 | Ga0070697_100013638 | Ga0070697_1000136382 | 157 |
| 34 | 3300005543 | Ga0070672_100378047 | Ga0070672_1003780472 | 157 |
| 35 | 3300005544 | Ga0070686_100387757 | Ga0070686_1003877572 | 157 |
| 36 | 3300005546 | Ga0070696_100557346 | Ga0070696_1005573462 | 157 |
| 37 | 3300005549 | Ga0070704_100665055 | Ga0070704_1006650552 | 157 |
| 38 | 3300005563 | Ga0068855_100132174 | Ga0068855_1001321742 | 157 |
| 39 | 3300005564 | Ga0070664_100004565 | Ga0070664_1000045659 | 157 |
| 40 | 3300005564 | Ga0070664_100329546 | Ga0070664_1003295462 | 157 |
| 41 | 3300005614 | Ga0068856_101580387 | Ga0068856_1015803871 | 157 |
| 42 | 3300005617 | Ga0068859_100553504 | Ga0068859_1005535042 | 157 |
| 43 | 3300005840 | Ga0068870_10235917 | Ga0068870_102359172 | 157 |
| 44 | 3300005843 | Ga0068860_100642649 | Ga0068860_1006426492 | 157 |
| 45 | 3300005937 | Ga0081455_10000067 | Ga0081455_10000067104 | 157 |
| 46 | 3300005981 | Ga0081538_10026589 | Ga0081538_100265892 | 157 |
| 47 | 3300006163 | Ga0070715_10276745 | Ga0070715_102767452 | 157 |
| 48 | 3300006173 | Ga0070716_100038753 | Ga0070716_1000387534 | 157 |
| 49 | 3300006844 | Ga0075428_100033541 | Ga0075428_1000335416 | 157 |
| 50 | 3300006844 | Ga0075428_100785356 | Ga0075428_1007853562 | 157 |
| 51 | 3300006844 | Ga0075428_100803318 | Ga0075428_1008033182 | 157 |
| 52 | 3300006844 | Ga0075428_101394360 | Ga0075428_1013943601 | 157 |
| 53 | 3300006844 | Ga0075428_102219524 | Ga0075428_1022195241 | 157 |
| 54 | 3300006846 | Ga0075430_100022482 | Ga0075430_1000224822 | 157 |
| 55 | 3300006846 | Ga0075430_100064532 | Ga0075430_1000645324 | 157 |
| 56 | 3300006846 | Ga0075430_100336789 | Ga0075430_1003367891 | 157 |
| 57 | 3300006846 | Ga0075430_100561865 | Ga0075430_1005618651 | 157 |
| 58 | 3300006846 | Ga0075430_100602377 | Ga0075430_1006023772 | 157 |
| 59 | 3300006847 | Ga0075431_100045936 | Ga0075431_1000459362 | 157 |
| 60 | 3300006847 | Ga0075431_100128194 | Ga0075431_1001281942 | 157 |
| 61 | 3300006847 | Ga0075431_100223521 | Ga0075431_1002235212 | 157 |
| 62 | 3300006847 | Ga0075431_100814038 | Ga0075431_1008140382 | 157 |
| 63 | 3300006852 | Ga0075433_10000198 | Ga0075433_1000019814 | 157 |
| 64 | 3300006852 | Ga0075433_10006171 | Ga0075433_100061712 | 157 |
| 65 | 3300006852 | Ga0075433_10144946 | Ga0075433_101449463 | 157 |
| 66 | 3300006852 | Ga0075433_10606409 | Ga0075433_106064092 | 157 |
| 67 | 3300006871 | Ga0075434_100000499 | Ga0075434_10000049914 | 157 |
| 68 | 3300006871 | Ga0075434_100035710 | Ga0075434_1000357102 | 157 |
| 69 | 3300006871 | Ga0075434_100065270 | Ga0075434_1000652703 | 157 |
| 70 | 3300006871 | Ga0075434_100106881 | Ga0075434_1001068813 | 157 |
| 71 | 3300006871 | Ga0075434_101203975 | Ga0075434_1012039751 | 157 |
| 72 | 3300006880 | Ga0075429_100015520 | Ga0075429_1000155206 | 157 |
| 73 | 3300006880 | Ga0075429_100103703 | Ga0075429_1001037033 | 157 |
| 74 | 3300006880 | Ga0075429_100202317 | Ga0075429_1002023172 | 157 |
| 75 | 3300006880 | Ga0075429_100351730 | Ga0075429_1003517302 | 157 |
| 76 | 3300006880 | Ga0075429_100352545 | Ga0075429_1003525452 | 157 |
| 77 | 3300006880 | Ga0075429_100790680 | Ga0075429_1007906801 | 157 |
| 78 | 3300006880 | Ga0075429_100914938 | Ga0075429_1009149382 | 157 |
| 79 | 3300006914 | Ga0075436_100747602 | Ga0075436_1007476021 | 157 |
| 80 | 3300006914 | Ga0075436_100768047 | Ga0075436_1007680472 | 157 |
| 81 | 3300006914 | Ga0075436_100869000 | Ga0075436_1008690002 | 157 |
| 82 | 3300006931 | Ga0097620_100553453 | Ga0097620_1005534532 | 157 |
| 83 | 3300007076 | Ga0075435_100015294 | Ga0075435_1000152942 | 157 |
| 84 | 3300007076 | Ga0075435_100063745 | Ga0075435_1000637452 | 157 |
| 85 | 3300007076 | Ga0075435_100103969 | Ga0075435_1001039692 | 157 |
| 86 | 3300007076 | Ga0075435_100353956 | Ga0075435_1003539562 | 157 |
| 87 | 3300007076 | Ga0075435_100918035 | Ga0075435_1009180351 | 157 |
| 88 | 3300009093 | Ga0105240_11380586 | Ga0105240_113805861 | 157 |
| 89 | 3300009094 | Ga0111539_10737525 | Ga0111539_107375252 | 157 |
| 90 | 3300009147 | Ga0114129_10147465 | Ga0114129_101474652 | 157 |
| 91 | 3300009147 | Ga0114129_10929001 | Ga0114129_109290012 | 157 |
| 92 | 3300009147 | Ga0114129_11497166 | Ga0114129_114971662 | 157 |
| 93 | 3300009148 | Ga0105243_10809286 | Ga0105243_108092862 | 157 |
| 94 | 3300009545 | Ga0105237_10207788 | Ga0105237_102077882 | 157 |
| 95 | 3300009553 | Ga0105249_10330705 | Ga0105249_103307052 | 157 |
| 96 | 3300010375 | Ga0105239_11393119 | Ga0105239_113931191 | 157 |
| 97 | 3300011119 | Ga0105246_10158891 | Ga0105246_101588912 | 157 |
| 98 | 3300013297 | Ga0157378_10101242 | Ga0157378_101012423 | 157 |
| 99 | 3300013297 | Ga0157378_10294608 | Ga0157378_102946082 | 157 |
| 100 | 3300013297 | Ga0157378_10404458 | Ga0157378_104044581 | 157 |
| 101 | 3300013306 | Ga0163162_10065901 | Ga0163162_100659014 | 157 |
| 102 | 3300013308 | Ga0157375_10855522 | Ga0157375_108555222 | 157 |
| 103 | 3300025907 | Ga0207645_10109541 | Ga0207645_101095412 | 157 |
| 104 | 3300025912 | Ga0207707_10002190 | Ga0207707_1000219011 | 157 |
| 105 | 3300025912 | Ga0207707_10003311 | Ga0207707_100033112 | 157 |
| 106 | 3300025917 | Ga0207660_10002204 | Ga0207660_1000220410 | 157 |
| 107 | 3300025917 | Ga0207660_10020490 | Ga0207660_100204902 | 157 |
| 108 | 3300025917 | Ga0207660_10327971 | Ga0207660_103279712 | 157 |
| 109 | 3300025919 | Ga0207657_10072423 | Ga0207657_100724233 | 157 |
| 110 | 3300025920 | Ga0207649_10177455 | Ga0207649_101774551 | 157 |
| 111 | 3300025921 | Ga0207652_10010626 | Ga0207652_100106267 | 157 |
| 112 | 3300025921 | Ga0207652_10131207 | Ga0207652_101312072 | 157 |
| 113 | 3300025922 | Ga0207646_10231723 | Ga0207646_102317232 | 157 |
| 114 | 3300025923 | Ga0207681_10329627 | Ga0207681_103296271 | 157 |
| 115 | 3300025925 | Ga0207650_10001410 | Ga0207650_1000141018 | 157 |
| 116 | 3300025931 | Ga0207644_10066257 | Ga0207644_100662573 | 157 |
| 117 | 3300025932 | Ga0207690_10004342 | Ga0207690_100043424 | 157 |
| 118 | 3300025933 | Ga0207706_10138572 | Ga0207706_101385722 | 157 |
| 119 | 3300025933 | Ga0207706_10236887 | Ga0207706_102368872 | 157 |
| 120 | 3300025936 | Ga0207670_10055093 | Ga0207670_100550932 | 157 |
| 121 | 3300025937 | Ga0207669_10680684 | Ga0207669_106806842 | 157 |
| 122 | 3300025938 | Ga0207704_10122382 | Ga0207704_101223822 | 157 |
| 123 | 3300025944 | Ga0207661_10376835 | Ga0207661_103768351 | 157 |
| 124 | 3300025945 | Ga0207679_10007766 | Ga0207679_100077667 | 157 |
| 125 | 3300025972 | Ga0207668_10474681 | Ga0207668_104746812 | 157 |
| 126 | 3300026067 | Ga0207678_10018177 | Ga0207678_100181772 | 157 |
| 127 | 3300026121 | Ga0207683_10147110 | Ga0207683_101471102 | 157 |
| 128 | 3300027617 | Ga0210002_1057893 | Ga0210002_10578931 | 157 |
| 129 | 3300027682 | Ga0209971_1012080 | Ga0209971_10120802 | 157 |
| 130 | 3300027876 | Ga0209974_10002328 | Ga0209974_100023285 | 157 |
| 131 | 3300027907 | Ga0207428_10013239 | Ga0207428_100132395 | 157 |
| 132 | 3300028381 | Ga0268264_10452395 | Ga0268264_104523952 | 157 |
| 133 | 3300031548 | Ga0307408_100073609 | Ga0307408_1000736092 | 157 |
| 134 | 3300031548 | Ga0307408_100101694 | Ga0307408_1001016942 | 157 |
| 135 | 3300031548 | Ga0307408_100103521 | Ga0307408_1001035212 | 157 |
| 136 | 3300031731 | Ga0307405_10690205 | Ga0307405_106902052 | 157 |
| 137 | 3300031824 | Ga0307413_10023725 | Ga0307413_100237252 | 157 |
| 138 | 3300031824 | Ga0307413_10181231 | Ga0307413_101812311 | 157 |
| 139 | 3300031852 | Ga0307410_10020407 | Ga0307410_100204073 | 157 |
| 140 | 3300031852 | Ga0307410_10109075 | Ga0307410_101090752 | 157 |
| 141 | 3300031901 | Ga0307406_10017625 | Ga0307406_100176253 | 157 |
| 142 | 3300031901 | Ga0307406_10116626 | Ga0307406_101166261 | 157 |
| 143 | 3300031911 | Ga0307412_10046977 | Ga0307412_100469773 | 157 |
| 144 | 3300031995 | Ga0307409_100022840 | Ga0307409_1000228403 | 157 |
| 145 | 3300031995 | Ga0307409_100156826 | Ga0307409_1001568262 | 157 |
| 146 | 3300032002 | Ga0307416_100009264 | Ga0307416_1000092643 | 157 |
| 147 | 3300032002 | Ga0307416_100208409 | Ga0307416_1002084091 | 157 |
| 148 | 3300032004 | Ga0307414_10015643 | Ga0307414_100156433 | 157 |
| 149 | 3300032004 | Ga0307414_10017900 | Ga0307414_100179002 | 157 |
| 150 | 3300032126 | Ga0307415_100064304 | Ga0307415_1000643043 | 157 |
| 151 | 3300032126 | Ga0307415_100073290 | Ga0307415_1000732903 | 157 |
| 152 | 3300035089 | Ga0373944_0229717 | Ga0373944_0229717_19_492 | 157 |
| 153 | 3300035112 | Ga0373932_0196402 | Ga0373932_0196402_30_503 | 157 |
| 154 | 3300035114 | Ga0373939_0087473 | Ga0373939_0087473_10_483 | 157 |
| 155 | 3300035116 | Ga0373945_0025773 | Ga0373945_0025773_254_727 | 157 |
| 156 | 3300035119 | Ga0373956_0057609 | Ga0373956_0057609_695_1168 | 157 |
| 157 | 3300035170 | Ga0373943_0187804 | Ga0373943_0187804_338_811 | 157 |
| 158 | 3300035242 | Ga0373962_0076478 | Ga0373962_0076478_499_972 | 157 |
| 159 | 3300035691 | Ga0373931_0005703 | Ga0373931_0005703_63_536 | 157 |
| 160 | 3300035691 | Ga0373931_0107596 | Ga0373931_0107596_295_867 | 157 |
| 161 | 3300035692 | Ga0373935_0392744 | Ga0373935_0392744_473_946 | 157 |
| 162 | 3300035725 | Ga0373947_0025116 | Ga0373947_0025116_2298_2771 | 157 |
| 163 | 3300036401 | Ga0373937_0090294 | Ga0373937_0090294_2326_2799 | 157 |
| 164 | 3300037068 | Ga0373925_0127189 | Ga0373925_0127189_980_1453 | 157 |
| 165 | 3300042156 | Ga0439446_0280187 | Ga0439446_0280187_80_553 | 157 |
| 166 | 3300042437 | Ga0439444_0100589 | Ga0439444_0100589_64_537 | 157 |
| 167 | 3300042876 | Ga0451577_0963850 | Ga0451577_0963850_183_659 | 157 |
| 168 | 3300042876 | Ga0451577_1203803 | Ga0451577_1203803_131_607 | 157 |
| 169 | 3300044712 | Ga0453684_1257617 | Ga0453684_1257617_225_698 | 157 |
| 170 | 3300045051 | Ga0451576_0477792 | Ga0451576_0477792_371_844 | 157 |
| 171 | 3300045051 | Ga0451576_0892923 | Ga0451576_0892923_373_846 | 157 |
| 172 | 3300046472 | Ga0495580_0045476 | Ga0495580_0045476_2345_2818 | 157 |
| 173 | 3300048910 | Ga0496107_1015181 | Ga0496107_1015181_60_533 | 157 |
| 174 | 3300048915 | Ga0496112_0024139 | Ga0496112_0024139_121_594 | 157 |
| 175 | 3300048916 | Ga0496113_0757783 | Ga0496113_0757783_167_640 | 157 |
| 176 | 3300049518 | Ga0501295_109821 | Ga0501295_109821_158_631 | 157 |
| 177 | 3300049522 | Ga0501299_091844 | Ga0501299_091844_170_643 | 157 |
| 178 | 3300049568 | Ga0501031_0014139 | Ga0501031_0014139_2864_3337 | 157 |
| 179 | 3300049568 | Ga0501031_0077144 | Ga0501031_0077144_490_963 | 157 |
| 180 | 3300049569 | Ga0501032_0016191 | Ga0501032_0016191_3114_3587 | 157 |
| 181 | 3300049569 | Ga0501032_0291327 | Ga0501032_0291327_140_613 | 157 |
| 182 | 3300049570 | Ga0501033_0032774 | Ga0501033_0032774_149_622 | 157 |
| 183 | 3300049570 | Ga0501033_0035291 | Ga0501033_0035291_806_1279 | 157 |
| 184 | 3300049572 | Ga0501036_0022376 | Ga0501036_0022376_111_584 | 157 |
| 185 | 3300049572 | Ga0501036_0091030 | Ga0501036_0091030_1033_1506 | 157 |
| 186 | 3300049572 | Ga0501036_0660942 | Ga0501036_0660942_122_595 | 157 |
| 187 | 3300049572 | Ga0501036_1052451 | Ga0501036_1052451_117_590 | 157 |
| 188 | 3300049573 | Ga0501037_0006668 | Ga0501037_0006668_5723_6196 | 157 |
| 189 | 3300049574 | Ga0501038_0000711 | Ga0501038_0000711_12171_12644 | 157 |
| 190 | 3300049574 | Ga0501038_0076426 | Ga0501038_0076426_1777_2250 | 157 |
| 191 | 3300049575 | Ga0501039_0000653 | Ga0501039_0000653_5250_5723 | 157 |
| 192 | 3300049575 | Ga0501039_0048829 | Ga0501039_0048829_1923_2396 | 157 |
| 193 | 3300049576 | Ga0501040_0003940 | Ga0501040_0003940_5199_5672 | 157 |
| 194 | 3300049576 | Ga0501040_0010864 | Ga0501040_0010864_3119_3592 | 157 |
| 195 | 3300049576 | Ga0501040_1400912 | Ga0501040_1400912_14_487 | 157 |
| 196 | 3300049577 | Ga0501041_0003089 | Ga0501041_0003089_5239_5712 | 157 |
| 197 | 3300049577 | Ga0501041_0045704 | Ga0501041_0045704_1874_2347 | 157 |
| 198 | 3300049578 | Ga0501042_0000287 | Ga0501042_0000287_937_1410 | 157 |
| 199 | 3300049578 | Ga0501042_0038831 | Ga0501042_0038831_2857_3330 | 157 |
| 200 | 3300049578 | Ga0501042_0976764 | Ga0501042_0976764_110_589 | 157 |
| 201 | 3300049579 | Ga0501043_0051520 | Ga0501043_0051520_1592_2065 | 157 |
| 202 | 3300049579 | Ga0501043_0119866 | Ga0501043_0119866_240_713 | 157 |
| 203 | 3300049580 | Ga0501046_0004354 | Ga0501046_0004354_12236_12709 | 157 |
| 204 | 3300049580 | Ga0501046_0054316 | Ga0501046_0054316_1931_2404 | 157 |
| 205 | 3300049581 | Ga0501047_0328080 | Ga0501047_0328080_112_585 | 157 |
| 206 | 3300049582 | Ga0501048_0005739 | Ga0501048_0005739_51_524 | 157 |
| 207 | 3300049582 | Ga0501048_0061167 | Ga0501048_0061167_1398_1871 | 157 |
| 208 | 3300049582 | Ga0501048_0477633 | Ga0501048_0477633_350_823 | 157 |
| 209 | 3300049583 | Ga0501067_0637780 | Ga0501067_0637780_63_536 | 157 |
| 210 | 3300049584 | Ga0501068_0061096 | Ga0501068_0061096_1474_1947 | 157 |
| 211 | 3300049584 | Ga0501068_0099804 | Ga0501068_0099804_875_1348 | 157 |
| 212 | 3300049584 | Ga0501068_1023511 | Ga0501068_1023511_51_524 | 157 |
| 213 | 3300049586 | Ga0501070_0018565 | Ga0501070_0018565_2658_3131 | 157 |
| 214 | 3300049587 | Ga0501071_0002376 | Ga0501071_0002376_10750_11223 | 157 |
| 215 | 3300049587 | Ga0501071_0316429 | Ga0501071_0316429_118_591 | 157 |
| 216 | 3300049587 | Ga0501071_0431543 | Ga0501071_0431543_272_745 | 157 |
| 217 | 3300049588 | Ga0501072_0006216 | Ga0501072_0006216_5221_5694 | 157 |
| 218 | 3300049588 | Ga0501072_0147828 | Ga0501072_0147828_1308_1781 | 157 |
| 219 | 3300049589 | Ga0501073_0008091 | Ga0501073_0008091_2717_3190 | 157 |
| 220 | 3300049590 | Ga0501074_0103566 | Ga0501074_0103566_817_1290 | 157 |
| 221 | 3300049590 | Ga0501074_0142025 | Ga0501074_0142025_1183_1656 | 157 |
| 222 | 3300049591 | Ga0501075_0004248 | Ga0501075_0004248_3964_4437 | 157 |
| 223 | 3300049591 | Ga0501075_0030598 | Ga0501075_0030598_247_720 | 157 |
| 224 | 3300049591 | Ga0501075_0036470 | Ga0501075_0036470_1994_2467 | 157 |
| 225 | 3300049591 | Ga0501075_0270451 | Ga0501075_0270451_156_629 | 157 |
| 226 | 3300049591 | Ga0501075_1469321 | Ga0501075_1469321_25_498 | 157 |
| 227 | 3300049592 | Ga0501076_0000283 | Ga0501076_0000283_25058_25531 | 157 |
| 228 | 3300049592 | Ga0501076_0036684 | Ga0501076_0036684_1777_2250 | 157 |
| 229 | 3300049592 | Ga0501076_0097683 | Ga0501076_0097683_692_1165 | 157 |
| 230 | 3300049592 | Ga0501076_0267881 | Ga0501076_0267881_889_1362 | 157 |
| 231 | 3300049592 | Ga0501076_0350441 | Ga0501076_0350441_423_896 | 157 |
| 232 | 3300049593 | Ga0501077_0001639 | Ga0501077_0001639_7729_8202 | 157 |
| 233 | 3300049593 | Ga0501077_0205099 | Ga0501077_0205099_182_655 | 157 |
| 234 | 3300049656 | Ga0501209_063413 | Ga0501209_063413_196_669 | 157 |
| 235 | 3300049656 | Ga0501209_089932 | Ga0501209_089932_239_712 | 157 |
| 236 | 3300049660 | Ga0501216_021464 | Ga0501216_021464_474_947 | 157 |
| 237 | 3300049741 | Ga0501079_0000512 | Ga0501079_0000512_7648_8121 | 157 |
| 238 | 3300049741 | Ga0501079_0251077 | Ga0501079_0251077_34_507 | 157 |
| 239 | 3300049741 | Ga0501079_1475788 | Ga0501079_1475788_12_485 | 157 |
| 240 | 3300049742 | Ga0501080_0009637 | Ga0501080_0009637_7228_7701 | 157 |
| 241 | 3300049742 | Ga0501080_0056823 | Ga0501080_0056823_618_1091 | 157 |
| 242 | 3300049743 | Ga0501081_0003790 | Ga0501081_0003790_5250_5723 | 157 |
| 243 | 3300049743 | Ga0501081_0120391 | Ga0501081_0120391_196_669 | 157 |
| 244 | 3300049743 | Ga0501081_0164952 | Ga0501081_0164952_182_655 | 157 |
| 245 | 3300049744 | Ga0501083_0076634 | Ga0501083_0076634_1183_1656 | 157 |
| 246 | 3300049744 | Ga0501083_0764710 | Ga0501083_0764710_101_574 | 157 |
| 247 | 3300049762 | Ga0501265_060378 | Ga0501265_060378_16_489 | 157 |
| 248 | 3300049822 | Ga0501035_0150953 | Ga0501035_0150953_486_959 | 157 |
| 249 | 3300049823 | Ga0501044_0043199 | Ga0501044_0043199_1556_2029 | 157 |
| 250 | 3300049824 | Ga0501045_0009849 | Ga0501045_0009849_1004_1477 | 157 |
| 251 | 3300049824 | Ga0501045_0021456 | Ga0501045_0021456_2522_2995 | 157 |
| 252 | 3300049824 | Ga0501045_0241307 | Ga0501045_0241307_813_1286 | 157 |
| 253 | 3300049824 | Ga0501045_1027930 | Ga0501045_1027930_54_527 | 157 |
| 254 | 3300050507 | nmdc:mga05p37_10647_c1 | nmdc:mga05p37_10647_c1_10118_10591 | 157 |
| 255 | 3300050507 | nmdc:mga05p37_150462_c1 | nmdc:mga05p37_150462_c1_407_886 | 157 |
| 256 | 3300050507 | nmdc:mga05p37_25264_c1 | nmdc:mga05p37_25264_c1_1373_1846 | 157 |
| 257 | 3300050507 | nmdc:mga05p37_304073_c1 | nmdc:mga05p37_304073_c1_1359_1832 | 157 |
| 258 | 3300050507 | nmdc:mga05p37_426191_c1 | nmdc:mga05p37_426191_c1_831_1304 | 157 |
| 259 | 3300050507 | nmdc:mga05p37_432054_c1 | nmdc:mga05p37_432054_c1_166_639 | 157 |
| 260 | 3300050507 | nmdc:mga05p37_479207_c1 | nmdc:mga05p37_479207_c1_912_1385 | 157 |
| 261 | 3300050507 | nmdc:mga05p37_591405_c1 | nmdc:mga05p37_591405_c1_179_652 | 157 |
| 262 | 3300050507 | nmdc:mga05p37_776902_c1 | nmdc:mga05p37_776902_c1_376_849 | 157 |
| 263 | 3300050507 | nmdc:mga05p37_82057_c1 | nmdc:mga05p37_82057_c1_3456_3929 | 157 |
| 264 | 3300050508 | nmdc:mga09592_175584_c1 | nmdc:mga09592_175584_c1_1011_1484 | 157 |
| 265 | 3300050508 | nmdc:mga09592_281741_c1 | nmdc:mga09592_281741_c1_838_1311 | 157 |
| 266 | 3300050508 | nmdc:mga09592_40252_c1 | nmdc:mga09592_40252_c1_3204_3677 | 157 |
| 267 | 3300050508 | nmdc:mga09592_930559_c1 | nmdc:mga09592_930559_c1_136_609 | 157 |
| 268 | 3300050509 | nmdc:mga0qj67_391149_c1 | nmdc:mga0qj67_391149_c1_565_1038 | 157 |
| 269 | 3300050509 | nmdc:mga0qj67_414230_c1 | nmdc:mga0qj67_414230_c1_164_637 | 157 |
| 270 | 3300050509 | nmdc:mga0qj67_43185_c1 | nmdc:mga0qj67_43185_c1_3021_3494 | 157 |
| 271 | 3300050509 | nmdc:mga0qj67_60441_c1 | nmdc:mga0qj67_60441_c1_620_1093 | 157 |
| 272 | 3300050509 | nmdc:mga0qj67_63601_c1 | nmdc:mga0qj67_63601_c1_1234_1782 | 157 |
| 273 | 3300050510 | nmdc:mga06r32_1007073_c1 | nmdc:mga06r32_1007073_c1_61_534 | 157 |
| 274 | 3300050510 | nmdc:mga06r32_190624_c1 | nmdc:mga06r32_190624_c1_77_550 | 157 |
| 275 | 3300050510 | nmdc:mga06r32_58404_c1 | nmdc:mga06r32_58404_c1_327_800 | 157 |
| 276 | 3300050510 | nmdc:mga06r32_66135_c1 | nmdc:mga06r32_66135_c1_606_1079 | 157 |
| 277 | 3300050511 | nmdc:mga08y16_1151042_c1 | nmdc:mga08y16_1151042_c1_10_483 | 157 |
| 278 | 3300050511 | nmdc:mga08y16_21179_c1 | nmdc:mga08y16_21179_c1_3046_3519 | 157 |
| 279 | 3300050512 | nmdc:mga0n895_1236867_c1 | nmdc:mga0n895_1236867_c1_49_522 | 157 |
| 280 | 3300050512 | nmdc:mga0n895_29629_c1 | nmdc:mga0n895_29629_c1_4555_5028 | 157 |
| 281 | 3300050512 | nmdc:mga0n895_375008_c1 | nmdc:mga0n895_375008_c1_25_498 | 157 |
| 282 | 3300050512 | nmdc:mga0n895_65874_c1 | nmdc:mga0n895_65874_c1_2073_2546 | 157 |
| 283 | 3300050513 | nmdc:mga0rr50_103572_c1 | nmdc:mga0rr50_103572_c1_508_981 | 157 |
| 284 | 3300050513 | nmdc:mga0rr50_1281606_c1 | nmdc:mga0rr50_1281606_c1_133_606 | 157 |
| 285 | 3300050513 | nmdc:mga0rr50_129206_c1 | nmdc:mga0rr50_129206_c1_352_825 | 157 |
| 286 | 3300050513 | nmdc:mga0rr50_549190_c1 | nmdc:mga0rr50_549190_c1_374_847 | 157 |
| 287 | 3300050513 | nmdc:mga0rr50_807610_c1 | nmdc:mga0rr50_807610_c1_40_513 | 157 |
| 288 | 3300050513 | nmdc:mga0rr50_820901_c1 | nmdc:mga0rr50_820901_c1_277_750 | 157 |
| 289 | 3300050513 | nmdc:mga0rr50_9440_c1 | nmdc:mga0rr50_9440_c1_699_1172 | 157 |
| 290 | 3300050514 | nmdc:mga08x19_179094_c1 | nmdc:mga08x19_179094_c1_190_663 | 157 |
| 291 | 3300050514 | nmdc:mga08x19_31519_c1 | nmdc:mga08x19_31519_c1_2809_3282 | 157 |
| 292 | 3300050514 | nmdc:mga08x19_707980_c1 | nmdc:mga08x19_707980_c1_188_661 | 157 |
| 293 | 3300050514 | nmdc:mga08x19_710374_c1 | nmdc:mga08x19_710374_c1_92_565 | 157 |
| 294 | 3300050515 | nmdc:mga0a205_118432_c1 | nmdc:mga0a205_118432_c1_1928_2401 | 157 |
| 295 | 3300050515 | nmdc:mga0a205_129445_c1 | nmdc:mga0a205_129445_c1_283_756 | 157 |
| 296 | 3300050515 | nmdc:mga0a205_363_c1 | nmdc:mga0a205_363_c1_4121_4594 | 157 |
| 297 | 3300050515 | nmdc:mga0a205_3769_c1 | nmdc:mga0a205_3769_c1_3545_4018 | 157 |
| 298 | 3300050515 | nmdc:mga0a205_57041_c1 | nmdc:mga0a205_57041_c1_1158_1634 | 157 |
| 299 | 3300050515 | nmdc:mga0a205_604531_c1 | nmdc:mga0a205_604531_c1_429_902 | 157 |
| 300 | 3300050515 | nmdc:mga0a205_66355_c1 | nmdc:mga0a205_66355_c1_2358_2831 | 157 |
| 301 | 3300054114 | Ga0501084_0021601 | Ga0501084_0021601_4770_5243 | 157 |
| 302 | 3300054114 | Ga0501084_0172491 | Ga0501084_0172491_984_1457 | 157 |
| 303 | 3300054114 | Ga0501084_0239772 | Ga0501084_0239772_876_1349 | 157 |
| 304 | 3300059424 | Ga0590075_004941 | Ga0590075_004941_368_841 | 157 |
| 305 | 3300060353 | Ga0501082_0003633 | Ga0501082_0003633_5147_5620 | 157 |
| 306 | 3300060353 | Ga0501082_0051809 | Ga0501082_0051809_2317_2790 | 157 |
| 307 | 3300060353 | Ga0501082_0198922 | Ga0501082_0198922_142_615 | 157 |
| 308 | 3300060353 | Ga0501082_0241257 | Ga0501082_0241257_967_1440 | 157 |
| 309 | 3300060353 | Ga0501082_1919262 | Ga0501082_1919262_23_496 | 157 |
| 310 | 3300061734 | Ga0530510_0035010 | Ga0530510_0035010_2905_3378 | 157 |
| 311 | 3300061734 | Ga0530510_0136733 | Ga0530510_0136733_195_668 | 157 |
| 312 | 3300061734 | Ga0530510_0222989 | Ga0530510_0222989_51_524 | 157 |
| 313 | 3300061734 | Ga0530510_0281175 | Ga0530510_0281175_145_618 | 157 |
| 314 | 3300061734 | Ga0530510_0381789 | Ga0530510_0381789_182_655 | 157 |
| 315 | 3300005365 | Ga0070688_100985682 | Ga0070688_1009856821 | 159 |
| 316 | 3300005406 | Ga0070703_10285674 | Ga0070703_102856741 | 159 |
| 317 | 3300005438 | Ga0070701_10059197 | Ga0070701_100591972 | 159 |
| 318 | 3300005440 | Ga0070705_100290095 | Ga0070705_1002900952 | 159 |
| 319 | 3300005444 | Ga0070694_100066050 | Ga0070694_1000660503 | 159 |
| 320 | 3300005544 | Ga0070686_100013098 | Ga0070686_1000130984 | 159 |
| 321 | 3300005617 | Ga0068859_101720199 | Ga0068859_1017201991 | 159 |
| 322 | 3300005617 | Ga0068859_101849658 | Ga0068859_1018496582 | 159 |
| 323 | 3300005618 | Ga0068864_100481137 | Ga0068864_1004811372 | 159 |
| 324 | 3300005719 | Ga0068861_100282978 | Ga0068861_1002829782 | 159 |
| 325 | 3300005844 | Ga0068862_100326998 | Ga0068862_1003269982 | 159 |
| 326 | 3300006931 | Ga0097620_101720231 | Ga0097620_1017202311 | 159 |
| 327 | 3300006931 | Ga0097620_101849601 | Ga0097620_1018496012 | 159 |
| 328 | 3300009176 | Ga0105242_10935549 | Ga0105242_109355491 | 159 |
| 329 | 3300009177 | Ga0105248_11068070 | Ga0105248_110680702 | 159 |
| 330 | 3300009553 | Ga0105249_10077893 | Ga0105249_100778934 | 159 |
| 331 | 3300014325 | Ga0163163_10131060 | Ga0163163_101310603 | 159 |
| 332 | 3300025934 | Ga0207686_10360841 | Ga0207686_103608412 | 159 |
| 333 | 3300025941 | Ga0207711_11061386 | Ga0207711_110613862 | 159 |
| 334 | 3300025961 | Ga0207712_11169369 | Ga0207712_111693691 | 159 |
| 335 | 3300026095 | Ga0207676_10419798 | Ga0207676_104197982 | 159 |
| 336 | 3300035691 | Ga0373931_0271840 | Ga0373931_0271840_175_660 | 159 |
| 337 | 3300039447 | Ga0436361_0889442 | Ga0436361_0889442_34_519 | 159 |
| 338 | 3300044712 | Ga0453684_1460504 | Ga0453684_1460504_175_660 | 159 |
| 339 | 3300046454 | Ga0495592_0000023 | Ga0495592_0000023_57759_58244 | 159 |
| 340 | 3300046476 | Ga0495662_0005799 | Ga0495662_0005799_5511_5996 | 159 |
| 341 | 3300046477 | Ga0495664_0042121 | Ga0495664_0042121_1045_1530 | 159 |
| 342 | 3300046514 | Ga0495618_0002603 | Ga0495618_0002603_4816_5301 | 159 |
| 343 | 3300046516 | Ga0495628_0005164 | Ga0495628_0005164_8975_9460 | 159 |
| 344 | 3300046517 | Ga0495630_0029891 | Ga0495630_0029891_3022_3507 | 159 |
| 345 | 3300046526 | Ga0495666_0050773 | Ga0495666_0050773_339_824 | 159 |
| 346 | 3300046529 | Ga0495652_0058251 | Ga0495652_0058251_1714_2199 | 159 |
| 347 | 3300046533 | Ga0495640_0006702 | Ga0495640_0006702_4854_5339 | 159 |
| 348 | 3300046535 | Ga0495586_0001744 | Ga0495586_0001744_1285_1770 | 159 |
| 349 | 3300046543 | Ga0495645_0013766 | Ga0495645_0013766_1396_1881 | 159 |
| 350 | 3300046642 | Ga0495634_0333356 | Ga0495634_0333356_255_740 | 159 |
| 351 | 3300046678 | Ga0495599_0024402 | Ga0495599_0024402_1820_2305 | 159 |
| 352 | 3300046680 | Ga0495646_0154966 | Ga0495646_0154966_246_731 | 159 |
| 353 | 3300046683 | Ga0495658_0506635 | Ga0495658_0506635_150_635 | 159 |
| 354 | 3300047319 | Ga0495674_0003916 | Ga0495674_0003916_9896_10381 | 159 |
| 355 | 3300050511 | nmdc:mga08y16_581182_c1 | nmdc:mga08y16_581182_c1_78_569 | 159 |
| 356 | 3300013296 | Ga0157374_10497820 | Ga0157374_104978202 | 160 |
| 357 | 3300013306 | Ga0163162_11302432 | Ga0163162_113024321 | 160 |
| 358 | 3300013308 | Ga0157375_12744949 | Ga0157375_127449491 | 160 |
| 359 | 3300035171 | Ga0373946_0187661 | Ga0373946_0187661_220_714 | 160 |
| 360 | 3300046683 | Ga0495658_0100819 | Ga0495658_0100819_407_901 | 160 |
| 361 | 3300003320 | rootH2_10035096 | rootH2_100350962 | 161 |
| 362 | 3300003323 | rootH1_10072186 | rootH1_100721862 | 161 |
| 363 | 3300005327 | Ga0070658_10120517 | Ga0070658_101205173 | 161 |
| 364 | 3300005327 | Ga0070658_10273866 | Ga0070658_102738662 | 161 |
| 365 | 3300005329 | Ga0070683_100238398 | Ga0070683_1002383983 | 161 |
| 366 | 3300005340 | Ga0070689_100176832 | Ga0070689_1001768322 | 161 |
| 367 | 3300005340 | Ga0070689_100210854 | Ga0070689_1002108542 | 161 |
| 368 | 3300005356 | Ga0070674_100496881 | Ga0070674_1004968811 | 161 |
| 369 | 3300005364 | Ga0070673_101023122 | Ga0070673_1010231221 | 161 |
| 370 | 3300005436 | Ga0070713_100247274 | Ga0070713_1002472742 | 161 |
| 371 | 3300005439 | Ga0070711_100002821 | Ga0070711_1000028219 | 161 |
| 372 | 3300005441 | Ga0070700_101057291 | Ga0070700_1010572911 | 161 |
| 373 | 3300005458 | Ga0070681_10329466 | Ga0070681_103294663 | 161 |
| 374 | 3300005458 | Ga0070681_10478536 | Ga0070681_104785362 | 161 |
| 375 | 3300005459 | Ga0068867_100244048 | Ga0068867_1002440482 | 161 |
| 376 | 3300005459 | Ga0068867_100410895 | Ga0068867_1004108953 | 161 |
| 377 | 3300005530 | Ga0070679_100031128 | Ga0070679_1000311284 | 161 |
| 378 | 3300005530 | Ga0070679_100342609 | Ga0070679_1003426091 | 161 |
| 379 | 3300005536 | Ga0070697_101306969 | Ga0070697_1013069691 | 161 |
| 380 | 3300005539 | Ga0068853_100026471 | Ga0068853_1000264717 | 161 |
| 381 | 3300005544 | Ga0070686_100200988 | Ga0070686_1002009882 | 161 |
| 382 | 3300005544 | Ga0070686_101076683 | Ga0070686_1010766831 | 161 |
| 383 | 3300005545 | Ga0070695_100822023 | Ga0070695_1008220231 | 161 |
| 384 | 3300005549 | Ga0070704_100101420 | Ga0070704_1001014203 | 161 |
| 385 | 3300005549 | Ga0070704_100387832 | Ga0070704_1003878323 | 161 |
| 386 | 3300005563 | Ga0068855_100019809 | Ga0068855_10001980910 | 161 |
| 387 | 3300005563 | Ga0068855_100044981 | Ga0068855_1000449816 | 161 |
| 388 | 3300005563 | Ga0068855_100180493 | Ga0068855_1001804934 | 161 |
| 389 | 3300005563 | Ga0068855_100505567 | Ga0068855_1005055672 | 161 |
| 390 | 3300005563 | Ga0068855_100619972 | Ga0068855_1006199722 | 161 |
| 391 | 3300005577 | Ga0068857_100619848 | Ga0068857_1006198482 | 161 |
| 392 | 3300005614 | Ga0068856_100000058 | Ga0068856_100000058104 | 161 |
| 393 | 3300005614 | Ga0068856_100145557 | Ga0068856_1001455573 | 161 |
| 394 | 3300005614 | Ga0068856_100981778 | Ga0068856_1009817782 | 161 |
| 395 | 3300005617 | Ga0068859_100056294 | Ga0068859_1000562942 | 161 |
| 396 | 3300005617 | Ga0068859_101877372 | Ga0068859_1018773722 | 161 |
| 397 | 3300005718 | Ga0068866_10591179 | Ga0068866_105911791 | 161 |
| 398 | 3300005719 | Ga0068861_100281316 | Ga0068861_1002813163 | 161 |
| 399 | 3300005841 | Ga0068863_101513405 | Ga0068863_1015134052 | 161 |
| 400 | 3300005842 | Ga0068858_100133244 | Ga0068858_1001332442 | 161 |
| 401 | 3300006844 | Ga0075428_100003743 | Ga0075428_10000374316 | 161 |
| 402 | 3300006847 | Ga0075431_100558356 | Ga0075431_1005583563 | 161 |
| 403 | 3300006931 | Ga0097620_100056294 | Ga0097620_1000562942 | 161 |
| 404 | 3300006931 | Ga0097620_101877507 | Ga0097620_1018775072 | 161 |
| 405 | 3300007076 | Ga0075435_100163133 | Ga0075435_1001631332 | 161 |
| 406 | 3300009093 | Ga0105240_10134769 | Ga0105240_101347692 | 161 |
| 407 | 3300009093 | Ga0105240_10167864 | Ga0105240_101678643 | 161 |
| 408 | 3300009093 | Ga0105240_10202948 | Ga0105240_102029483 | 161 |
| 409 | 3300009093 | Ga0105240_10442939 | Ga0105240_104429392 | 161 |
| 410 | 3300009094 | Ga0111539_10004958 | Ga0111539_1000495810 | 161 |
| 411 | 3300009094 | Ga0111539_10494989 | Ga0111539_104949891 | 161 |
| 412 | 3300009147 | Ga0114129_10948048 | Ga0114129_109480482 | 161 |
| 413 | 3300009174 | Ga0105241_10066720 | Ga0105241_100667205 | 161 |
| 414 | 3300009176 | Ga0105242_10295108 | Ga0105242_102951081 | 161 |
| 415 | 3300009551 | Ga0105238_10027652 | Ga0105238_100276527 | 161 |
| 416 | 3300009551 | Ga0105238_10105220 | Ga0105238_101052202 | 161 |
| 417 | 3300009551 | Ga0105238_10325421 | Ga0105238_103254212 | 161 |
| 418 | 3300009551 | Ga0105238_11481675 | Ga0105238_114816752 | 161 |
| 419 | 3300011119 | Ga0105246_11025133 | Ga0105246_110251332 | 161 |
| 420 | 3300013102 | Ga0157371_10284288 | Ga0157371_102842882 | 161 |
| 421 | 3300013104 | Ga0157370_10045311 | Ga0157370_100453114 | 161 |
| 422 | 3300013104 | Ga0157370_10500966 | Ga0157370_105009662 | 161 |
| 423 | 3300013296 | Ga0157374_10148125 | Ga0157374_101481252 | 161 |
| 424 | 3300013296 | Ga0157374_10995042 | Ga0157374_109950422 | 161 |
| 425 | 3300013297 | Ga0157378_10681764 | Ga0157378_106817641 | 161 |
| 426 | 3300013306 | Ga0163162_11007903 | Ga0163162_110079031 | 161 |
| 427 | 3300013307 | Ga0157372_10187482 | Ga0157372_101874825 | 161 |
| 428 | 3300014325 | Ga0163163_11573677 | Ga0163163_115736772 | 161 |
| 429 | 3300014968 | Ga0157379_11234793 | Ga0157379_112347931 | 161 |
| 430 | 3300014969 | Ga0157376_12159843 | Ga0157376_121598431 | 161 |
| 431 | 3300025899 | Ga0207642_10452660 | Ga0207642_104526602 | 161 |
| 432 | 3300025909 | Ga0207705_10213479 | Ga0207705_102134792 | 161 |
| 433 | 3300025911 | Ga0207654_10074411 | Ga0207654_100744112 | 161 |
| 434 | 3300025912 | Ga0207707_10399978 | Ga0207707_103999781 | 161 |
| 435 | 3300025913 | Ga0207695_10101741 | Ga0207695_101017412 | 161 |
| 436 | 3300025913 | Ga0207695_10119012 | Ga0207695_101190123 | 161 |
| 437 | 3300025913 | Ga0207695_10154957 | Ga0207695_101549573 | 161 |
| 438 | 3300025913 | Ga0207695_10246284 | Ga0207695_102462845 | 161 |
| 439 | 3300025916 | Ga0207663_10001010 | Ga0207663_1000101011 | 161 |
| 440 | 3300025921 | Ga0207652_10128185 | Ga0207652_101281854 | 161 |
| 441 | 3300025921 | Ga0207652_10510644 | Ga0207652_105106442 | 161 |
| 442 | 3300025924 | Ga0207694_10015363 | Ga0207694_100153632 | 161 |
| 443 | 3300025924 | Ga0207694_10044221 | Ga0207694_100442214 | 161 |
| 444 | 3300025924 | Ga0207694_10053022 | Ga0207694_100530224 | 161 |
| 445 | 3300025924 | Ga0207694_10308600 | Ga0207694_103086003 | 161 |
| 446 | 3300025929 | Ga0207664_10005849 | Ga0207664_100058495 | 161 |
| 447 | 3300025936 | Ga0207670_10060592 | Ga0207670_100605924 | 161 |
| 448 | 3300025936 | Ga0207670_10531461 | Ga0207670_105314612 | 161 |
| 449 | 3300025944 | Ga0207661_10327449 | Ga0207661_103274492 | 161 |
| 450 | 3300025949 | Ga0207667_10034747 | Ga0207667_100347475 | 161 |
| 451 | 3300025949 | Ga0207667_10141572 | Ga0207667_101415723 | 161 |
| 452 | 3300025949 | Ga0207667_10168415 | Ga0207667_101684154 | 161 |
| 453 | 3300025949 | Ga0207667_10389931 | Ga0207667_103899312 | 161 |
| 454 | 3300025949 | Ga0207667_10531277 | Ga0207667_105312772 | 161 |
| 455 | 3300026035 | Ga0207703_10088615 | Ga0207703_100886152 | 161 |
| 456 | 3300026078 | Ga0207702_10002049 | Ga0207702_1000204919 | 161 |
| 457 | 3300026078 | Ga0207702_10025697 | Ga0207702_100256974 | 161 |
| 458 | 3300026078 | Ga0207702_10697721 | Ga0207702_106977213 | 161 |
| 459 | 3300026088 | Ga0207641_10997168 | Ga0207641_109971682 | 161 |
| 460 | 3300026095 | Ga0207676_10175131 | Ga0207676_101751313 | 161 |
| 461 | 3300026095 | Ga0207676_11459380 | Ga0207676_114593801 | 161 |
| 462 | 3300027907 | Ga0207428_10276090 | Ga0207428_102760902 | 161 |
| 463 | 3300028556 | Ga0265337_1000140 | Ga0265337_100014021 | 161 |
| 464 | 3300028556 | Ga0265337_1001274 | Ga0265337_10012745 | 161 |
| 465 | 3300028556 | Ga0265337_1002167 | Ga0265337_10021676 | 161 |
| 466 | 3300028556 | Ga0265337_1006735 | Ga0265337_10067355 | 161 |
| 467 | 3300028556 | Ga0265337_1015350 | Ga0265337_10153502 | 161 |
| 468 | 3300028558 | Ga0265326_10001872 | Ga0265326_100018728 | 161 |
| 469 | 3300028558 | Ga0265326_10006429 | Ga0265326_100064293 | 161 |
| 470 | 3300028558 | Ga0265326_10106052 | Ga0265326_101060522 | 161 |
| 471 | 3300028558 | Ga0265326_10170413 | Ga0265326_101704132 | 161 |
| 472 | 3300028563 | Ga0265319_1000007 | Ga0265319_100000796 | 161 |
| 473 | 3300028563 | Ga0265319_1029444 | Ga0265319_10294443 | 161 |
| 474 | 3300028563 | Ga0265319_1043151 | Ga0265319_10431513 | 161 |
| 475 | 3300028563 | Ga0265319_1100430 | Ga0265319_11004302 | 161 |
| 476 | 3300028573 | Ga0265334_10011533 | Ga0265334_100115333 | 161 |
| 477 | 3300028573 | Ga0265334_10052800 | Ga0265334_100528002 | 161 |
| 478 | 3300028573 | Ga0265334_10199677 | Ga0265334_101996771 | 161 |
| 479 | 3300028577 | Ga0265318_10057750 | Ga0265318_100577503 | 161 |
| 480 | 3300028577 | Ga0265318_10235343 | Ga0265318_102353431 | 161 |
| 481 | 3300028653 | Ga0265323_10000237 | Ga0265323_1000023730 | 161 |
| 482 | 3300028653 | Ga0265323_10029666 | Ga0265323_100296662 | 161 |
| 483 | 3300028653 | Ga0265323_10123693 | Ga0265323_101236932 | 161 |
| 484 | 3300028654 | Ga0265322_10088443 | Ga0265322_100884431 | 161 |
| 485 | 3300028654 | Ga0265322_10125051 | Ga0265322_101250512 | 161 |
| 486 | 3300028666 | Ga0265336_10000819 | Ga0265336_100008195 | 161 |
| 487 | 3300028666 | Ga0265336_10014566 | Ga0265336_100145663 | 161 |
| 488 | 3300028666 | Ga0265336_10052476 | Ga0265336_100524763 | 161 |
| 489 | 3300028666 | Ga0265336_10077152 | Ga0265336_100771522 | 161 |
| 490 | 3300028800 | Ga0265338_10000075 | Ga0265338_1000007559 | 161 |
| 491 | 3300028800 | Ga0265338_10000425 | Ga0265338_1000042536 | 161 |
| 492 | 3300028800 | Ga0265338_10000431 | Ga0265338_1000043111 | 161 |
| 493 | 3300028800 | Ga0265338_10000945 | Ga0265338_1000094514 | 161 |
| 494 | 3300028800 | Ga0265338_10001555 | Ga0265338_1000155517 | 161 |
| 495 | 3300028800 | Ga0265338_10002354 | Ga0265338_100023544 | 161 |
| 496 | 3300028800 | Ga0265338_10004123 | Ga0265338_100041238 | 161 |
| 497 | 3300028800 | Ga0265338_10009242 | Ga0265338_100092428 | 161 |
| 498 | 3300028800 | Ga0265338_10009353 | Ga0265338_100093534 | 161 |
| 499 | 3300028800 | Ga0265338_10010670 | Ga0265338_1001067010 | 161 |
| 500 | 3300028800 | Ga0265338_10013146 | Ga0265338_100131468 | 161 |
| 501 | 3300028800 | Ga0265338_10018502 | Ga0265338_100185027 | 161 |
| 502 | 3300028800 | Ga0265338_10019978 | Ga0265338_100199783 | 161 |
| 503 | 3300028800 | Ga0265338_10020690 | Ga0265338_1002069012 | 161 |
| 504 | 3300028800 | Ga0265338_10022140 | Ga0265338_100221403 | 161 |
| 505 | 3300028800 | Ga0265338_10052394 | Ga0265338_100523946 | 161 |
| 506 | 3300028800 | Ga0265338_10052887 | Ga0265338_100528875 | 161 |
| 507 | 3300028800 | Ga0265338_10073848 | Ga0265338_100738482 | 161 |
| 508 | 3300028800 | Ga0265338_10105052 | Ga0265338_101050522 | 161 |
| 509 | 3300028800 | Ga0265338_10107502 | Ga0265338_101075022 | 161 |
| 510 | 3300028800 | Ga0265338_10213267 | Ga0265338_102132672 | 161 |
| 511 | 3300028800 | Ga0265338_10233848 | Ga0265338_102338482 | 161 |
| 512 | 3300028800 | Ga0265338_10251731 | Ga0265338_102517312 | 161 |
| 513 | 3300028800 | Ga0265338_10298128 | Ga0265338_102981283 | 161 |
| 514 | 3300028800 | Ga0265338_10462476 | Ga0265338_104624762 | 161 |
| 515 | 3300028800 | Ga0265338_10470376 | Ga0265338_104703762 | 161 |
| 516 | 3300029957 | Ga0265324_10000515 | Ga0265324_1000051523 | 161 |
| 517 | 3300029957 | Ga0265324_10005688 | Ga0265324_100056885 | 161 |
| 518 | 3300029957 | Ga0265324_10006339 | Ga0265324_100063393 | 161 |
| 519 | 3300029957 | Ga0265324_10009283 | Ga0265324_100092832 | 161 |
| 520 | 3300029957 | Ga0265324_10037961 | Ga0265324_100379612 | 161 |
| 521 | 3300029957 | Ga0265324_10042539 | Ga0265324_100425393 | 161 |
| 522 | 3300029957 | Ga0265324_10053490 | Ga0265324_100534902 | 161 |
| 523 | 3300029957 | Ga0265324_10058288 | Ga0265324_100582882 | 161 |
| 524 | 3300029957 | Ga0265324_10061213 | Ga0265324_100612132 | 161 |
| 525 | 3300029957 | Ga0265324_10095539 | Ga0265324_100955392 | 161 |
| 526 | 3300029957 | Ga0265324_10253310 | Ga0265324_102533101 | 161 |
| 527 | 3300031235 | Ga0265330_10381445 | Ga0265330_103814451 | 161 |
| 528 | 3300031235 | Ga0265330_10394163 | Ga0265330_103941632 | 161 |
| 529 | 3300031238 | Ga0265332_10167872 | Ga0265332_101678722 | 161 |
| 530 | 3300031240 | Ga0265320_10000188 | Ga0265320_1000018811 | 161 |
| 531 | 3300031240 | Ga0265320_10004415 | Ga0265320_1000441510 | 161 |
| 532 | 3300031240 | Ga0265320_10016271 | Ga0265320_100162713 | 161 |
| 533 | 3300031240 | Ga0265320_10025337 | Ga0265320_100253372 | 161 |
| 534 | 3300031240 | Ga0265320_10027037 | Ga0265320_100270373 | 161 |
| 535 | 3300031240 | Ga0265320_10027755 | Ga0265320_100277553 | 161 |
| 536 | 3300031240 | Ga0265320_10160543 | Ga0265320_101605432 | 161 |
| 537 | 3300031240 | Ga0265320_10192108 | Ga0265320_101921082 | 161 |
| 538 | 3300031240 | Ga0265320_10341778 | Ga0265320_103417781 | 161 |
| 539 | 3300031241 | Ga0265325_10085582 | Ga0265325_100855822 | 161 |
| 540 | 3300031241 | Ga0265325_10094847 | Ga0265325_100948472 | 161 |
| 541 | 3300031242 | Ga0265329_10100357 | Ga0265329_101003572 | 161 |
| 542 | 3300031247 | Ga0265340_10000803 | Ga0265340_100008039 | 161 |
| 543 | 3300031247 | Ga0265340_10027009 | Ga0265340_100270091 | 161 |
| 544 | 3300031247 | Ga0265340_10057322 | Ga0265340_100573223 | 161 |
| 545 | 3300031247 | Ga0265340_10063435 | Ga0265340_100634354 | 161 |
| 546 | 3300031249 | Ga0265339_10014822 | Ga0265339_100148226 | 161 |
| 547 | 3300031249 | Ga0265339_10024832 | Ga0265339_100248324 | 161 |
| 548 | 3300031249 | Ga0265339_10025907 | Ga0265339_100259074 | 161 |
| 549 | 3300031249 | Ga0265339_10296789 | Ga0265339_102967892 | 161 |
| 550 | 3300031249 | Ga0265339_10301890 | Ga0265339_103018902 | 161 |
| 551 | 3300031249 | Ga0265339_10345557 | Ga0265339_103455572 | 161 |
| 552 | 3300031250 | Ga0265331_10239305 | Ga0265331_102393052 | 161 |
| 553 | 3300031250 | Ga0265331_10259269 | Ga0265331_102592691 | 161 |
| 554 | 3300031251 | Ga0265327_10000752 | Ga0265327_1000075216 | 161 |
| 555 | 3300031251 | Ga0265327_10003972 | Ga0265327_100039723 | 161 |
| 556 | 3300031251 | Ga0265327_10010095 | Ga0265327_100100956 | 161 |
| 557 | 3300031251 | Ga0265327_10030353 | Ga0265327_100303533 | 161 |
| 558 | 3300031344 | Ga0265316_10006885 | Ga0265316_1000688511 | 161 |
| 559 | 3300031344 | Ga0265316_10017515 | Ga0265316_100175152 | 161 |
| 560 | 3300031344 | Ga0265316_10026957 | Ga0265316_100269574 | 161 |
| 561 | 3300031344 | Ga0265316_10028132 | Ga0265316_100281326 | 161 |
| 562 | 3300031344 | Ga0265316_10218174 | Ga0265316_102181742 | 161 |
| 563 | 3300031344 | Ga0265316_10399473 | Ga0265316_103994732 | 161 |
| 564 | 3300031344 | Ga0265316_10484451 | Ga0265316_104844512 | 161 |
| 565 | 3300031595 | Ga0265313_10001008 | Ga0265313_1000100823 | 161 |
| 566 | 3300031595 | Ga0265313_10079892 | Ga0265313_100798922 | 161 |
| 567 | 3300031595 | Ga0265313_10097366 | Ga0265313_100973663 | 161 |
| 568 | 3300031595 | Ga0265313_10114218 | Ga0265313_101142182 | 161 |
| 569 | 3300031595 | Ga0265313_10158762 | Ga0265313_101587622 | 161 |
| 570 | 3300031711 | Ga0265314_10004107 | Ga0265314_1000410715 | 161 |
| 571 | 3300031711 | Ga0265314_10014321 | Ga0265314_100143214 | 161 |
| 572 | 3300031711 | Ga0265314_10046910 | Ga0265314_100469103 | 161 |
| 573 | 3300031711 | Ga0265314_10299710 | Ga0265314_102997102 | 161 |
| 574 | 3300031733 | Ga0316577_10193797 | Ga0316577_101937971 | 161 |
| 575 | 3300034816 | Ga0373930_0021703 | Ga0373930_0021703_115_600 | 161 |
| 576 | 3300034957 | Ga0373938_0020453 | Ga0373938_0020453_695_1180 | 161 |
| 577 | 3300034957 | Ga0373938_0026517 | Ga0373938_0026517_63_548 | 161 |
| 578 | 3300035084 | Ga0373928_0000124 | Ga0373928_0000124_6967_7452 | 161 |
| 579 | 3300035085 | Ga0373929_0006750 | Ga0373929_0006750_1416_1901 | 161 |
| 580 | 3300035086 | Ga0373934_0070470 | Ga0373934_0070470_794_1327 | 161 |
| 581 | 3300035089 | Ga0373944_0001296 | Ga0373944_0001296_3980_4465 | 161 |
| 582 | 3300035090 | Ga0373949_0019648 | Ga0373949_0019648_270_755 | 161 |
| 583 | 3300035091 | Ga0373951_0003865 | Ga0373951_0003865_3030_3515 | 161 |
| 584 | 3300035111 | Ga0373923_0066729 | Ga0373923_0066729_661_1194 | 161 |
| 585 | 3300035112 | Ga0373932_0000001 | Ga0373932_0000001_1154181_1154666 | 161 |
| 586 | 3300035113 | Ga0373936_0154362 | Ga0373936_0154362_417_902 | 161 |
| 587 | 3300035116 | Ga0373945_0027439 | Ga0373945_0027439_408_893 | 161 |
| 588 | 3300035117 | Ga0373953_0155983 | Ga0373953_0155983_327_860 | 161 |
| 589 | 3300035118 | Ga0373954_0003285 | Ga0373954_0003285_257_790 | 161 |
| 590 | 3300035118 | Ga0373954_0068773 | Ga0373954_0068773_165_695 | 161 |
| 591 | 3300035118 | Ga0373954_0070100 | Ga0373954_0070100_737_1273 | 161 |
| 592 | 3300035171 | Ga0373946_0115194 | Ga0373946_0115194_440_925 | 161 |
| 593 | 3300035172 | Ga0373955_0062252 | Ga0373955_0062252_1509_2051 | 161 |
| 594 | 3300035172 | Ga0373955_0345438 | Ga0373955_0345438_74_610 | 161 |
| 595 | 3300035241 | Ga0373961_0045640 | Ga0373961_0045640_650_1135 | 161 |
| 596 | 3300035242 | Ga0373962_0000018 | Ga0373962_0000018_30102_30587 | 161 |
| 597 | 3300035691 | Ga0373931_0000002 | Ga0373931_0000002_340732_341217 | 161 |
| 598 | 3300035692 | Ga0373935_0091703 | Ga0373935_0091703_712_1197 | 161 |
| 599 | 3300035692 | Ga0373935_0643648 | Ga0373935_0643648_25_510 | 161 |
| 600 | 3300035695 | Ga0373927_0026587 | Ga0373927_0026587_2663_3148 | 161 |
| 601 | 3300035724 | Ga0373933_0764336 | Ga0373933_0764336_51_536 | 161 |
| 602 | 3300035725 | Ga0373947_0049735 | Ga0373947_0049735_1622_2107 | 161 |
| 603 | 3300036401 | Ga0373937_0025480 | Ga0373937_0025480_3088_3630 | 161 |
| 604 | 3300037068 | Ga0373925_0000552 | Ga0373925_0000552_20659_21144 | 161 |
| 605 | 3300037068 | Ga0373925_0011834 | Ga0373925_0011834_3183_3668 | 161 |
| 606 | 3300041486 | Ga0451807_0982052 | Ga0451807_0982052_827_1312 | 161 |
| 607 | 3300042876 | Ga0451577_0008522 | Ga0451577_0008522_5343_5888 | 161 |
| 608 | 3300042876 | Ga0451577_0064048 | Ga0451577_0064048_988_1473 | 161 |
| 609 | 3300042876 | Ga0451577_0150176 | Ga0451577_0150176_841_1335 | 161 |
| 610 | 3300044684 | Ga0466966_0094958 | Ga0466966_0094958_1069_1602 | 161 |
| 611 | 3300044712 | Ga0453684_0002848 | Ga0453684_0002848_14170_14709 | 161 |
| 612 | 3300044712 | Ga0453684_0006217 | Ga0453684_0006217_3330_3824 | 161 |
| 613 | 3300044712 | Ga0453684_0009645 | Ga0453684_0009645_11588_12133 | 161 |
| 614 | 3300044712 | Ga0453684_0650786 | Ga0453684_0650786_646_1131 | 161 |
| 615 | 3300044712 | Ga0453684_0741856 | Ga0453684_0741856_117_692 | 161 |
| 616 | 3300044712 | Ga0453684_1861747 | Ga0453684_1861747_59_544 | 161 |
| 617 | 3300045051 | Ga0451576_0029877 | Ga0451576_0029877_3202_3696 | 161 |
| 618 | 3300045051 | Ga0451576_0074622 | Ga0451576_0074622_1435_1971 | 161 |
| 619 | 3300045051 | Ga0451576_0090765 | Ga0451576_0090765_147_683 | 161 |
| 620 | 3300045051 | Ga0451576_0500750 | Ga0451576_0500750_709_1194 | 161 |
| 621 | 3300045051 | Ga0451576_0729402 | Ga0451576_0729402_58_543 | 161 |
| 622 | 3300045051 | Ga0451576_1051311 | Ga0451576_1051311_249_782 | 161 |
| 623 | 3300046454 | Ga0495592_0198406 | Ga0495592_0198406_787_1323 | 161 |
| 624 | 3300046454 | Ga0495592_0290727 | Ga0495592_0290727_29_562 | 161 |
| 625 | 3300046459 | Ga0495629_0196643 | Ga0495629_0196643_51_593 | 161 |
| 626 | 3300046472 | Ga0495580_0377969 | Ga0495580_0377969_227_712 | 161 |
| 627 | 3300046477 | Ga0495664_0364839 | Ga0495664_0364839_63_548 | 161 |
| 628 | 3300046511 | Ga0495608_0333478 | Ga0495608_0333478_66_554 | 161 |
| 629 | 3300046514 | Ga0495618_0002646 | Ga0495618_0002646_9469_10002 | 161 |
| 630 | 3300046517 | Ga0495630_0017877 | Ga0495630_0017877_4541_5026 | 161 |
| 631 | 3300046517 | Ga0495630_0085176 | Ga0495630_0085176_875_1408 | 161 |
| 632 | 3300046517 | Ga0495630_1180276 | Ga0495630_1180276_52_537 | 161 |
| 633 | 3300046526 | Ga0495666_0162477 | Ga0495666_0162477_368_901 | 161 |
| 634 | 3300046529 | Ga0495652_0177386 | Ga0495652_0177386_730_1263 | 161 |
| 635 | 3300046529 | Ga0495652_0666337 | Ga0495652_0666337_136_621 | 161 |
| 636 | 3300046533 | Ga0495640_0189425 | Ga0495640_0189425_92_625 | 161 |
| 637 | 3300046535 | Ga0495586_0002311 | Ga0495586_0002311_398_940 | 161 |
| 638 | 3300046535 | Ga0495586_0650176 | Ga0495586_0650176_11_496 | 161 |
| 639 | 3300046535 | Ga0495586_0833867 | Ga0495586_0833867_11_496 | 161 |
| 640 | 3300046543 | Ga0495645_0320781 | Ga0495645_0320781_52_585 | 161 |
| 641 | 3300046557 | Ga0495622_0256937 | Ga0495622_0256937_148_684 | 161 |
| 642 | 3300046559 | Ga0495667_0371595 | Ga0495667_0371595_299_832 | 161 |
| 643 | 3300046642 | Ga0495634_0002060 | Ga0495634_0002060_6233_6775 | 161 |
| 644 | 3300046663 | Ga0495635_0045785 | Ga0495635_0045785_1329_1862 | 161 |
| 645 | 3300046678 | Ga0495599_0526627 | Ga0495599_0526627_32_568 | 161 |
| 646 | 3300046681 | Ga0495647_0014088 | Ga0495647_0014088_1363_1896 | 161 |
| 647 | 3300046689 | Ga0495613_0021151 | Ga0495613_0021151_3240_3782 | 161 |
| 648 | 3300047319 | Ga0495674_0298603 | Ga0495674_0298603_17_553 | 161 |
| 649 | 3300047319 | Ga0495674_0461380 | Ga0495674_0461380_313_846 | 161 |
| 650 | 3300047322 | Ga0495680_0013067 | Ga0495680_0013067_5535_6068 | 161 |
| 651 | 3300047444 | Ga0495675_0123348 | Ga0495675_0123348_896_1432 | 161 |
| 652 | 3300047471 | Ga0495684_0081704 | Ga0495684_0081704_1569_2102 | 161 |
| 653 | 3300047471 | Ga0495684_0822836 | Ga0495684_0822836_55_588 | 161 |
| 654 | 3300048918 | Ga0496115_0009632 | Ga0496115_0009632_5206_5805 | 161 |
| 655 | 3300048918 | Ga0496115_0633157 | Ga0496115_0633157_18_551 | 161 |
| 656 | 3300049460 | Ga0495682_0079226 | Ga0495682_0079226_334_867 | 161 |
| 657 | 3300049460 | Ga0495682_0141220 | Ga0495682_0141220_275_808 | 161 |
| 658 | 3300049568 | Ga0501031_0009653 | Ga0501031_0009653_1344_1829 | 161 |
| 659 | 3300049569 | Ga0501032_0001311 | Ga0501032_0001311_1479_1964 | 161 |
| 660 | 3300049570 | Ga0501033_0019944 | Ga0501033_0019944_78_563 | 161 |
| 661 | 3300049570 | Ga0501033_0033260 | Ga0501033_0033260_3285_3770 | 161 |
| 662 | 3300049573 | Ga0501037_0013416 | Ga0501037_0013416_3246_3731 | 161 |
| 663 | 3300049575 | Ga0501039_0072172 | Ga0501039_0072172_790_1275 | 161 |
| 664 | 3300049575 | Ga0501039_0714604 | Ga0501039_0714604_177_716 | 161 |
| 665 | 3300049579 | Ga0501043_0639110 | Ga0501043_0639110_87_572 | 161 |
| 666 | 3300049589 | Ga0501073_0482742 | Ga0501073_0482742_135_668 | 161 |
| 667 | 3300049822 | Ga0501035_0003191 | Ga0501035_0003191_11819_12304 | 161 |
| 668 | 3300049823 | Ga0501044_0000125 | Ga0501044_0000125_60223_60708 | 161 |
| 669 | 3300049823 | Ga0501044_0269897 | Ga0501044_0269897_979_1464 | 161 |
| 670 | 3300050511 | nmdc:mga08y16_44782_c1 | nmdc:mga08y16_44782_c1_2801_3286 | 161 |
| 671 | 3300050513 | nmdc:mga0rr50_288139_c1 | nmdc:mga0rr50_288139_c1_772_1308 | 161 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2o2k-assembly1.cif.gz_B | crystal structure of the activation domain of human methionine synthase isoform/mutant d963e/k1071n | 0.8719 | 40 | 73 |
| 2o2k-assembly1.cif.gz_A | crystal structure of the activation domain of human methionine synthase isoform/mutant d963e/k1071n | 0.8618 | 40 | 73 |
| 7p8n-assembly1.cif.gz_B | tmhydabc- t. maritima hydrogenase with bridge closed | 0.8409 | 78 | 158 |
| 7p5h-assembly1.cif.gz_b | tmhydabc- d2 map | 0.833 | 76 | 158 |
| 8oh5-assembly1.cif.gz_A | cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) | 0.8277 | 11 | 161 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O13691_6_74_1.10.10.1590 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E | 0.9437 | 4 | 68 | 1.10.10.1590 |
| af_Q9D6J6_126_223_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9426 | 76 | 158 | 3.40.30.10 |
| af_P0AFD1_83_165_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9371 | 74 | 158 | 3.40.30.10 |
| af_P9WIV5_106_200_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9065 | 75 | 160 | 3.40.30.10 |
| af_P0AFD1_83_165_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9053 | 74 | 158 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645D7E5-F1-model_v4 | NAD(P)H-dependent oxidoreductase subunit E | 0.9625 | 69 | 161 |
GO:0003954
|
| AF-A0A645D7E5-F1-model_v4 | NAD(P)H-dependent oxidoreductase subunit E | 0.9524 | 69 | 161 |
GO:0003954
|
| AF-A0A661A0L8-F1-model_v4 | NAD(P)H-dependent oxidoreductase subunit E | 0.9126 | 1 | 160 |
GO:0046872
GO:0051536 |
| AF-Q46505-F1-model_v4 | NADP-reducing hydrogenase subunit HndA (EC 1.12.1.3) (Hydrogen dehydrogenase (NADP(+))) | 0.8903 | 5 | 158 |
GO:0046872
GO:0050583 GO:0051537 |
| AF-A0A5D0RIZ2-F1-model_v4 | NAD(P)H-dependent oxidoreductase subunit E | 0.8882 | 7 | 160 |
GO:0016491
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar