F474174

General Info

Members Datasets Scaffolds Average Seq Length
671 209 1342 122

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0055048|Ga0395900_0055048_1779_2213
Length 144
Sequence MAVPLHVDLRLGRLGRAARGVTAKQPGEAPSPLQAAVKGNCPRCGAHTLFAGWVRFAHKCRGCGLDLDSFNVGDGPAAFLIFIVGTITVVAALIVDGVFSPPWWVHLVWIPVAGGLTIAGLRLSKALLLAQEYKHRASEGRLVQ

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
169 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.98
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0055048 3300037418 Bacteria 4095
2 JGI24747J21853_1000483 3300001978 Bacteria 2496
3 JGI24740J21852_10005046 3300001979 Bacteria 5606
4 JGI24740J21852_10015625 3300001979 Bacteria 2766
5 JGI24739J22299_10161851 3300001989 Bacteria 660
6 JGI24737J22298_10001784 3300001990 Bacteria 7703
7 JGI24737J22298_10004604 3300001990 Bacteria 4799
8 JGI24737J22298_10015381 3300001990 Bacteria 2476
9 JGI24735J21928_10003490 3300002067 Bacteria 5354
10 JGI24735J21928_10006396 3300002067 Bacteria 3878
11 JGI24738J21930_10001857 3300002075 Bacteria 5713
12 JGI24744J21845_10000252 3300002077 Bacteria 8691
13 Ga0065715_10059421 3300005293 Bacteria 985
14 Ga0070658_10000269 3300005327 Bacteria 45712
15 Ga0070658_10016854 3300005327 Bacteria 5849
16 Ga0070658_10021051 3300005327 Bacteria 5224
17 Ga0070658_10032345 3300005327 Bacteria 4206
18 Ga0070658_10202252 3300005327 Bacteria 1676
19 Ga0070658_10603274 3300005327 Bacteria 951
20 Ga0070658_10994148 3300005327 Bacteria 730
21 Ga0070676_10139745 3300005328 Bacteria 1540
22 Ga0070676_10229238 3300005328 Bacteria 1230
23 Ga0070676_10469032 3300005328 Bacteria 888
24 Ga0070683_100000781 3300005329 Bacteria 23455
25 Ga0070683_100021095 3300005329 Bacteria 5810
26 Ga0070683_100489602 3300005329 Bacteria 1174
27 Ga0070683_101236888 3300005329 Bacteria 718
28 Ga0070690_100009956 3300005330 Bacteria 5516
29 Ga0070690_100375791 3300005330 Bacteria 1038
30 Ga0070690_101041007 3300005330 Bacteria 647
31 Ga0070670_100038039 3300005331 Bacteria 4137
32 Ga0070677_10021797 3300005333 Bacteria 2354
33 Ga0068869_100076249 3300005334 Bacteria 2492
34 Ga0068869_100844101 3300005334 Bacteria 790
35 Ga0070666_10002236 3300005335 Bacteria 11709
36 Ga0070666_10004179 3300005335 Bacteria 8766
37 Ga0070666_10006211 3300005335 Bacteria 7350
38 Ga0070666_10047834 3300005335 Bacteria 2872
39 Ga0070666_10093746 3300005335 Bacteria 2064
40 Ga0070680_100001257 3300005336 Bacteria 18304
41 Ga0070680_100002339 3300005336 Bacteria 14005
42 Ga0070680_100003004 3300005336 Bacteria 12527
43 Ga0070680_100011573 3300005336 Bacteria 6832
44 Ga0070680_100221893 3300005336 Bacteria 1596
45 Ga0070680_100653761 3300005336 Bacteria 904
46 Ga0068868_100002917 3300005338 Bacteria 11871
47 Ga0068868_100091424 3300005338 Bacteria 2452
48 Ga0068868_100181437 3300005338 Bacteria 1747
49 Ga0068868_101020952 3300005338 Bacteria 757
50 Ga0070660_100000109 3300005339 Bacteria 50964
51 Ga0070660_100006463 3300005339 Bacteria 8128
52 Ga0070660_100014087 3300005339 Bacteria 5756
53 Ga0070660_100108810 3300005339 Bacteria 2203
54 Ga0070660_100132077 3300005339 Bacteria 1999
55 Ga0070660_100365284 3300005339 Bacteria 1190
56 Ga0070691_10100057 3300005341 Bacteria 1439
57 Ga0070661_100000070 3300005344 Bacteria 82818
58 Ga0070661_100023288 3300005344 Bacteria 4437
59 Ga0070661_100060376 3300005344 Bacteria 2783
60 Ga0070661_100092826 3300005344 Bacteria 2237
61 Ga0070661_101712549 3300005344 Bacteria 533
62 Ga0070692_10018534 3300005345 Bacteria 3349
63 Ga0070692_10048347 3300005345 Bacteria 2203
64 Ga0070692_10084086 3300005345 Bacteria 1719
65 Ga0070675_100059386 3300005354 Bacteria 3155
66 Ga0070675_100701526 3300005354 Bacteria 922
67 Ga0070671_100005172 3300005355 Bacteria 10388
68 Ga0070671_100022777 3300005355 Bacteria 5118
69 Ga0070671_100069212 3300005355 Bacteria 2944
70 Ga0070671_100087416 3300005355 Bacteria 2608
71 Ga0070671_100129706 3300005355 Bacteria 2123
72 Ga0070671_100139600 3300005355 Bacteria 2045
73 Ga0070671_100183185 3300005355 Bacteria 1773
74 Ga0070671_101062172 3300005355 Bacteria 710
75 Ga0070674_100003944 3300005356 Bacteria 8403
76 Ga0070674_100009013 3300005356 Bacteria 5962
77 Ga0070673_100000526 3300005364 Bacteria 20563
78 Ga0070673_100014589 3300005364 Bacteria 5481
79 Ga0070673_100178140 3300005364 Bacteria 1818
80 Ga0070673_100182977 3300005364 Bacteria 1795
81 Ga0070673_100408989 3300005364 Bacteria 1215
82 Ga0070659_100000312 3300005366 Bacteria 37872
83 Ga0070659_100023152 3300005366 Bacteria 4750
84 Ga0070659_100304595 3300005366 Bacteria 1329
85 Ga0070659_100307820 3300005366 Bacteria 1322
86 Ga0070659_100363873 3300005366 Bacteria 1216
87 Ga0070659_100445650 3300005366 Bacteria 1097
88 Ga0070667_100019471 3300005367 Bacteria 5631
89 Ga0070667_100052963 3300005367 Bacteria 3425
90 Ga0070667_100077119 3300005367 Bacteria 2846
91 Ga0070667_100482484 3300005367 Bacteria 1135
92 Ga0070667_100553972 3300005367 Bacteria 1057
93 Ga0070714_100003924 3300005435 Bacteria 11182
94 Ga0070714_100045702 3300005435 Bacteria 3712
95 Ga0070713_100031313 3300005436 Bacteria 4236
96 Ga0070663_100003412 3300005455 Bacteria 9172
97 Ga0070663_100013578 3300005455 Bacteria 5199
98 Ga0070663_100016737 3300005455 Bacteria 4771
99 Ga0070663_100333817 3300005455 Bacteria 1223
100 Ga0070678_100003435 3300005456 Bacteria 8834
101 Ga0070678_100045757 3300005456 Bacteria 3133
102 Ga0070678_100130260 3300005456 Bacteria 1997
103 Ga0070678_100315250 3300005456 Bacteria 1334
104 Ga0070662_100000037 3300005457 Bacteria 76596
105 Ga0070662_100007521 3300005457 Bacteria 7065
106 Ga0070662_100014679 3300005457 Bacteria 5235
107 Ga0070662_100021118 3300005457 Bacteria 4443
108 Ga0070662_100069302 3300005457 Bacteria 2595
109 Ga0070662_100114924 3300005457 Bacteria 2055
110 Ga0070662_100355716 3300005457 Bacteria 1201
111 Ga0070662_100385283 3300005457 Bacteria 1155
112 Ga0070662_101824970 3300005457 Bacteria 525
113 Ga0070681_10080293 3300005458 Bacteria 3218
114 Ga0070681_10163687 3300005458 Bacteria 2148
115 Ga0070681_10946052 3300005458 Bacteria 781
116 Ga0068867_100019089 3300005459 Bacteria 4882
117 Ga0068867_100074141 3300005459 Bacteria 2550
118 Ga0068867_100448625 3300005459 Bacteria 1098
119 Ga0070685_10734326 3300005466 Bacteria 723
120 Ga0070685_11217532 3300005466 Bacteria 573
121 Ga0070679_100032167 3300005530 Bacteria 5187
122 Ga0070679_100199670 3300005530 Bacteria 1966
123 Ga0070679_100267645 3300005530 Bacteria 1664
124 Ga0070679_100381257 3300005530 Bacteria 1357
125 Ga0070679_100502407 3300005530 Bacteria 1156
126 Ga0070679_100526773 3300005530 Bacteria 1125
127 Ga0070679_101276560 3300005530 Bacteria 680
128 Ga0070684_100001938 3300005535 Bacteria 15189
129 Ga0070684_100006272 3300005535 Bacteria 9183
130 Ga0070684_102323734 3300005535 Bacteria 505
131 Ga0068853_100000213 3300005539 Bacteria 41255
132 Ga0068853_100009556 3300005539 Bacteria 7813
133 Ga0068853_100118479 3300005539 Bacteria 2359
134 Ga0068853_100147153 3300005539 Bacteria 2118
135 Ga0070672_100005950 3300005543 Bacteria 8139
136 Ga0070672_100581158 3300005543 Bacteria 974
137 Ga0070672_100608044 3300005543 Bacteria 952
138 Ga0070686_100155418 3300005544 Bacteria 1605
139 Ga0070686_101602607 3300005544 Bacteria 551
140 Ga0070693_100002515 3300005547 Bacteria 8450
141 Ga0070693_100055655 3300005547 Bacteria 2280
142 Ga0070665_100055436 3300005548 Bacteria 3975
143 Ga0070665_100165774 3300005548 Bacteria 2212
144 Ga0070665_100792175 3300005548 Bacteria 961
145 Ga0068855_100004288 3300005563 Bacteria 17424
146 Ga0068855_100038922 3300005563 Bacteria 5646
147 Ga0068855_100056131 3300005563 Bacteria 4622
148 Ga0068855_100061623 3300005563 Bacteria 4382
149 Ga0068855_100243561 3300005563 Bacteria 2008
150 Ga0068855_100368981 3300005563 Bacteria 1578
151 Ga0068855_100916912 3300005563 Bacteria 925
152 Ga0068855_101127602 3300005563 Bacteria 819
153 Ga0068855_101292262 3300005563 Bacteria 755
154 Ga0070664_100000077 3300005564 Bacteria 62053
155 Ga0070664_100430355 3300005564 Bacteria 1210
156 Ga0070664_100591263 3300005564 Bacteria 1029
157 Ga0068857_100007354 3300005577 Bacteria 9481
158 Ga0068857_100101079 3300005577 Bacteria 2587
159 Ga0068857_102127704 3300005577 Bacteria 551
160 Ga0068857_102561866 3300005577 Bacteria 501
161 Ga0068854_100040129 3300005578 Bacteria 3301
162 Ga0068854_100049427 3300005578 Bacteria 3004
163 Ga0068854_100078155 3300005578 Bacteria 2437
164 Ga0068854_100132376 3300005578 Bacteria 1905
165 Ga0068854_101146308 3300005578 Bacteria 694
166 Ga0068856_100000444 3300005614 Bacteria 45674
167 Ga0068856_100182940 3300005614 Bacteria 2109
168 Ga0068856_100245003 3300005614 Bacteria 1807
169 Ga0068856_100374121 3300005614 Bacteria 1443
170 Ga0068856_100496453 3300005614 Bacteria 1241
171 Ga0068856_100997231 3300005614 Bacteria 856
172 Ga0068856_101074180 3300005614 Bacteria 822
173 Ga0068856_101283554 3300005614 Bacteria 748
174 Ga0068856_101994646 3300005614 Bacteria 591
175 Ga0068856_102495417 3300005614 Bacteria 524
176 Ga0070702_100400620 3300005615 Bacteria 981
177 Ga0068852_100000350 3300005616 Bacteria 31032
178 Ga0068852_100000998 3300005616 Bacteria 18659
179 Ga0068852_100001197 3300005616 Bacteria 17227
180 Ga0068852_100046036 3300005616 Bacteria 3714
181 Ga0068852_100553055 3300005616 Bacteria 1151
182 Ga0068852_100686204 3300005616 Bacteria 1033
183 Ga0068852_100713422 3300005616 Bacteria 1013
184 Ga0068852_100784188 3300005616 Bacteria 966
185 Ga0068852_100838410 3300005616 Bacteria 935
186 Ga0068852_101066774 3300005616 Bacteria 828
187 Ga0068852_101125397 3300005616 Bacteria 805
188 Ga0068852_101387912 3300005616 Bacteria 724
189 Ga0068852_101778076 3300005616 Bacteria 639
190 Ga0068859_100107540 3300005617 Bacteria 2849
191 Ga0068859_100565965 3300005617 Bacteria 1230
192 Ga0068859_100870040 3300005617 Bacteria 987
193 Ga0068864_100003875 3300005618 Bacteria 12316
194 Ga0068864_100083468 3300005618 Bacteria 2806
195 Ga0068864_100102892 3300005618 Bacteria 2535
196 Ga0068864_100166201 3300005618 Bacteria 2009
197 Ga0068864_100635114 3300005618 Bacteria 1039
198 Ga0068866_10030669 3300005718 Bacteria 2583
199 Ga0068851_10076418 3300005834 Bacteria 1742
200 Ga0068851_11102217 3300005834 Bacteria 504
201 Ga0068863_100007156 3300005841 Bacteria 10948
202 Ga0068863_100013893 3300005841 Bacteria 7764
203 Ga0068863_100024293 3300005841 Bacteria 5780
204 Ga0068858_100019195 3300005842 Bacteria 6394
205 Ga0068858_100025351 3300005842 Bacteria 5518
206 Ga0068858_100057912 3300005842 Bacteria 3581
207 Ga0068858_100071259 3300005842 Bacteria 3223
208 Ga0068858_101097878 3300005842 Bacteria 781
209 Ga0068860_100658962 3300005843 Bacteria 1055
210 Ga0070717_10003717 3300006028 Bacteria 10962
211 Ga0070716_100112231 3300006173 Bacteria 1691
212 Ga0070712_100948761 3300006175 Bacteria 743
213 Ga0097621_100057256 3300006237 Bacteria 3187
214 Ga0097621_100138855 3300006237 Bacteria 2075
215 Ga0097621_100162589 3300006237 Bacteria 1920
216 Ga0068871_100050304 3300006358 Bacteria 3371
217 Ga0068871_100150125 3300006358 Bacteria 1987
218 Ga0075434_100485385 3300006871 Bacteria 1256
219 Ga0068865_100014890 3300006881 Bacteria 4950
220 Ga0068865_100191367 3300006881 Bacteria 1582
221 Ga0075436_101569841 3300006914 Bacteria 500
222 Ga0097620_100107546 3300006931 Bacteria 2849
223 Ga0097620_100290904 3300006931 Bacteria 1727
224 Ga0097620_100565981 3300006931 Bacteria 1230
225 Ga0097620_100870036 3300006931 Bacteria 987
226 Ga0105240_10003525 3300009093 Bacteria 24281
227 Ga0105240_10581921 3300009093 Bacteria 1235
228 Ga0105245_10015501 3300009098 Bacteria 6645
229 Ga0105245_10306003 3300009098 Bacteria 1561
230 Ga0105243_10136331 3300009148 Bacteria 2088
231 Ga0105241_10343005 3300009174 Bacteria 1295
232 Ga0105241_11592165 3300009174 Bacteria 631
233 Ga0105241_12161795 3300009174 Bacteria 551
234 Ga0105242_10054009 3300009176 Bacteria 3283
235 Ga0105248_10000719 3300009177 Bacteria 37511
236 Ga0105248_10023597 3300009177 Bacteria 6833
237 Ga0105248_10224780 3300009177 Bacteria 2113
238 Ga0105237_10053336 3300009545 Bacteria 4056
239 Ga0105238_10003663 3300009551 Bacteria 15311
240 Ga0105238_10018382 3300009551 Bacteria 7114
241 Ga0105238_10729771 3300009551 Bacteria 1004
242 Ga0105246_10083331 3300011119 Bacteria 2284
243 Ga0157373_10062429 3300013100 Bacteria 2639
244 Ga0157373_10132852 3300013100 Bacteria 1750
245 Ga0157373_10303170 3300013100 Bacteria 1134
246 Ga0157373_10398184 3300013100 Bacteria 987
247 Ga0157371_10006685 3300013102 Bacteria 9433
248 Ga0157371_10046396 3300013102 Bacteria 3090
249 Ga0157371_10116998 3300013102 Bacteria 1895
250 Ga0157371_10543047 3300013102 Bacteria 861
251 Ga0157371_11078532 3300013102 Bacteria 615
252 Ga0157371_11109125 3300013102 Bacteria 607
253 Ga0157370_10008767 3300013104 Bacteria 10870
254 Ga0157370_10020613 3300013104 Bacteria 6581
255 Ga0157370_10180667 3300013104 Bacteria 1961
256 Ga0157370_10533580 3300013104 Bacteria 1076
257 Ga0157370_10951024 3300013104 Bacteria 779
258 Ga0157370_11217032 3300013104 Bacteria 679
259 Ga0157369_10012516 3300013105 Bacteria 9625
260 Ga0157369_10014649 3300013105 Bacteria 8846
261 Ga0157369_10101701 3300013105 Bacteria 3062
262 Ga0157369_10227341 3300013105 Bacteria 1951
263 Ga0157369_10647026 3300013105 Bacteria 1090
264 Ga0157369_12599728 3300013105 Bacteria 512
265 Ga0157374_10008086 3300013296 Bacteria 8992
266 Ga0157374_10028392 3300013296 Bacteria 5054
267 Ga0157374_10104992 3300013296 Bacteria 2713
268 Ga0157378_10046737 3300013297 Bacteria 3847
269 Ga0157378_10326952 3300013297 Bacteria 1491
270 Ga0157378_10736665 3300013297 Bacteria 1007
271 Ga0157378_11163316 3300013297 Bacteria 810
272 Ga0157378_11439751 3300013297 Bacteria 733
273 Ga0157378_11645784 3300013297 Bacteria 688
274 Ga0163162_10072149 3300013306 Bacteria 3507
275 Ga0163162_11172047 3300013306 Bacteria 872
276 Ga0163162_12652884 3300013306 Bacteria 577
277 Ga0157372_10018495 3300013307 Bacteria 7491
278 Ga0157372_10218839 3300013307 Bacteria 2207
279 Ga0157372_11960432 3300013307 Bacteria 673
280 Ga0157375_10223107 3300013308 Bacteria 2043
281 Ga0163163_10000123 3300014325 Bacteria 82366
282 Ga0182008_10210757 3300014497 Bacteria 991
283 Ga0157377_10045915 3300014745 Bacteria 2441
284 Ga0157379_10054776 3300014968 Bacteria 3563
285 Ga0163161_10035725 3300017792 Bacteria 3557
286 Ga0206354_11597292 3300020081 Bacteria 914
287 Ga0206353_11377395 3300020082 Bacteria 660
288 Ga0206353_11626991 3300020082 Bacteria 2339
289 Ga0213876_10008002 3300021384 Bacteria 5730
290 Ga0207697_10039754 3300025315 Bacteria 1930
291 Ga0207656_10029982 3300025321 Bacteria 2244
292 Ga0207656_10219629 3300025321 Bacteria 923
293 Ga0207682_10010776 3300025893 Bacteria 3580
294 Ga0207642_10135165 3300025899 Bacteria 1292
295 Ga0207710_10765369 3300025900 Bacteria 507
296 Ga0207688_10063610 3300025901 Bacteria 2081
297 Ga0207688_10199344 3300025901 Bacteria 1199
298 Ga0207688_10546014 3300025901 Bacteria 728
299 Ga0207680_10001446 3300025903 Bacteria 11267
300 Ga0207680_10006384 3300025903 Bacteria 5698
301 Ga0207680_10010381 3300025903 Bacteria 4657
302 Ga0207680_10250573 3300025903 Bacteria 1223
303 Ga0207680_10361076 3300025903 Bacteria 1021
304 Ga0207647_10009434 3300025904 Bacteria 6932
305 Ga0207647_10011648 3300025904 Bacteria 6157
306 Ga0207647_10269998 3300025904 Bacteria 972
307 Ga0207645_10282813 3300025907 Bacteria 1102
308 Ga0207645_10798427 3300025907 Bacteria 642
309 Ga0207645_10908666 3300025907 Bacteria 598
310 Ga0207705_10000086 3300025909 Bacteria 116132
311 Ga0207705_10000493 3300025909 Bacteria 33656
312 Ga0207705_10019462 3300025909 Bacteria 4855
313 Ga0207705_10029968 3300025909 Bacteria 3881
314 Ga0207705_10043007 3300025909 Bacteria 3244
315 Ga0207705_10170922 3300025909 Bacteria 1636
316 Ga0207705_10323118 3300025909 Bacteria 1186
317 Ga0207705_10733756 3300025909 Bacteria 767
318 Ga0207654_10045439 3300025911 Bacteria 2499
319 Ga0207654_11215444 3300025911 Bacteria 549
320 Ga0207707_10018643 3300025912 Bacteria 6051
321 Ga0207707_10037036 3300025912 Bacteria 4262
322 Ga0207707_10588801 3300025912 Bacteria 942
323 Ga0207695_10070465 3300025913 Bacteria 3574
324 Ga0207671_10102803 3300025914 Bacteria 2166
325 Ga0207693_10811137 3300025915 Bacteria 721
326 Ga0207660_10000484 3300025917 Bacteria 26514
327 Ga0207660_10003056 3300025917 Bacteria 10947
328 Ga0207660_10007321 3300025917 Bacteria 7142
329 Ga0207660_10009364 3300025917 Bacteria 6338
330 Ga0207660_10296904 3300025917 Bacteria 1286
331 Ga0207660_10749031 3300025917 Bacteria 797
332 Ga0207657_10006522 3300025919 Bacteria 12088
333 Ga0207657_10007307 3300025919 Bacteria 11328
334 Ga0207657_10012533 3300025919 Bacteria 8363
335 Ga0207657_10225598 3300025919 Bacteria 1500
336 Ga0207657_10383461 3300025919 Bacteria 1106
337 Ga0207657_10440542 3300025919 Bacteria 1023
338 Ga0207657_10662440 3300025919 Bacteria 812
339 Ga0207649_10000420 3300025920 Bacteria 31171
340 Ga0207649_10009087 3300025920 Bacteria 5433
341 Ga0207649_10023577 3300025920 Bacteria 3566
342 Ga0207649_10070482 3300025920 Bacteria 2229
343 Ga0207649_10231805 3300025920 Bacteria 1321
344 Ga0207649_10750569 3300025920 Bacteria 759
345 Ga0207649_11024499 3300025920 Bacteria 650
346 Ga0207652_10000034 3300025921 Bacteria 138571
347 Ga0207652_10088866 3300025921 Bacteria 2712
348 Ga0207652_10142099 3300025921 Bacteria 2147
349 Ga0207652_10496814 3300025921 Bacteria 1098
350 Ga0207652_10965919 3300025921 Bacteria 750
351 Ga0207694_10005798 3300025924 Bacteria 9462
352 Ga0207694_10005951 3300025924 Bacteria 9352
353 Ga0207694_10035277 3300025924 Bacteria 3837
354 Ga0207694_10113789 3300025924 Bacteria 2154
355 Ga0207650_10014652 3300025925 Bacteria 5447
356 Ga0207659_10038000 3300025926 Bacteria 3346
357 Ga0207687_11019488 3300025927 Bacteria 710
358 Ga0207700_10053281 3300025928 Bacteria 3030
359 Ga0207664_10013701 3300025929 Bacteria 5831
360 Ga0207644_10000614 3300025931 Bacteria 22677
361 Ga0207644_10000747 3300025931 Bacteria 20633
362 Ga0207644_10012501 3300025931 Bacteria 5641
363 Ga0207644_10071448 3300025931 Bacteria 2539
364 Ga0207644_10779000 3300025931 Bacteria 799
365 Ga0207690_10002581 3300025932 Bacteria 10939
366 Ga0207690_10004814 3300025932 Bacteria 7964
367 Ga0207690_10041403 3300025932 Bacteria 3019
368 Ga0207690_10045049 3300025932 Bacteria 2912
369 Ga0207690_10218524 3300025932 Bacteria 1457
370 Ga0207690_10223329 3300025932 Bacteria 1442
371 Ga0207690_10243023 3300025932 Bacteria 1387
372 Ga0207690_10903223 3300025932 Bacteria 733
373 Ga0207690_11007281 3300025932 Bacteria 693
374 Ga0207706_10000192 3300025933 Bacteria 68319
375 Ga0207706_10016069 3300025933 Bacteria 6765
376 Ga0207706_10025331 3300025933 Bacteria 5316
377 Ga0207706_10102586 3300025933 Bacteria 2517
378 Ga0207706_10536417 3300025933 Bacteria 1008
379 Ga0207709_10722253 3300025935 Bacteria 799
380 Ga0207669_10011179 3300025937 Bacteria 4357
381 Ga0207669_10016923 3300025937 Bacteria 3724
382 Ga0207704_10177150 3300025938 Bacteria 1536
383 Ga0207691_10007087 3300025940 Bacteria 10821
384 Ga0207691_10050832 3300025940 Bacteria 3793
385 Ga0207691_10545020 3300025940 Bacteria 984
386 Ga0207711_10005061 3300025941 Bacteria 11181
387 Ga0207711_10012758 3300025941 Bacteria 6980
388 Ga0207711_10028323 3300025941 Bacteria 4713
389 Ga0207711_10118968 3300025941 Bacteria 2357
390 Ga0207711_10963577 3300025941 Bacteria 792
391 Ga0207689_11356971 3300025942 Bacteria 597
392 Ga0207661_10003062 3300025944 Bacteria 11577
393 Ga0207661_10004478 3300025944 Bacteria 9809
394 Ga0207661_10035714 3300025944 Bacteria 3875
395 Ga0207661_10301851 3300025944 Bacteria 1436
396 Ga0207661_10840953 3300025944 Bacteria 845
397 Ga0207679_10012640 3300025945 Bacteria 5511
398 Ga0207679_10136929 3300025945 Bacteria 1973
399 Ga0207679_10392829 3300025945 Bacteria 1219
400 Ga0207667_10000850 3300025949 Bacteria 39399
401 Ga0207667_10024964 3300025949 Bacteria 6552
402 Ga0207667_10040454 3300025949 Bacteria 4964
403 Ga0207667_10092864 3300025949 Bacteria 3117
404 Ga0207667_10127777 3300025949 Bacteria 2618
405 Ga0207667_10315152 3300025949 Bacteria 1598
406 Ga0207667_11005171 3300025949 Bacteria 821
407 Ga0207667_11625743 3300025949 Bacteria 614
408 Ga0207651_10000915 3300025960 Bacteria 12977
409 Ga0207651_10030292 3300025960 Bacteria 3443
410 Ga0207651_10050070 3300025960 Bacteria 2834
411 Ga0207651_10132986 3300025960 Bacteria 1908
412 Ga0207651_10144969 3300025960 Bacteria 1840
413 Ga0207651_10252904 3300025960 Bacteria 1442
414 Ga0207640_10034911 3300025981 Bacteria 3143
415 Ga0207640_10035946 3300025981 Bacteria 3105
416 Ga0207640_10076887 3300025981 Bacteria 2267
417 Ga0207640_10237475 3300025981 Bacteria 1406
418 Ga0207640_11324412 3300025981 Bacteria 643
419 Ga0207640_11356461 3300025981 Bacteria 636
420 Ga0207658_10041960 3300025986 Bacteria 3316
421 Ga0207658_10071550 3300025986 Bacteria 2626
422 Ga0207658_11520387 3300025986 Bacteria 612
423 Ga0207677_10002385 3300026023 Bacteria 9839
424 Ga0207677_10058435 3300026023 Bacteria 2655
425 Ga0207677_10074576 3300026023 Bacteria 2408
426 Ga0207677_10133789 3300026023 Bacteria 1887
427 Ga0207703_10007259 3300026035 Bacteria 8812
428 Ga0207703_10011293 3300026035 Bacteria 6946
429 Ga0207703_10041346 3300026035 Bacteria 3692
430 Ga0207639_10000923 3300026041 Bacteria 19909
431 Ga0207639_10005442 3300026041 Bacteria 8599
432 Ga0207639_10996189 3300026041 Bacteria 785
433 Ga0207678_10001460 3300026067 Bacteria 21690
434 Ga0207678_10004281 3300026067 Bacteria 12798
435 Ga0207678_10087795 3300026067 Bacteria 2658
436 Ga0207678_10348377 3300026067 Bacteria 1277
437 Ga0207702_10012937 3300026078 Bacteria 6943
438 Ga0207702_10019373 3300026078 Bacteria 5630
439 Ga0207702_10164400 3300026078 Bacteria 2029
440 Ga0207702_10444421 3300026078 Bacteria 1257
441 Ga0207702_11357729 3300026078 Bacteria 705
442 Ga0207641_10003063 3300026088 Bacteria 15070
443 Ga0207641_10013137 3300026088 Bacteria 6791
444 Ga0207641_10068990 3300026088 Bacteria 3033
445 Ga0207641_10302111 3300026088 Bacteria 1512
446 Ga0207648_10002768 3300026089 Bacteria 18606
447 Ga0207648_10642754 3300026089 Bacteria 980
448 Ga0207676_10001223 3300026095 Bacteria 19146
449 Ga0207676_10018572 3300026095 Bacteria 5058
450 Ga0207676_10025079 3300026095 Bacteria 4422
451 Ga0207674_10013046 3300026116 Bacteria 9255
452 Ga0207674_10037622 3300026116 Bacteria 5030
453 Ga0207674_11695366 3300026116 Bacteria 600
454 Ga0207675_100177452 3300026118 Bacteria 2038
455 Ga0207683_10009832 3300026121 Bacteria 8160
456 Ga0207683_10010864 3300026121 Bacteria 7765
457 Ga0207683_10062474 3300026121 Bacteria 3280
458 Ga0207683_10329976 3300026121 Bacteria 1398
459 Ga0207698_10000542 3300026142 Bacteria 21912
460 Ga0207698_10009423 3300026142 Bacteria 6227
461 Ga0207698_10012042 3300026142 Bacteria 5639
462 Ga0207698_10022007 3300026142 Bacteria 4420
463 Ga0207698_10080024 3300026142 Bacteria 2631
464 Ga0207698_10625392 3300026142 Bacteria 1064
465 Ga0207698_11151140 3300026142 Bacteria 789
466 Ga0268266_10034495 3300028379 Bacteria 4304
467 Ga0307517_10535112 3300028786 Bacteria 589
468 Ga0307408_100054817 3300031548 Bacteria 2884
469 Ga0307408_100110825 3300031548 Bacteria 2108
470 Ga0307405_10041480 3300031731 Bacteria 2795
471 Ga0307413_10137148 3300031824 Bacteria 1684
472 Ga0307413_10387556 3300031824 Bacteria 1091
473 Ga0307410_10002317 3300031852 Bacteria 9147
474 Ga0307410_10003097 3300031852 Bacteria 8243
475 Ga0307410_10017727 3300031852 Bacteria 4284
476 Ga0307406_10020799 3300031901 Bacteria 3872
477 Ga0307406_10245868 3300031901 Bacteria 1345
478 Ga0307406_10433501 3300031901 Bacteria 1050
479 Ga0307407_10128165 3300031903 Bacteria 1619
480 Ga0307409_100012763 3300031995 Bacteria 5368
481 Ga0307416_100451512 3300032002 Bacteria 1338
482 Ga0307414_10085576 3300032004 Bacteria 2323
483 Ga0307414_10175707 3300032004 Bacteria 1717
484 Ga0307414_12204579 3300032004 Bacteria 514
485 Ga0307411_10004645 3300032005 Bacteria 6617
486 Ga0307411_10022197 3300032005 Bacteria 3732
487 Ga0307411_10485452 3300032005 Bacteria 1041
488 Ga0307415_100048310 3300032126 Bacteria 2871
489 Ga0373928_0073014 3300035084 Unclassified 852
490 Ga0373941_0068306 3300035115 Bacteria 1174
491 Ga0373941_0536038 3300035115 Bacteria 502
492 Ga0373942_0053347 3300035207 Bacteria 1140
493 Ga0373931_0009791 3300035691 Bacteria 4589
494 Ga0373931_0200163 3300035691 Bacteria 1193
495 Ga0395899_0000669 3300037312 Bacteria 34717
496 Ga0395899_0005034 3300037312 Bacteria 10275
497 Ga0395899_0011007 3300037312 Bacteria 6928
498 Ga0395899_0013002 3300037312 Bacteria 6369
499 Ga0395899_0020519 3300037312 Bacteria 5009
500 Ga0395899_0024800 3300037312 Bacteria 4531
501 Ga0395899_0104860 3300037312 Bacteria 2037
502 Ga0395899_0186612 3300037312 Bacteria 1453
503 Ga0395899_0273007 3300037312 Bacteria 1153
504 Ga0395899_0275681 3300037312 Bacteria 1146
505 Ga0395899_0327510 3300037312 Bacteria 1030
506 Ga0395899_0354416 3300037312 Bacteria 980
507 Ga0395899_0456623 3300037312 Bacteria 835
508 Ga0395899_0543145 3300037312 Bacteria 748
509 Ga0395899_0639381 3300037312 Bacteria 673
510 Ga0395899_0689662 3300037312 Bacteria 641
511 Ga0395899_0755451 3300037312 Bacteria 605
512 Ga0395900_0001777 3300037418 Bacteria 24746
513 Ga0395900_0003481 3300037418 Bacteria 16989
514 Ga0395900_0014867 3300037418 Bacteria 7931
515 Ga0395900_0035696 3300037418 Bacteria 5122
516 Ga0395900_0038732 3300037418 Bacteria 4914
517 Ga0395900_0043887 3300037418 Bacteria 4608
518 Ga0395900_0048043 3300037418 Bacteria 4395
519 Ga0395900_0059959 3300037418 Bacteria 3916
520 Ga0395900_0069573 3300037418 Bacteria 3617
521 Ga0395900_0120136 3300037418 Bacteria 2696
522 Ga0395900_0253266 3300037418 Bacteria 1761
523 Ga0395900_0415991 3300037418 Bacteria 1306
524 Ga0395900_0516150 3300037418 Bacteria 1143
525 Ga0395900_0531776 3300037418 Bacteria 1122
526 Ga0395900_0553697 3300037418 Bacteria 1094
527 Ga0395900_0584523 3300037418 Bacteria 1058
528 Ga0395900_0661602 3300037418 Bacteria 980
529 Ga0395900_0786008 3300037418 Bacteria 880
530 Ga0395900_0836603 3300037418 Bacteria 847
531 Ga0395900_0840478 3300037418 Bacteria 844
532 Ga0395900_0882367 3300037418 Bacteria 818
533 Ga0395900_0895704 3300037418 Bacteria 811
534 Ga0395900_1425600 3300037418 Bacteria 605
535 Ga0395900_1632192 3300037418 Bacteria 556
536 Ga0395898_0019146 3300037466 Bacteria 6969
537 Ga0395898_0088387 3300037466 Bacteria 2983
538 Ga0395898_0105554 3300037466 Bacteria 2701
539 Ga0395898_0133963 3300037466 Bacteria 2372
540 Ga0395898_0158296 3300037466 Bacteria 2166
541 Ga0395898_0229468 3300037466 Bacteria 1770
542 Ga0395898_0403705 3300037466 Bacteria 1303
543 Ga0395898_0471627 3300037466 Bacteria 1194
544 Ga0395898_0611404 3300037466 Bacteria 1033
545 Ga0395898_0890323 3300037466 Bacteria 828
546 Ga0395905_0000005 3300037471 Bacteria 557808
547 Ga0395905_0000558 3300037471 Bacteria 50819
548 Ga0395905_0002727 3300037471 Bacteria 19339
549 Ga0395905_0008899 3300037471 Bacteria 9862
550 Ga0395905_0019970 3300037471 Bacteria 6349
551 Ga0395905_0033725 3300037471 Bacteria 4808
552 Ga0395905_0035280 3300037471 Bacteria 4696
553 Ga0395905_0036601 3300037471 Bacteria 4609
554 Ga0395905_0072309 3300037471 Bacteria 3233
555 Ga0395905_0085473 3300037471 Bacteria 2956
556 Ga0395905_0086051 3300037471 Bacteria 2945
557 Ga0395905_0098243 3300037471 Bacteria 2749
558 Ga0395905_0184351 3300037471 Bacteria 1959
559 Ga0395905_0212184 3300037471 Bacteria 1814
560 Ga0395905_0362536 3300037471 Bacteria 1342
561 Ga0395905_0442227 3300037471 Bacteria 1197
562 Ga0395905_0471979 3300037471 Bacteria 1154
563 Ga0395905_0549958 3300037471 Bacteria 1055
564 Ga0395905_0549971 3300037471 Bacteria 1055
565 Ga0395905_0625715 3300037471 Bacteria 978
566 Ga0395905_0661366 3300037471 Bacteria 947
567 Ga0395905_0941787 3300037471 Unclassified 766
568 Ga0395905_1399125 3300037471 Bacteria 604
569 Ga0395901_0001728 3300038443 Bacteria 22552
570 Ga0395901_0015662 3300038443 Bacteria 7723
571 Ga0395901_0025237 3300038443 Bacteria 6101
572 Ga0395901_0030649 3300038443 Bacteria 5542
573 Ga0395901_0041896 3300038443 Bacteria 4746
574 Ga0395901_0051606 3300038443 Bacteria 4276
575 Ga0395901_0069109 3300038443 Bacteria 3678
576 Ga0395901_0170698 3300038443 Bacteria 2282
577 Ga0395901_0194206 3300038443 Bacteria 2128
578 Ga0395901_0222797 3300038443 Bacteria 1971
579 Ga0395901_0260376 3300038443 Bacteria 1805
580 Ga0395901_0277449 3300038443 Bacteria 1742
581 Ga0395901_0304934 3300038443 Bacteria 1650
582 Ga0395901_0368085 3300038443 Bacteria 1481
583 Ga0395901_0501195 3300038443 Bacteria 1236
584 Ga0395901_0677222 3300038443 Bacteria 1031
585 Ga0395901_0706414 3300038443 Bacteria 1005
586 Ga0395901_0776200 3300038443 Bacteria 949
587 Ga0395901_1354814 3300038443 Bacteria 671
588 Ga0395901_1977337 3300038443 Bacteria 529
589 Ga0439448_0011166 3300042005 Bacteria 2673
590 Ga0439455_0002650 3300042012 Bacteria 3292
591 Ga0439458_0000816 3300042157 Bacteria 8017
592 Ga0439458_0008340 3300042157 Bacteria 2306
593 Ga0466969_0152775 3300044656 Bacteria 1063
594 Ga0466972_0014603 3300044658 Bacteria 3932
595 Ga0466972_0141110 3300044658 Bacteria 1134
596 Ga0466972_0198888 3300044658 Bacteria 939
597 Ga0466972_0376596 3300044658 Bacteria 665
598 Ga0466965_0098468 3300044683 Bacteria 1493
599 Ga0466965_0300262 3300044683 Bacteria 871
600 Ga0466966_0130108 3300044684 Bacteria 1542
601 Ga0466966_0196966 3300044684 Bacteria 1220
602 Ga0466966_0308736 3300044684 Bacteria 951
603 Ga0466961_0007193 3300044693 Bacteria 7080
604 Ga0466963_0014689 3300044694 Bacteria 4832
605 Ga0466963_0082272 3300044694 Bacteria 2182
606 Ga0466963_0157954 3300044694 Bacteria 1577
607 Ga0466963_0165852 3300044694 Bacteria 1538
608 Ga0466963_0314866 3300044694 Bacteria 1101
609 Ga0466964_0004778 3300044706 Bacteria 5010
610 Ga0466964_0084466 3300044706 Bacteria 1369
611 Ga0466971_0473276 3300044719 Bacteria 616
612 Ga0466968_0002423 3300044735 Bacteria 6841
613 Ga0466970_0019719 3300044765 Bacteria 3498
614 Ga0466970_0173918 3300044765 Bacteria 1194
615 Ga0466957_0001422 3300044842 Bacteria 12499
616 Ga0466957_0705543 3300044842 Bacteria 712
617 Ga0466957_0745390 3300044842 Bacteria 693
618 Ga0466957_0908844 3300044842 Bacteria 629
619 Ga0466960_0166730 3300044901 Bacteria 1186
620 Ga0466959_0005408 3300045049 Bacteria 8740
621 Ga0466959_0197690 3300045049 Bacteria 1401
622 Ga0466958_0002868 3300045836 Bacteria 8783
623 Ga0466958_0192274 3300045836 Bacteria 1297
624 Ga0466958_0251925 3300045836 Bacteria 1129
625 Ga0466958_0514215 3300045836 Bacteria 777
626 Ga0466967_0003049 3300045976 Bacteria 10750
627 Ga0466967_0042610 3300045976 Bacteria 3923
628 Ga0466967_0073139 3300045976 Bacteria 3074
629 Ga0466967_0100090 3300045976 Bacteria 2648
630 Ga0466967_0130257 3300045976 Bacteria 2334
631 Ga0466967_0142041 3300045976 Bacteria 2237
632 Ga0466967_0199503 3300045976 Bacteria 1894
633 Ga0466967_0231366 3300045976 Bacteria 1760
634 Ga0466967_0240066 3300045976 Bacteria 1728
635 Ga0466967_0480518 3300045976 Bacteria 1217
636 Ga0466967_0641694 3300045976 Bacteria 1050
637 Ga0466967_0670425 3300045976 Bacteria 1026
638 Ga0466967_0733205 3300045976 Bacteria 980
639 Ga0466967_2573977 3300045976 Bacteria 503
640 Ga0495643_0058572 3300046522 Bacteria 2050
641 Ga0495663_0052904 3300046525 Bacteria 1261
642 Ga0495642_0569559 3300046528 Bacteria 503
643 Ga0495621_0021215 3300046539 Bacteria 2140
644 Ga0495669_0005373 3300046684 Bacteria 5341
645 Ga0496100_0573001 3300048903 Bacteria 875
646 Ga0496102_0514492 3300048905 Bacteria 1119
647 Ga0496104_0795459 3300048907 Bacteria 852
648 Ga0496105_0141691 3300048908 Bacteria 1979
649 Ga0496105_0943393 3300048908 Bacteria 648
650 Ga0496106_0029937 3300048909 Bacteria 4059
651 Ga0496106_1249353 3300048909 Bacteria 578
652 Ga0496107_0035323 3300048910 Bacteria 3584
653 Ga0496107_0086788 3300048910 Bacteria 2284
654 Ga0496109_0736327 3300048912 Bacteria 924
655 Ga0496109_1974530 3300048912 Bacteria 515
656 Ga0496110_0100447 3300048913 Bacteria 2593
657 Ga0496110_0621313 3300048913 Bacteria 979
658 Ga0496110_1809901 3300048913 Bacteria 521
659 Ga0496111_0840555 3300048914 Bacteria 663
660 Ga0496112_0026946 3300048915 Bacteria 5539
661 Ga0496112_0451340 3300048915 Bacteria 1223
662 Ga0496113_0069227 3300048916 Bacteria 2680
663 Ga0496114_0049943 3300048917 Bacteria 3481
664 Ga0496115_0866461 3300048918 Bacteria 698
665 Ga0501067_0036110 3300049583 Bacteria 2745
666 Ga0501068_0609014 3300049584 Bacteria 712
667 Ga0501069_0402951 3300049585 Bacteria 810
668 Ga0501074_0121877 3300049590 Bacteria 1865
669 Ga0501083_1102342 3300049744 Bacteria 517
670 nmdc:mga0n895_1023029_c1 3300050512 Bacteria 806
671 Ga0466962_0095642 3300061719 Bacteria 1424
672 Ga0395900_0055048
673 JGI24747J21853_1000483
674 JGI24740J21852_10005046
675 JGI24740J21852_10015625
676 JGI24739J22299_10161851
677 JGI24737J22298_10001784
678 JGI24737J22298_10004604
679 JGI24737J22298_10015381
680 JGI24735J21928_10003490
681 JGI24735J21928_10006396
682 JGI24738J21930_10001857
683 JGI24744J21845_10000252
684 Ga0065715_10059421
685 Ga0070658_10000269
686 Ga0070658_10016854
687 Ga0070658_10021051
688 Ga0070658_10032345
689 Ga0070658_10202252
690 Ga0070658_10603274
691 Ga0070658_10994148
692 Ga0070676_10139745
693 Ga0070676_10229238
694 Ga0070676_10469032
695 Ga0070683_100000781
696 Ga0070683_100021095
697 Ga0070683_100489602
698 Ga0070683_101236888
699 Ga0070690_100009956
700 Ga0070690_100375791
701 Ga0070690_101041007
702 Ga0070670_100038039
703 Ga0070677_10021797
704 Ga0068869_100076249
705 Ga0068869_100844101
706 Ga0070666_10002236
707 Ga0070666_10004179
708 Ga0070666_10006211
709 Ga0070666_10047834
710 Ga0070666_10093746
711 Ga0070680_100001257
712 Ga0070680_100002339
713 Ga0070680_100003004
714 Ga0070680_100011573
715 Ga0070680_100221893
716 Ga0070680_100653761
717 Ga0068868_100002917
718 Ga0068868_100091424
719 Ga0068868_100181437
720 Ga0068868_101020952
721 Ga0070660_100000109
722 Ga0070660_100006463
723 Ga0070660_100014087
724 Ga0070660_100108810
725 Ga0070660_100132077
726 Ga0070660_100365284
727 Ga0070691_10100057
728 Ga0070661_100000070
729 Ga0070661_100023288
730 Ga0070661_100060376
731 Ga0070661_100092826
732 Ga0070661_101712549
733 Ga0070692_10018534
734 Ga0070692_10048347
735 Ga0070692_10084086
736 Ga0070675_100059386
737 Ga0070675_100701526
738 Ga0070671_100005172
739 Ga0070671_100022777
740 Ga0070671_100069212
741 Ga0070671_100087416
742 Ga0070671_100129706
743 Ga0070671_100139600
744 Ga0070671_100183185
745 Ga0070671_101062172
746 Ga0070674_100003944
747 Ga0070674_100009013
748 Ga0070673_100000526
749 Ga0070673_100014589
750 Ga0070673_100178140
751 Ga0070673_100182977
752 Ga0070673_100408989
753 Ga0070659_100000312
754 Ga0070659_100023152
755 Ga0070659_100304595
756 Ga0070659_100307820
757 Ga0070659_100363873
758 Ga0070659_100445650
759 Ga0070667_100019471
760 Ga0070667_100052963
761 Ga0070667_100077119
762 Ga0070667_100482484
763 Ga0070667_100553972
764 Ga0070714_100003924
765 Ga0070714_100045702
766 Ga0070713_100031313
767 Ga0070663_100003412
768 Ga0070663_100013578
769 Ga0070663_100016737
770 Ga0070663_100333817
771 Ga0070678_100003435
772 Ga0070678_100045757
773 Ga0070678_100130260
774 Ga0070678_100315250
775 Ga0070662_100000037
776 Ga0070662_100007521
777 Ga0070662_100014679
778 Ga0070662_100021118
779 Ga0070662_100069302
780 Ga0070662_100114924
781 Ga0070662_100355716
782 Ga0070662_100385283
783 Ga0070662_101824970
784 Ga0070681_10080293
785 Ga0070681_10163687
786 Ga0070681_10946052
787 Ga0068867_100019089
788 Ga0068867_100074141
789 Ga0068867_100448625
790 Ga0070685_10734326
791 Ga0070685_11217532
792 Ga0070679_100032167
793 Ga0070679_100199670
794 Ga0070679_100267645
795 Ga0070679_100381257
796 Ga0070679_100502407
797 Ga0070679_100526773
798 Ga0070679_101276560
799 Ga0070684_100001938
800 Ga0070684_100006272
801 Ga0070684_102323734
802 Ga0068853_100000213
803 Ga0068853_100009556
804 Ga0068853_100118479
805 Ga0068853_100147153
806 Ga0070672_100005950
807 Ga0070672_100581158
808 Ga0070672_100608044
809 Ga0070686_100155418
810 Ga0070686_101602607
811 Ga0070693_100002515
812 Ga0070693_100055655
813 Ga0070665_100055436
814 Ga0070665_100165774
815 Ga0070665_100792175
816 Ga0068855_100004288
817 Ga0068855_100038922
818 Ga0068855_100056131
819 Ga0068855_100061623
820 Ga0068855_100243561
821 Ga0068855_100368981
822 Ga0068855_100916912
823 Ga0068855_101127602
824 Ga0068855_101292262
825 Ga0070664_100000077
826 Ga0070664_100430355
827 Ga0070664_100591263
828 Ga0068857_100007354
829 Ga0068857_100101079
830 Ga0068857_102127704
831 Ga0068857_102561866
832 Ga0068854_100040129
833 Ga0068854_100049427
834 Ga0068854_100078155
835 Ga0068854_100132376
836 Ga0068854_101146308
837 Ga0068856_100000444
838 Ga0068856_100182940
839 Ga0068856_100245003
840 Ga0068856_100374121
841 Ga0068856_100496453
842 Ga0068856_100997231
843 Ga0068856_101074180
844 Ga0068856_101283554
845 Ga0068856_101994646
846 Ga0068856_102495417
847 Ga0070702_100400620
848 Ga0068852_100000350
849 Ga0068852_100000998
850 Ga0068852_100001197
851 Ga0068852_100046036
852 Ga0068852_100553055
853 Ga0068852_100686204
854 Ga0068852_100713422
855 Ga0068852_100784188
856 Ga0068852_100838410
857 Ga0068852_101066774
858 Ga0068852_101125397
859 Ga0068852_101387912
860 Ga0068852_101778076
861 Ga0068859_100107540
862 Ga0068859_100565965
863 Ga0068859_100870040
864 Ga0068864_100003875
865 Ga0068864_100083468
866 Ga0068864_100102892
867 Ga0068864_100166201
868 Ga0068864_100635114
869 Ga0068866_10030669
870 Ga0068851_10076418
871 Ga0068851_11102217
872 Ga0068863_100007156
873 Ga0068863_100013893
874 Ga0068863_100024293
875 Ga0068858_100019195
876 Ga0068858_100025351
877 Ga0068858_100057912
878 Ga0068858_100071259
879 Ga0068858_101097878
880 Ga0068860_100658962
881 Ga0070717_10003717
882 Ga0070716_100112231
883 Ga0070712_100948761
884 Ga0097621_100057256
885 Ga0097621_100138855
886 Ga0097621_100162589
887 Ga0068871_100050304
888 Ga0068871_100150125
889 Ga0075434_100485385
890 Ga0068865_100014890
891 Ga0068865_100191367
892 Ga0075436_101569841
893 Ga0097620_100107546
894 Ga0097620_100290904
895 Ga0097620_100565981
896 Ga0097620_100870036
897 Ga0105240_10003525
898 Ga0105240_10581921
899 Ga0105245_10015501
900 Ga0105245_10306003
901 Ga0105243_10136331
902 Ga0105241_10343005
903 Ga0105241_11592165
904 Ga0105241_12161795
905 Ga0105242_10054009
906 Ga0105248_10000719
907 Ga0105248_10023597
908 Ga0105248_10224780
909 Ga0105237_10053336
910 Ga0105238_10003663
911 Ga0105238_10018382
912 Ga0105238_10729771
913 Ga0105246_10083331
914 Ga0157373_10062429
915 Ga0157373_10132852
916 Ga0157373_10303170
917 Ga0157373_10398184
918 Ga0157371_10006685
919 Ga0157371_10046396
920 Ga0157371_10116998
921 Ga0157371_10543047
922 Ga0157371_11078532
923 Ga0157371_11109125
924 Ga0157370_10008767
925 Ga0157370_10020613
926 Ga0157370_10180667
927 Ga0157370_10533580
928 Ga0157370_10951024
929 Ga0157370_11217032
930 Ga0157369_10012516
931 Ga0157369_10014649
932 Ga0157369_10101701
933 Ga0157369_10227341
934 Ga0157369_10647026
935 Ga0157369_12599728
936 Ga0157374_10008086
937 Ga0157374_10028392
938 Ga0157374_10104992
939 Ga0157378_10046737
940 Ga0157378_10326952
941 Ga0157378_10736665
942 Ga0157378_11163316
943 Ga0157378_11439751
944 Ga0157378_11645784
945 Ga0163162_10072149
946 Ga0163162_11172047
947 Ga0163162_12652884
948 Ga0157372_10018495
949 Ga0157372_10218839
950 Ga0157372_11960432
951 Ga0157375_10223107
952 Ga0163163_10000123
953 Ga0182008_10210757
954 Ga0157377_10045915
955 Ga0157379_10054776
956 Ga0163161_10035725
957 Ga0206354_11597292
958 Ga0206353_11377395
959 Ga0206353_11626991
960 Ga0213876_10008002
961 Ga0207697_10039754
962 Ga0207656_10029982
963 Ga0207656_10219629
964 Ga0207682_10010776
965 Ga0207642_10135165
966 Ga0207710_10765369
967 Ga0207688_10063610
968 Ga0207688_10199344
969 Ga0207688_10546014
970 Ga0207680_10001446
971 Ga0207680_10006384
972 Ga0207680_10010381
973 Ga0207680_10250573
974 Ga0207680_10361076
975 Ga0207647_10009434
976 Ga0207647_10011648
977 Ga0207647_10269998
978 Ga0207645_10282813
979 Ga0207645_10798427
980 Ga0207645_10908666
981 Ga0207705_10000086
982 Ga0207705_10000493
983 Ga0207705_10019462
984 Ga0207705_10029968
985 Ga0207705_10043007
986 Ga0207705_10170922
987 Ga0207705_10323118
988 Ga0207705_10733756
989 Ga0207654_10045439
990 Ga0207654_11215444
991 Ga0207707_10018643
992 Ga0207707_10037036
993 Ga0207707_10588801
994 Ga0207695_10070465
995 Ga0207671_10102803
996 Ga0207693_10811137
997 Ga0207660_10000484
998 Ga0207660_10003056
999 Ga0207660_10007321
1000 Ga0207660_10009364
1001 Ga0207660_10296904
1002 Ga0207660_10749031
1003 Ga0207657_10006522
1004 Ga0207657_10007307
1005 Ga0207657_10012533
1006 Ga0207657_10225598
1007 Ga0207657_10383461
1008 Ga0207657_10440542
1009 Ga0207657_10662440
1010 Ga0207649_10000420
1011 Ga0207649_10009087
1012 Ga0207649_10023577
1013 Ga0207649_10070482
1014 Ga0207649_10231805
1015 Ga0207649_10750569
1016 Ga0207649_11024499
1017 Ga0207652_10000034
1018 Ga0207652_10088866
1019 Ga0207652_10142099
1020 Ga0207652_10496814
1021 Ga0207652_10965919
1022 Ga0207694_10005798
1023 Ga0207694_10005951
1024 Ga0207694_10035277
1025 Ga0207694_10113789
1026 Ga0207650_10014652
1027 Ga0207659_10038000
1028 Ga0207687_11019488
1029 Ga0207700_10053281
1030 Ga0207664_10013701
1031 Ga0207644_10000614
1032 Ga0207644_10000747
1033 Ga0207644_10012501
1034 Ga0207644_10071448
1035 Ga0207644_10779000
1036 Ga0207690_10002581
1037 Ga0207690_10004814
1038 Ga0207690_10041403
1039 Ga0207690_10045049
1040 Ga0207690_10218524
1041 Ga0207690_10223329
1042 Ga0207690_10243023
1043 Ga0207690_10903223
1044 Ga0207690_11007281
1045 Ga0207706_10000192
1046 Ga0207706_10016069
1047 Ga0207706_10025331
1048 Ga0207706_10102586
1049 Ga0207706_10536417
1050 Ga0207709_10722253
1051 Ga0207669_10011179
1052 Ga0207669_10016923
1053 Ga0207704_10177150
1054 Ga0207691_10007087
1055 Ga0207691_10050832
1056 Ga0207691_10545020
1057 Ga0207711_10005061
1058 Ga0207711_10012758
1059 Ga0207711_10028323
1060 Ga0207711_10118968
1061 Ga0207711_10963577
1062 Ga0207689_11356971
1063 Ga0207661_10003062
1064 Ga0207661_10004478
1065 Ga0207661_10035714
1066 Ga0207661_10301851
1067 Ga0207661_10840953
1068 Ga0207679_10012640
1069 Ga0207679_10136929
1070 Ga0207679_10392829
1071 Ga0207667_10000850
1072 Ga0207667_10024964
1073 Ga0207667_10040454
1074 Ga0207667_10092864
1075 Ga0207667_10127777
1076 Ga0207667_10315152
1077 Ga0207667_11005171
1078 Ga0207667_11625743
1079 Ga0207651_10000915
1080 Ga0207651_10030292
1081 Ga0207651_10050070
1082 Ga0207651_10132986
1083 Ga0207651_10144969
1084 Ga0207651_10252904
1085 Ga0207640_10034911
1086 Ga0207640_10035946
1087 Ga0207640_10076887
1088 Ga0207640_10237475
1089 Ga0207640_11324412
1090 Ga0207640_11356461
1091 Ga0207658_10041960
1092 Ga0207658_10071550
1093 Ga0207658_11520387
1094 Ga0207677_10002385
1095 Ga0207677_10058435
1096 Ga0207677_10074576
1097 Ga0207677_10133789
1098 Ga0207703_10007259
1099 Ga0207703_10011293
1100 Ga0207703_10041346
1101 Ga0207639_10000923
1102 Ga0207639_10005442
1103 Ga0207639_10996189
1104 Ga0207678_10001460
1105 Ga0207678_10004281
1106 Ga0207678_10087795
1107 Ga0207678_10348377
1108 Ga0207702_10012937
1109 Ga0207702_10019373
1110 Ga0207702_10164400
1111 Ga0207702_10444421
1112 Ga0207702_11357729
1113 Ga0207641_10003063
1114 Ga0207641_10013137
1115 Ga0207641_10068990
1116 Ga0207641_10302111
1117 Ga0207648_10002768
1118 Ga0207648_10642754
1119 Ga0207676_10001223
1120 Ga0207676_10018572
1121 Ga0207676_10025079
1122 Ga0207674_10013046
1123 Ga0207674_10037622
1124 Ga0207674_11695366
1125 Ga0207675_100177452
1126 Ga0207683_10009832
1127 Ga0207683_10010864
1128 Ga0207683_10062474
1129 Ga0207683_10329976
1130 Ga0207698_10000542
1131 Ga0207698_10009423
1132 Ga0207698_10012042
1133 Ga0207698_10022007
1134 Ga0207698_10080024
1135 Ga0207698_10625392
1136 Ga0207698_11151140
1137 Ga0268266_10034495
1138 Ga0307517_10535112
1139 Ga0307408_100054817
1140 Ga0307408_100110825
1141 Ga0307405_10041480
1142 Ga0307413_10137148
1143 Ga0307413_10387556
1144 Ga0307410_10002317
1145 Ga0307410_10003097
1146 Ga0307410_10017727
1147 Ga0307406_10020799
1148 Ga0307406_10245868
1149 Ga0307406_10433501
1150 Ga0307407_10128165
1151 Ga0307409_100012763
1152 Ga0307416_100451512
1153 Ga0307414_10085576
1154 Ga0307414_10175707
1155 Ga0307414_12204579
1156 Ga0307411_10004645
1157 Ga0307411_10022197
1158 Ga0307411_10485452
1159 Ga0307415_100048310
1160 Ga0373928_0073014
1161 Ga0373941_0068306
1162 Ga0373941_0536038
1163 Ga0373942_0053347
1164 Ga0373931_0009791
1165 Ga0373931_0200163
1166 Ga0395899_0000669
1167 Ga0395899_0005034
1168 Ga0395899_0011007
1169 Ga0395899_0013002
1170 Ga0395899_0020519
1171 Ga0395899_0024800
1172 Ga0395899_0104860
1173 Ga0395899_0186612
1174 Ga0395899_0273007
1175 Ga0395899_0275681
1176 Ga0395899_0327510
1177 Ga0395899_0354416
1178 Ga0395899_0456623
1179 Ga0395899_0543145
1180 Ga0395899_0639381
1181 Ga0395899_0689662
1182 Ga0395899_0755451
1183 Ga0395900_0001777
1184 Ga0395900_0003481
1185 Ga0395900_0014867
1186 Ga0395900_0035696
1187 Ga0395900_0038732
1188 Ga0395900_0043887
1189 Ga0395900_0048043
1190 Ga0395900_0059959
1191 Ga0395900_0069573
1192 Ga0395900_0120136
1193 Ga0395900_0253266
1194 Ga0395900_0415991
1195 Ga0395900_0516150
1196 Ga0395900_0531776
1197 Ga0395900_0553697
1198 Ga0395900_0584523
1199 Ga0395900_0661602
1200 Ga0395900_0786008
1201 Ga0395900_0836603
1202 Ga0395900_0840478
1203 Ga0395900_0882367
1204 Ga0395900_0895704
1205 Ga0395900_1425600
1206 Ga0395900_1632192
1207 Ga0395898_0019146
1208 Ga0395898_0088387
1209 Ga0395898_0105554
1210 Ga0395898_0133963
1211 Ga0395898_0158296
1212 Ga0395898_0229468
1213 Ga0395898_0403705
1214 Ga0395898_0471627
1215 Ga0395898_0611404
1216 Ga0395898_0890323
1217 Ga0395905_0000005
1218 Ga0395905_0000558
1219 Ga0395905_0002727
1220 Ga0395905_0008899
1221 Ga0395905_0019970
1222 Ga0395905_0033725
1223 Ga0395905_0035280
1224 Ga0395905_0036601
1225 Ga0395905_0072309
1226 Ga0395905_0085473
1227 Ga0395905_0086051
1228 Ga0395905_0098243
1229 Ga0395905_0184351
1230 Ga0395905_0212184
1231 Ga0395905_0362536
1232 Ga0395905_0442227
1233 Ga0395905_0471979
1234 Ga0395905_0549958
1235 Ga0395905_0549971
1236 Ga0395905_0625715
1237 Ga0395905_0661366
1238 Ga0395905_0941787
1239 Ga0395905_1399125
1240 Ga0395901_0001728
1241 Ga0395901_0015662
1242 Ga0395901_0025237
1243 Ga0395901_0030649
1244 Ga0395901_0041896
1245 Ga0395901_0051606
1246 Ga0395901_0069109
1247 Ga0395901_0170698
1248 Ga0395901_0194206
1249 Ga0395901_0222797
1250 Ga0395901_0260376
1251 Ga0395901_0277449
1252 Ga0395901_0304934
1253 Ga0395901_0368085
1254 Ga0395901_0501195
1255 Ga0395901_0677222
1256 Ga0395901_0706414
1257 Ga0395901_0776200
1258 Ga0395901_1354814
1259 Ga0395901_1977337
1260 Ga0439448_0011166
1261 Ga0439455_0002650
1262 Ga0439458_0000816
1263 Ga0439458_0008340
1264 Ga0466969_0152775
1265 Ga0466972_0014603
1266 Ga0466972_0141110
1267 Ga0466972_0198888
1268 Ga0466972_0376596
1269 Ga0466965_0098468
1270 Ga0466965_0300262
1271 Ga0466966_0130108
1272 Ga0466966_0196966
1273 Ga0466966_0308736
1274 Ga0466961_0007193
1275 Ga0466963_0014689
1276 Ga0466963_0082272
1277 Ga0466963_0157954
1278 Ga0466963_0165852
1279 Ga0466963_0314866
1280 Ga0466964_0004778
1281 Ga0466964_0084466
1282 Ga0466971_0473276
1283 Ga0466968_0002423
1284 Ga0466970_0019719
1285 Ga0466970_0173918
1286 Ga0466957_0001422
1287 Ga0466957_0705543
1288 Ga0466957_0745390
1289 Ga0466957_0908844
1290 Ga0466960_0166730
1291 Ga0466959_0005408
1292 Ga0466959_0197690
1293 Ga0466958_0002868
1294 Ga0466958_0192274
1295 Ga0466958_0251925
1296 Ga0466958_0514215
1297 Ga0466967_0003049
1298 Ga0466967_0042610
1299 Ga0466967_0073139
1300 Ga0466967_0100090
1301 Ga0466967_0130257
1302 Ga0466967_0142041
1303 Ga0466967_0199503
1304 Ga0466967_0231366
1305 Ga0466967_0240066
1306 Ga0466967_0480518
1307 Ga0466967_0641694
1308 Ga0466967_0670425
1309 Ga0466967_0733205
1310 Ga0466967_2573977
1311 Ga0495643_0058572
1312 Ga0495663_0052904
1313 Ga0495642_0569559
1314 Ga0495621_0021215
1315 Ga0495669_0005373
1316 Ga0496100_0573001
1317 Ga0496102_0514492
1318 Ga0496104_0795459
1319 Ga0496105_0141691
1320 Ga0496105_0943393
1321 Ga0496106_0029937
1322 Ga0496106_1249353
1323 Ga0496107_0035323
1324 Ga0496107_0086788
1325 Ga0496109_0736327
1326 Ga0496109_1974530
1327 Ga0496110_0100447
1328 Ga0496110_0621313
1329 Ga0496110_1809901
1330 Ga0496111_0840555
1331 Ga0496112_0026946
1332 Ga0496112_0451340
1333 Ga0496113_0069227
1334 Ga0496114_0049943
1335 Ga0496115_0866461
1336 Ga0501067_0036110
1337 Ga0501068_0609014
1338 Ga0501069_0402951
1339 Ga0501074_0121877
1340 Ga0501083_1102342
1341 nmdc:mga0n895_1023029_c1
1342 Ga0466962_0095642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06170

DUF983

Protein of unknown function (DUF983)

50

133

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7etw-assembly1.cif.gz_A cryo-em structure of scap/insig complex in the present of digitonin. 0.6611 43 109
5gas-assembly1.cif.gz_U thermus thermophilus v/a-atpase, conformation 2 0.4732 37 97
7ajb-assembly1.cif.gz_a bovine atp synthase dimer state1:state1 0.4565 53 111
5gas-assembly1.cif.gz_Q thermus thermophilus v/a-atpase, conformation 2 0.4398 37 106
7ajf-assembly1.cif.gz_a bovine atp synthase dimer state2:state2 0.4381 53 108
ID Description Score Start End Superfamily
af_Q54DE8_365_465_1.10.472.100 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Presenilin 0.653 43 101 1.10.472.100
af_A5A630_30_91_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6109 33 96 1.10.287.70
af_Q2FZQ5_283_457_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.5656 46 113 1.10.357.20
af_A5A630_30_91_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5611 33 96 1.10.287.70
af_Q2G0I1_12_195_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.5267 38 115 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A2V5BK83-F1-model_v4 deleted 0.9445 14 117
AF-A0A4Q4CX04-F1-model_v4 DUF983 domain-containing protein 0.9445 10 114 GO:0016020
AF-A0A7X9WUL8-F1-model_v4 DUF983 domain-containing protein 0.9374 11 115 GO:0016020
AF-A0A552U7N1-F1-model_v4 DUF983 domain-containing protein 0.933 12 116 GO:0016020
AF-A0A1L3ZVB8-F1-model_v4 DUF983 domain-containing protein 0.9321 11 117 GO:0016020

Map