F474191

General Info

Members Datasets Scaffolds Average Seq Length
671 447 1342 170

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0048319|Ga0501080_0048319_1566_2075
Length 169
Sequence MRYWLGLGANLGDRRAALEAALAGLAGAGIAVEAVSPAYETAPRDVVDQPAFMNAAARVRTDLPPEELLAAVKRLERALGREPGPRWGPRAIDCDLLLWEGGAHDAGELLTIPHPRLAERRFALLPLLDLDPALALPDGRRLADLLAAIPPDDQPARRLEEPLAAPELD

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
50 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
60 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
99 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
100 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
101 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
102 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
103 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
104 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
105 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
106 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
107 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
199 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
200 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
201 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
202 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
203 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
204 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
205 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
206 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
207 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
210 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
214 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
215 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
216 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
220 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
221 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
222 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
223 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
224 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
225 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
226 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
227 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
228 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
229 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
230 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
231 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
232 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
233 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
234 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
235 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
236 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
237 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
238 2519899620 Rhizobium sp. Pop5 Isolate Nodule
239 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
240 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
241 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
242 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
243 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
244 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
245 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
246 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
247 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
248 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
249 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
250 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
251 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
252 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
253 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
254 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
255 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
256 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
257 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
258 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
259 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
260 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
261 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
262 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
263 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
264 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
265 2643221599 Rhizobium sp. Root708 Isolate Unclassified
266 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
267 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
268 2643221719 Rhizobium sp. Root274 Isolate Unclassified
269 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
270 2718217882 Rhizobium sp. N741 Isolate Nodule
271 2718217927 Rhizobium sp. N324 Isolate Nodule
272 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
273 2718218009 Rhizobium sp. N561 Isolate Nodule
274 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
275 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
276 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
277 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
278 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
279 2718218363 Rhizobium sp. N113 Isolate Nodule
280 2718218365 Rhizobium sp. N731 Isolate Nodule
281 2718218366 Rhizobium sp. N621 Isolate Nodule
282 2718218423 Rhizobium sp. N941 Isolate Nodule
283 2721755514 Rhizobium sp. N6212 Isolate Nodule
284 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
285 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
286 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
287 2721755809 Rhizobium sp. N541 Isolate Nodule
288 2721755810 Rhizobium sp. N871 Isolate Nodule
289 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
290 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
291 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
292 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
293 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
294 2728369365 Rhizobium sp. N1341 Isolate Nodule
295 2728369397 Rhizobium sp. N1314 Isolate Nodule
296 2738541293 Rhizobium sp. GV031 Isolate Unclassified
297 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
298 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
299 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
300 2791355256 Rhizobium sp. M10 Isolate Nodule
301 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
302 2791355260 Rhizobium sp. L9 Isolate Nodule
303 2791355261 Rhizobium sp. J15 Isolate Nodule
304 2791355262 Rhizobium sp. M1 Isolate Nodule
305 2791355263 Rhizobium chutanense C5 Isolate Nodule
306 2791355264 Rhizobium sp. S9 Isolate Nodule
307 2791355265 Rhizobium sp. H4 Isolate Nodule
308 2791355266 Rhizobium sp. L43 Isolate Nodule
309 2791355267 Rhizobium sp. L18 Isolate Nodule
310 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
311 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
312 2802429633 Rhizobium anhuiense J3 Isolate Nodule
313 2802429634 Rhizobium anhuiense S10 Isolate Nodule
314 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
315 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
316 2802429637 Rhizobium anhuiense C15 Isolate Nodule
317 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
318 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
319 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
320 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
321 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
322 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
323 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
324 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
325 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
326 2838048938 Rhizobium pisi 27/80 Isolate Nodule
327 2838061910 Rhizobium phaseoli L15 Isolate Nodule
328 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
329 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
330 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
331 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
332 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
333 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
334 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
335 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
336 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
337 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
338 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
339 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
340 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
341 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
342 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
343 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
344 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
345 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
346 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
347 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
348 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
349 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
350 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
351 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
352 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
353 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
354 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
355 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
356 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
357 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
358 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
359 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
360 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
361 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
362 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
363 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
364 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
365 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
366 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
367 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
368 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
369 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
370 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
371 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
372 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
373 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
374 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
375 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
376 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
377 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
378 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
379 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
380 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
381 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
382 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
383 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
384 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
385 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
386 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
387 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
388 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
389 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
390 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
391 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
392 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
393 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
394 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
395 2933599457 Rhizobium phaseoli M3 Isolate Nodule
396 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
397 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
398 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
399 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
400 2936381700 Rhizobium chutanense C16 Isolate Unclassified
401 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
402 2996887358 Rhizobium sp. R711 Isolate Nodule
403 2996893221 Rhizobium sp. R635 Isolate Nodule
404 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
405 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
406 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
407 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
408 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
409 8005258706 Rhizobium sp. R693 Isolate Nodule
410 8005275841 Rhizobium sp. N4311 Isolate Nodule
411 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
412 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
413 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
414 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
415 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
416 8005321885 Rhizobium sp. R72 Isolate Nodule
417 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
418 8005382845 Rhizobium sp. R634 Isolate Nodule
419 8005395548 Rhizobium sp. R339 Isolate Nodule
420 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
421 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
422 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
423 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
424 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
425 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
426 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
427 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
428 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
429 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
430 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
431 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
432 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
433 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
434 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
435 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
436 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
437 8018176218 Rhizobium sp. N122 Isolate Nodule
438 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
439 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
440 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
441 8024501048 Rhizobium sp. H4 Isolate Nodule
442 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
443 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
444 8056382006 Rhizobium croatiense 13T Isolate Nodule
445 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
446 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
447 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.87
Metatranscriptomes 0
Isolates 34.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.08
Nodule 26.23
Rhizoplane 3.13
Rhizosphere 25.19
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0048319 3300049742 Bacteria 3961
2 JGI24740J21852_10000136 3300001979 Bacteria 28016
3 JGI25155J39150_1000001 3300002704 Bacteria 354543
4 JGI25156J39149_1000001 3300002705 Bacteria 354557
5 JGI25162J39368_1001158 3300002737 Bacteria 15692
6 JGI25162J39368_1002359 3300002737 Bacteria 7475
7 JGI25162J39368_1003705 3300002737 Bacteria 4150
8 JGI25154J39366_1000011 3300002738 Bacteria 296007
9 JGI25158J39367_1000255 3300002739 Bacteria 12155
10 JGI25157J39369_1000030 3300002741 Bacteria 146112
11 JGI25152J39213_1002860 3300002773 Bacteria 6180
12 JGI25152J39213_1009190 3300002773 Bacteria 2367
13 JGI25152J39213_1030848 3300002773 Bacteria 829
14 JGI25150J39212_1000137 3300002774 Bacteria 41263
15 JGI25150J39212_1032174 3300002774 Bacteria 718
16 JGI25159J45721_1000272 3300002987 Bacteria 24252
17 JGI25159J45721_1001295 3300002987 Bacteria 10564
18 JGI25151J46595_10000134 3300003187 Bacteria 98987
19 JGI25151J46595_10000300 3300003187 Bacteria 54213
20 JGI25151J46595_10002851 3300003187 Bacteria 9945
21 JGI25165J46597_1001317 3300003214 Bacteria 14046
22 JGI25165J46597_1001387 3300003214 Bacteria 13290
23 JGI25165J46597_1002284 3300003214 Bacteria 6553
24 JGI25153J46596_10005686 3300003215 Bacteria 6506
25 JGI25153J46596_10009240 3300003215 Bacteria 4612
26 JGI25153J46596_10015744 3300003215 Bacteria 3062
27 JGI25153J46596_10058660 3300003215 Bacteria 1058
28 JGI25153J46596_10097949 3300003215 Unclassified 695
29 rootH1_10010859 3300003316 Bacteria 5003
30 rootH1_10138550 3300003316 Bacteria 1323
31 rootH2_10055022 3300003320 Bacteria 5009
32 rootH2_10217396 3300003320 Bacteria 1455
33 rootL2_10037168 3300003322 Bacteria 1723
34 rootL2_10067723 3300003322 Bacteria 12506
35 JGI25160J50197_1000010 3300003354 Bacteria 279365
36 JGI25161J50226_1000006 3300003374 Bacteria 279563
37 JGI25161J50226_1000282 3300003374 Bacteria 29080
38 JGI25161J50226_1003736 3300003374 Bacteria 3385
39 JGI25161J50226_1006287 3300003374 Bacteria 2170
40 Ga0055526_1000191 3300003771 Bacteria 53302
41 Ga0055526_1005036 3300003771 Bacteria 7723
42 Ga0055526_1011041 3300003771 Bacteria 4123
43 Ga0055526_1017456 3300003771 Bacteria 2738
44 Ga0055526_1039379 3300003771 Bacteria 1205
45 Ga0055524_1005678 3300003775 Bacteria 5530
46 Ga0055524_1007042 3300003775 Bacteria 4829
47 Ga0055524_1010213 3300003775 Bacteria 3753
48 Ga0055524_1014795 3300003775 Bacteria 2875
49 Ga0055524_1016704 3300003775 Bacteria 2618
50 Ga0055524_1028517 3300003775 Bacteria 1670
51 Ga0055528_1000794 3300003790 Bacteria 21880
52 Ga0055528_1001243 3300003790 Bacteria 16193
53 Ga0055528_1003681 3300003790 Bacteria 7605
54 Ga0055528_1004133 3300003790 Bacteria 7071
55 Ga0055528_1014390 3300003790 Bacteria 2928
56 Ga0055528_1018780 3300003790 Bacteria 2327
57 Ga0055528_1032091 3300003790 Bacteria 1351
58 Ga0055540_1003033 3300003792 Bacteria 8386
59 Ga0055540_1012330 3300003792 Bacteria 2690
60 Ga0055540_1016002 3300003792 Bacteria 2154
61 Ga0055531_10048294 3300003794 Bacteria 1149
62 Ga0058692_1012924 3300003856 Bacteria 1960
63 Ga0055543_1000014 3300004625 Bacteria 177906
64 Ga0055543_1000020 3300004625 Bacteria 150535
65 Ga0055543_1001626 3300004625 Bacteria 8580
66 Ga0065165_1000251 3300005262 Bacteria 93020
67 Ga0065165_1010297 3300005262 Bacteria 4062
68 Ga0065165_1014133 3300005262 Bacteria 3117
69 Ga0065165_1024832 3300005262 Bacteria 2005
70 Ga0070670_100002269 3300005331 Bacteria 15819
71 Ga0070668_100806915 3300005347 Bacteria 834
72 Ga0070671_100081122 3300005355 Bacteria 2712
73 Ga0070663_100907622 3300005455 Bacteria 761
74 Ga0070665_100156677 3300005548 Bacteria 2279
75 Ga0068855_100066371 3300005563 Bacteria 4207
76 Ga0068856_100075976 3300005614 Bacteria 3328
77 Ga0068856_100163634 3300005614 Bacteria 2236
78 Ga0068861_100498561 3300005719 Bacteria 1100
79 Ga0081455_10551087 3300005937 Bacteria 762
80 Ga0075368_10007373 3300006042 Bacteria 3878
81 Ga0075368_10247019 3300006042 Bacteria 762
82 Ga0075363_100028582 3300006048 Bacteria 2870
83 Ga0075363_100040896 3300006048 Bacteria 2444
84 Ga0075363_100071222 3300006048 Bacteria 1889
85 Ga0075364_10579894 3300006051 Bacteria 766
86 Ga0075362_10001489 3300006177 Bacteria 7518
87 Ga0075362_10231945 3300006177 Bacteria 904
88 Ga0075367_10002471 3300006178 Bacteria 8461
89 Ga0075367_10002760 3300006178 Bacteria 8130
90 Ga0075367_10380351 3300006178 Bacteria 892
91 Ga0075367_10527163 3300006178 Bacteria 750
92 Ga0075369_10000330 3300006186 Bacteria 14095
93 Ga0075369_10032046 3300006186 Bacteria 2222
94 Ga0075366_10078014 3300006195 Bacteria 1977
95 Ga0075370_10001061 3300006353 Bacteria 11450
96 Ga0075370_10003623 3300006353 Bacteria 7388
97 Ga0075370_10489312 3300006353 Bacteria 742
98 Ga0105240_10000005 3300009093 Bacteria 702630
99 Ga0105248_10514549 3300009177 Bacteria 1350
100 Ga0105237_10000809 3300009545 Bacteria 42758
101 Ga0105249_10361728 3300009553 Bacteria 1473
102 Ga0123341_1000004 3300009765 Bacteria 153727
103 Ga0123342_1006869 3300009766 Bacteria 15472
104 Ga0105239_10004791 3300010375 Bacteria 16055
105 Ga0105239_11980068 3300010375 Bacteria 676
106 Ga0157370_10001170 3300013104 Bacteria 32703
107 Ga0157369_11115730 3300013105 Bacteria 806
108 Ga0163162_11061907 3300013306 Bacteria 917
109 Ga0157372_11001975 3300013307 Bacteria 968
110 Ga0182008_10026604 3300014497 Bacteria 2933
111 Ga0182007_10005859 3300015262 Bacteria 5341
112 Ga0182005_1012463 3300015265 Bacteria 2400
113 Ga0209435_100012 3300025206 Bacteria 401621
114 Ga0209760_103929 3300025207 Bacteria 1298
115 Ga0209436_100034 3300025208 Bacteria 80089
116 Ga0209436_106118 3300025208 Bacteria 2674
117 Ga0209437_100047 3300025233 Bacteria 405163
118 Ga0209437_100165 3300025233 Bacteria 145009
119 Ga0207425_1000024 3300025245 Bacteria 328978
120 Ga0207425_1002510 3300025245 Bacteria 6436
121 Ga0207425_1010394 3300025245 Bacteria 2266
122 Ga0207425_1044298 3300025245 Bacteria 836
123 Ga0209646_1000026 3300025246 Bacteria 401621
124 Ga0209646_1014159 3300025246 Bacteria 1203
125 Ga0209026_1000014 3300025250 Bacteria 401621
126 Ga0209677_100570 3300025253 Bacteria 20385
127 Ga0209759_1000012 3300025256 Bacteria 401621
128 Ga0209129_1000069 3300025258 Bacteria 212790
129 Ga0209129_1000133 3300025258 Bacteria 126018
130 Ga0209129_1000732 3300025258 Bacteria 21108
131 Ga0209129_1000817 3300025258 Bacteria 19602
132 Ga0209129_1027073 3300025258 Bacteria 985
133 Ga0209233_1000048 3300025261 Bacteria 453669
134 Ga0209233_1000069 3300025261 Bacteria 367639
135 Ga0209233_1000195 3300025261 Bacteria 125863
136 Ga0209673_1000013 3300025273 Bacteria 571633
137 Ga0209673_1000048 3300025273 Bacteria 287976
138 Ga0209673_1000552 3300025273 Bacteria 60264
139 Ga0209673_1000580 3300025273 Bacteria 57834
140 Ga0209673_1000959 3300025273 Bacteria 36010
141 Ga0209673_1004682 3300025273 Bacteria 7218
142 Ga0209673_1005882 3300025273 Bacteria 6068
143 Ga0209673_1007231 3300025273 Bacteria 5169
144 Ga0209130_1000004 3300025284 Bacteria 633436
145 Ga0209130_1000021 3300025284 Bacteria 374278
146 Ga0209675_1015462 3300025291 Bacteria 2265
147 Ga0209676_1095737 3300025292 Bacteria 642
148 Ga0209025_1000050 3300025294 Bacteria 331531
149 Ga0209025_1000166 3300025294 Bacteria 164692
150 Ga0209025_1003517 3300025294 Bacteria 14707
151 Ga0209025_1005057 3300025294 Bacteria 10982
152 Ga0209025_1011274 3300025294 Bacteria 5914
153 Ga0209025_1012989 3300025294 Bacteria 5273
154 Ga0209025_1036997 3300025294 Bacteria 2174
155 Ga0209564_1000273 3300025295 Bacteria 108165
156 Ga0209564_1001066 3300025295 Bacteria 33193
157 Ga0209564_1002209 3300025295 Bacteria 16230
158 Ga0209564_1005653 3300025295 Bacteria 7022
159 Ga0209564_1008240 3300025295 Bacteria 5191
160 Ga0209758_1000083 3300025297 Bacteria 257283
161 Ga0209758_1000384 3300025297 Bacteria 76474
162 Ga0209758_1000749 3300025297 Bacteria 47284
163 Ga0209758_1001310 3300025297 Bacteria 30349
164 Ga0209758_1004443 3300025297 Bacteria 11663
165 Ga0209758_1004646 3300025297 Bacteria 11245
166 Ga0209758_1007723 3300025297 Bacteria 7215
167 Ga0209256_1000371 3300025299 Bacteria 72192
168 Ga0209256_1003416 3300025299 Bacteria 11174
169 Ga0209256_1004340 3300025299 Bacteria 8999
170 Ga0209256_1004711 3300025299 Bacteria 8357
171 Ga0209256_1010986 3300025299 Bacteria 3695
172 Ga0209256_1012055 3300025299 Bacteria 3368
173 Ga0209256_1081155 3300025299 Bacteria 708
174 Ga0207426_1000003 3300025302 Bacteria 1063212
175 Ga0207426_1000010 3300025302 Bacteria 796003
176 Ga0207426_1000039 3300025302 Bacteria 439937
177 Ga0207426_1000671 3300025302 Bacteria 41548
178 Ga0209051_1000142 3300025303 Bacteria 135337
179 Ga0209051_1007308 3300025303 Bacteria 6061
180 Ga0209051_1008288 3300025303 Bacteria 5518
181 Ga0209051_1029198 3300025303 Bacteria 2162
182 Ga0209051_1084409 3300025303 Bacteria 904
183 Ga0209257_1004899 3300025304 Bacteria 9871
184 Ga0209257_1062481 3300025304 Bacteria 1008
185 Ga0207695_10000011 3300025913 Bacteria 910221
186 Ga0207671_10003637 3300025914 Bacteria 15221
187 Ga0207650_10003188 3300025925 Bacteria 11307
188 Ga0207667_10069632 3300025949 Bacteria 3662
189 Ga0207668_10503487 3300025972 Bacteria 1042
190 Ga0207639_10838813 3300026041 Bacteria 858
191 Ga0207678_10696384 3300026067 Bacteria 894
192 Ga0207702_10128849 3300026078 Bacteria 2275
193 Ga0207675_100319457 3300026118 Bacteria 1515
194 Ga0209813_10191286 3300027866 Bacteria 753
195 Ga0268266_10121073 3300028379 Bacteria 2329
196 Ga0268265_11482618 3300028380 Bacteria 682
197 Ga0307515_10127177 3300028794 Bacteria 2836
198 Ga0307515_10379389 3300028794 Bacteria 1047
199 Ga0265338_10014309 3300028800 Bacteria 8837
200 Ga0307405_10002522 3300031731 Bacteria 8106
201 Ga0307412_10006359 3300031911 Bacteria 6675
202 Ga0439465_0000344 3300041413 Bacteria 13291
203 Ga0439465_0005512 3300041413 Bacteria 4036
204 Ga0439465_0021824 3300041413 Bacteria 2010
205 Ga0439465_0035462 3300041413 Bacteria 1599
206 Ga0451833_0423070 3300041491 Bacteria 634
207 Ga0451833_0687010 3300041491 Bacteria 1618
208 Ga0451837_0108696 3300041494 Bacteria 698
209 Ga0451837_0381245 3300041494 Bacteria 1457
210 Ga0451839_0828661 3300041496 Bacteria 1681
211 Ga0451841_0584862 3300041498 Bacteria 1146
212 Ga0451845_0871543 3300041501 Bacteria 1438
213 Ga0451847_0139396 3300041503 Bacteria 1424
214 Ga0451849_1076091 3300041505 Bacteria 966
215 Ga0451849_1390237 3300041505 Bacteria 1299
216 Ga0451851_0204499 3300041507 Bacteria 4532
217 Ga0451851_0631139 3300041507 Bacteria 1265
218 Ga0451843_0630401 3300041509 Bacteria 1232
219 Ga0451855_0141101 3300041511 Bacteria 762
220 Ga0451855_1995774 3300041511 Bacteria 1164
221 Ga0451853_1345831 3300041512 Bacteria 3042
222 Ga0439431_0152225 3300041997 Bacteria 658
223 Ga0439432_050355 3300042006 Bacteria 1300
224 Ga0439449_0005557 3300042007 Bacteria 4825
225 Ga0466966_0025673 3300044684 Bacteria 3848
226 Ga0466963_0105375 3300044694 Bacteria 1932
227 Ga0466970_0000649 3300044765 Bacteria 17115
228 Ga0466957_0032447 3300044842 Bacteria 3127
229 Ga0466959_0072429 3300045049 Bacteria 2494
230 Ga0466958_0073571 3300045836 Bacteria 2093
231 Ga0466967_1384992 3300045976 Bacteria 700
232 Ga0495617_112574 3300046452 Bacteria 880
233 Ga0495592_0064949 3300046454 Bacteria 2673
234 Ga0495638_0000145 3300046460 Bacteria 112275
235 Ga0495638_0130856 3300046460 Bacteria 1474
236 Ga0495650_0026325 3300046471 Bacteria 2708
237 Ga0495650_0105711 3300046471 Bacteria 1052
238 Ga0495605_0000715 3300046474 Bacteria 24441
239 Ga0495605_0034646 3300046474 Bacteria 2556
240 Ga0495605_0380348 3300046474 Bacteria 589
241 Ga0495662_0000738 3300046476 Bacteria 15658
242 Ga0495664_0091918 3300046477 Bacteria 1825
243 Ga0495585_0013441 3300046492 Bacteria 4791
244 Ga0495585_0021340 3300046492 Bacteria 3719
245 Ga0495607_0029168 3300046501 Bacteria 3398
246 Ga0495583_0004516 3300046506 Bacteria 9921
247 Ga0495583_0132988 3300046506 Bacteria 1040
248 Ga0495606_0002372 3300046507 Bacteria 22115
249 Ga0495606_0008918 3300046507 Bacteria 8589
250 Ga0495606_0077069 3300046507 Bacteria 2082
251 Ga0495606_0222298 3300046507 Bacteria 1063
252 Ga0495610_0000703 3300046512 Bacteria 32000
253 Ga0495610_0034788 3300046512 Bacteria 2591
254 Ga0495616_0026298 3300046513 Bacteria 3099
255 Ga0495616_0196244 3300046513 Bacteria 889
256 Ga0495620_0006623 3300046515 Bacteria 6347
257 Ga0495620_0016476 3300046515 Bacteria 3707
258 Ga0495631_0001539 3300046518 Bacteria 13867
259 Ga0495632_0001929 3300046519 Bacteria 16568
260 Ga0495632_0002877 3300046519 Bacteria 12688
261 Ga0495632_0013737 3300046519 Bacteria 4608
262 Ga0495632_0297083 3300046519 Bacteria 717
263 Ga0495643_0029212 3300046522 Bacteria 3085
264 Ga0495643_0033938 3300046522 Bacteria 2818
265 Ga0495643_0038213 3300046522 Bacteria 2630
266 Ga0495643_0086102 3300046522 Bacteria 1628
267 Ga0495652_0119334 3300046529 Bacteria 2107
268 Ga0495640_0058710 3300046533 Bacteria 2623
269 Ga0495587_0056697 3300046536 Bacteria 2305
270 Ga0495597_0012545 3300046542 Bacteria 4086
271 Ga0495633_0047575 3300046558 Bacteria 2027
272 Ga0495633_0279821 3300046558 Bacteria 759
273 Ga0495656_0068928 3300046615 Bacteria 1565
274 Ga0495656_0127804 3300046615 Bacteria 1207
275 Ga0495668_0003583 3300046616 Bacteria 11528
276 Ga0495668_0037863 3300046616 Bacteria 2697
277 Ga0495611_0003021 3300046648 Bacteria 7497
278 Ga0495625_0002190 3300046660 Bacteria 21683
279 Ga0495625_0075147 3300046660 Bacteria 2364
280 Ga0495625_0297746 3300046660 Bacteria 1033
281 Ga0495635_0035183 3300046663 Bacteria 3473
282 Ga0495661_0226546 3300046665 Bacteria 966
283 Ga0495588_0033187 3300046674 Bacteria 2606
284 Ga0495657_0054655 3300046675 Bacteria 2666
285 Ga0495624_0056174 3300046690 Bacteria 2478
286 Ga0495670_0023596 3300046691 Bacteria 3036
287 Ga0495670_0054915 3300046691 Bacteria 1997
288 Ga0495670_0460579 3300046691 Bacteria 689
289 Ga0495671_0140042 3300046692 Bacteria 1179
290 Ga0495649_0201381 3300046694 Bacteria 1034
291 Ga0495649_0359782 3300046694 Bacteria 734
292 Ga0495600_0110988 3300046809 Bacteria 1785
293 Ga0495604_0065192 3300047317 Bacteria 2773
294 Ga0495636_0019889 3300047318 Bacteria 2702
295 Ga0495674_0491206 3300047319 Bacteria 983
296 Ga0495672_0005896 3300047320 Bacteria 9602
297 Ga0495687_020307 3300047443 Bacteria 3239
298 Ga0495687_102134 3300047443 Bacteria 1073
299 Ga0495679_055582 3300047446 Bacteria 1175
300 Ga0495681_0029736 3300047470 Bacteria 2792
301 Ga0495686_0001073 3300047472 Bacteria 32557
302 Ga0495686_0005102 3300047472 Bacteria 10499
303 Ga0495686_0101949 3300047472 Bacteria 1730
304 Ga0495686_0217949 3300047472 Bacteria 1087
305 Ga0495686_0306845 3300047472 Bacteria 874
306 Ga0495686_0379424 3300047472 Bacteria 763
307 Ga0495626_0023555 3300048091 Bacteria 3031
308 Ga0496100_0002352 3300048903 Bacteria 9571
309 Ga0496100_0438589 3300048903 Bacteria 1000
310 Ga0496101_0128394 3300048904 Bacteria 1923
311 Ga0496101_0254256 3300048904 Bacteria 1369
312 Ga0496102_0005955 3300048905 Bacteria 10383
313 Ga0496102_0198688 3300048905 Bacteria 1890
314 Ga0496103_0001184 3300048906 Bacteria 17910
315 Ga0496103_1050657 3300048906 Bacteria 505
316 Ga0496104_0799759 3300048907 Bacteria 849
317 Ga0496105_0026425 3300048908 Bacteria 4734
318 Ga0496106_0000125 3300048909 Bacteria 59031
319 Ga0496106_0106628 3300048909 Bacteria 2178
320 Ga0496106_0856927 3300048909 Bacteria 719
321 Ga0496107_0062984 3300048910 Bacteria 2687
322 Ga0496111_0593016 3300048914 Bacteria 811
323 Ga0496113_0016531 3300048916 Bacteria 5099
324 Ga0496113_0564739 3300048916 Bacteria 912
325 Ga0496113_0913338 3300048916 Bacteria 694
326 Ga0496114_0075401 3300048917 Bacteria 2841
327 Ga0496114_0175450 3300048917 Bacteria 1870
328 Ga0496116_0005363 3300048919 Bacteria 11934
329 Ga0496116_0009212 3300048919 Bacteria 8450
330 Ga0496116_0012844 3300048919 Bacteria 6806
331 Ga0496116_0012915 3300048919 Bacteria 6780
332 Ga0496116_0028834 3300048919 Bacteria 4013
333 Ga0496116_0040914 3300048919 Bacteria 3185
334 Ga0496116_0061961 3300048919 Bacteria 2418
335 Ga0496116_0238011 3300048919 Bacteria 917
336 Ga0496117_0002198 3300048920 Bacteria 25364
337 Ga0496117_0018379 3300048920 Bacteria 5790
338 Ga0496117_0082333 3300048920 Bacteria 2108
339 Ga0496117_0085495 3300048920 Bacteria 2053
340 Ga0496117_0122131 3300048920 Bacteria 1598
341 Ga0496118_0002392 3300048921 Bacteria 25358
342 Ga0496118_0003857 3300048921 Bacteria 18424
343 Ga0496118_0024594 3300048921 Bacteria 5194
344 Ga0496118_0092262 3300048921 Bacteria 2079
345 Ga0496118_0093505 3300048921 Bacteria 2059
346 Ga0496118_0462469 3300048921 Bacteria 641
347 Ga0496119_0004664 3300048922 Bacteria 13512
348 Ga0496119_0020340 3300048922 Bacteria 4846
349 Ga0496119_0046424 3300048922 Bacteria 2713
350 Ga0496119_0074982 3300048922 Bacteria 1968
351 Ga0496119_0083065 3300048922 Bacteria 1840
352 Ga0496119_0104765 3300048922 Bacteria 1581
353 Ga0496120_0004195 3300048923 Bacteria 12312
354 Ga0496121_0002775 3300048924 Bacteria 25995
355 Ga0496121_0020325 3300048924 Bacteria 6580
356 Ga0496121_0031045 3300048924 Bacteria 4893
357 Ga0496121_0031418 3300048924 Bacteria 4851
358 Ga0496121_0033635 3300048924 Bacteria 4634
359 Ga0496121_0072638 3300048924 Bacteria 2761
360 Ga0496121_0098968 3300048924 Bacteria 2255
361 Ga0496121_0351628 3300048924 Bacteria 981
362 Ga0496121_0366015 3300048924 Bacteria 955
363 Ga0496121_0373303 3300048924 Bacteria 943
364 Ga0496121_0631817 3300048924 Bacteria 655
365 Ga0496122_0005990 3300048925 Bacteria 14209
366 Ga0496122_0007088 3300048925 Bacteria 12593
367 Ga0496122_0016747 3300048925 Bacteria 6907
368 Ga0496122_0032632 3300048925 Bacteria 4301
369 Ga0496122_0036840 3300048925 Bacteria 3947
370 Ga0496122_0125558 3300048925 Bacteria 1643
371 Ga0496122_0318512 3300048925 Bacteria 828
372 Ga0496123_0003616 3300048926 Bacteria 17128
373 Ga0496123_0014496 3300048926 Bacteria 6528
374 Ga0496123_0028689 3300048926 Bacteria 4113
375 Ga0496123_0029563 3300048926 Bacteria 4029
376 Ga0496123_0032137 3300048926 Bacteria 3806
377 Ga0496123_0117400 3300048926 Bacteria 1505
378 Ga0496124_0004003 3300048927 Bacteria 17543
379 Ga0496124_0006551 3300048927 Bacteria 12658
380 Ga0496124_0045320 3300048927 Bacteria 3770
381 Ga0496124_0059163 3300048927 Bacteria 3219
382 Ga0496124_0083422 3300048927 Bacteria 2622
383 Ga0496124_0156837 3300048927 Bacteria 1779
384 Ga0496124_0253195 3300048927 Bacteria 1301
385 Ga0496124_0283813 3300048927 Bacteria 1205
386 Ga0496124_0405590 3300048927 Bacteria 944
387 Ga0496125_0003639 3300048928 Bacteria 18464
388 Ga0496125_0014114 3300048928 Bacteria 7797
389 Ga0496125_0177067 3300048928 Bacteria 1426
390 Ga0496125_0325152 3300048928 Bacteria 930
391 Ga0496125_0414426 3300048928 Bacteria 783
392 Ga0496125_0551548 3300048928 Bacteria 638
393 Ga0496126_0019302 3300048929 Bacteria 6715
394 Ga0496126_0082458 3300048929 Bacteria 2841
395 Ga0496126_0187659 3300048929 Bacteria 1752
396 Ga0496126_0255179 3300048929 Bacteria 1460
397 Ga0496126_0916269 3300048929 Bacteria 663
398 Ga0495678_024147 3300049459 Bacteria 2630
399 Ga0495678_052731 3300049459 Bacteria 1565
400 Ga0495678_060738 3300049459 Bacteria 1421
401 Ga0501032_0034664 3300049569 Bacteria 3454
402 Ga0501037_0208924 3300049573 Bacteria 1377
403 Ga0501046_0450400 3300049580 Bacteria 926
404 Ga0501047_0431506 3300049581 Bacteria 1148
405 Ga0501068_0156585 3300049584 Bacteria 1435
406 Ga0501083_0757769 3300049744 Bacteria 631
407 Ga0501044_0174887 3300049823 Bacteria 2116
408 nmdc:mga03683_3800_c1 3300050489 Bacteria 4928
409 nmdc:mga03n38_100619_c1 3300050490 Bacteria 1393
410 nmdc:mga03n38_242829_c1 3300050490 Bacteria 948
411 nmdc:mga00v17_141911_c2 3300050491 Bacteria 664
412 nmdc:mga0yw44_575629_c1 3300050492 Bacteria 765
413 nmdc:mga07m45_390974_c1 3300050496 Bacteria 807
414 nmdc:mga07m45_430618_c1 3300050496 Bacteria 765
415 Ga0500610_0005661 3300053079 Bacteria 5151
416 Ga0495655_0122991 3300053083 Bacteria 792
417 Ga0500578_0069068 3300053086 Bacteria 2251
418 Ga0500651_0176445 3300053093 Bacteria 1271
419 Ga0500557_000494 3300053105 Bacteria 5247
420 Ga0500569_003626 3300053109 Bacteria 3176
421 Ga0500569_044354 3300053109 Bacteria 1316
422 Ga0500594_0000222 3300053118 Bacteria 13820
423 Ga0500608_008336 3300053122 Bacteria 4350
424 Ga0500618_004170 3300053125 Bacteria 4715
425 Ga0500618_012936 3300053125 Bacteria 2172
426 Ga0500618_036631 3300053125 Bacteria 1136
427 Ga0500658_0002500 3300053134 Bacteria 7116
428 Ga0500658_0007286 3300053134 Bacteria 4084
429 Ga0500568_0000846 3300053139 Bacteria 21547
430 Ga0500568_0003503 3300053139 Bacteria 8713
431 Ga0500590_000249 3300053148 Bacteria 16591
432 Ga0500604_0295956 3300053151 Bacteria 561
433 Ga0500616_0006239 3300053153 Bacteria 7862
434 Ga0500616_0008579 3300053153 Bacteria 6329
435 Ga0500622_0242031 3300053156 Bacteria 797
436 Ga0500627_0056756 3300053158 Bacteria 1716
437 Ga0500633_0020653 3300053160 Bacteria 1990
438 Ga0500633_0103457 3300053160 Bacteria 1050
439 Ga0500638_231715 3300053162 Bacteria 758
440 Ga0500636_0067338 3300053177 Bacteria 2081
441 Ga0500645_006761 3300053730 Bacteria 4062
442 Ga0466962_0188569 3300061719 Bacteria 1006
443 2509386687 2509276021 Bacteria 7634384
444 2509443258 2509276033 Bacteria 7180565
445 2510133309 2510065019 Bacteria 6903379
446 2511135114 2510917022 Bacteria 6504556
447 2511183335 2510917028 Bacteria 6185411
448 2513572502 2513237084 Bacteria 7231967
449 2513577277 2513237085 Bacteria 7695351
450 2513594586 2513237088 Bacteria 6927906
451 2513708734 2513237103 Bacteria 7647401
452 2513864644 2513237138 Bacteria 7368160
453 2513912416 2513237144 Bacteria 7530820
454 2513926223 2513237146 Bacteria 7166346
455 2515112269 2515075009 Bacteria 7288508
456 2515637569 2515154113 Bacteria 7807172
457 2515639769 2515154114 Bacteria 7848616
458 2515738581 2515154134 Bacteria 7220242
459 2517036001 2516653077 Bacteria 7555578
460 2517076394 2516653085 Bacteria 7346596
461 2517095152 2517093000 Bacteria 7412387
462 2520375990 2519899620 Bacteria 6499161
463 2524460277 2524023209 Bacteria 6679728
464 2530645524 2529292951 Bacteria 6916614
465 2535516497 2534681796 Bacteria 7146037
466 2585200164 2582581294 Bacteria 6626667
467 2585229986 2582581299 Bacteria 6518058
468 2585270854 2582581307 Bacteria 6597605
469 2585277204 2582581308 Bacteria 7413247
470 2585323787 2582581315 Bacteria 7318924
471 2585331766 2582581316 Bacteria 7774528
472 2585402011 2582581867 Bacteria 7184437
473 2585527636 2585427526 Bacteria 7258840
474 2585534060 2585427527 Bacteria 7273426
475 2585537536 2585427528 Bacteria 6842387
476 2585552089 2585427530 Bacteria 7383882
477 2585558578 2585427531 Bacteria 6992870
478 2585821796 2585427590 Bacteria 6824633
479 2585835486 2585427593 Bacteria 7141551
480 2585846739 2585427594 Bacteria 6180594
481 2585897942 2585427608 Bacteria 6544331
482 2585904453 2585427609 Bacteria 6667127
483 2587980430 2585428125 Bacteria 6662905
484 2599417701 2599185170 Bacteria 7295545
485 2616292461 2615840624 Bacteria 6557588
486 2616308582 2615840626 Bacteria 7921970
487 2616557114 2615840698 Bacteria 7319877
488 2617385665 2617270742 Bacteria 6808054
489 2644003769 2643221599 Bacteria 6292121
490 2644192768 2643221634 Bacteria 6705461
491 2644298502 2643221653 Bacteria 4569637
492 2644656731 2643221719 Bacteria 4568197
493 2671111714 2667528174 Bacteria 6435400
494 2719181181 2718217882 Bacteria 6556348
495 2719385783 2718217927 Bacteria 6972593
496 2719665604 2718217997 Bacteria 6740740
497 2719731930 2718218009 Bacteria 6478651
498 2720492024 2718218199 Bacteria 6740745
499 2720613289 2718218232 Bacteria 6720332
500 2720620165 2718218233 Bacteria 6662049
501 2720631590 2718218235 Bacteria 6630699
502 2720775318 2718218269 Bacteria 6906114
503 2721147275 2718218363 Bacteria 6524337
504 2721158808 2718218365 Bacteria 6274507
505 2721164193 2718218366 Bacteria 6425255
506 2721399563 2718218423 Bacteria 6438183
507 2722840363 2721755514 Bacteria 6424414
508 2723026936 2721755556 Bacteria 6745503
509 2723560551 2721755684 Bacteria 6859907
510 2723567137 2721755685 Bacteria 6704835
511 2724038376 2721755809 Bacteria 6438790
512 2724044686 2721755810 Bacteria 6479005
513 2724089925 2721755819 Bacteria 6906405
514 2724104402 2721755822 Bacteria 6726041
515 2724110194 2721755823 Bacteria 6752556
516 2725950649 2724679232 Bacteria 7646494
517 2730107872 2728369352 Bacteria 6745171
518 2730164418 2728369365 Bacteria 6555560
519 2730298440 2728369397 Bacteria 6274511
520 2738802059 2738541293 Bacteria 7065685
521 2739036498 2738541333 Bacteria 7106503
522 2766063165 2765235942 Bacteria 7445910
523 2778174019 2775507266 Bacteria 7392367
524 2793294669 2791355256 Bacteria 6798008
525 2793312250 2791355259 Bacteria 7254731
526 2793322021 2791355260 Bacteria 6598818
527 2793326659 2791355261 Bacteria 6661293
528 2793335736 2791355262 Bacteria 6774204
529 2793341516 2791355263 Bacteria 6872478
530 2793349077 2791355264 Bacteria 6429314
531 2793353071 2791355265 Bacteria 6539969
532 2793361174 2791355266 Bacteria 7116587
533 2793369264 2791355267 Bacteria 7222458
534 2805925702 2802429605 Bacteria 6875453
535 2805933573 2802429606 Bacteria 6346811
536 2806046048 2802429633 Bacteria 7341974
537 2806054427 2802429634 Bacteria 7083200
538 2806060432 2802429635 Bacteria 7650140
539 2806065110 2802429636 Bacteria 7597525
540 2806072375 2802429637 Bacteria 7067217
541 2819241633 2818991272 Bacteria 4622173
542 2819612794 2818991448 Bacteria 6772224
543 2819637907 2818991453 Bacteria 7181617
544 2837653606 2837651117 Bacteria 3772164
545 2838021476 2838016132 Bacteria 6577831
546 2838027868 2838022645 Bacteria 6494267
547 2838030089 2838029111 Bacteria 6603031
548 2838038086 2838035591 Bacteria 7166484
549 2838043434 2838042994 Bacteria 6046894
550 2838052428 2838048938 Bacteria 6044578
551 2838067744 2838061910 Bacteria 6794874
552 2838073582 2838068647 Bacteria 6208656
553 2838667227 2838661181 Bacteria 7385261
554 2838672033 2838668709 Bacteria 6671819
555 2838682218 2838680041 Bacteria 6545511
556 2838689489 2838686498 Bacteria 7807632
557 2838696789 2838694306 Bacteria 6853137
558 2838704687 2838701080 Bacteria 6669771
559 2838709971 2838707686 Bacteria 6619912
560 2838730822 2838729681 Bacteria 7400765
561 2838743763 2838742623 Bacteria 7396178
562 2841857839 2841851746 Bacteria 7532261
563 2842078144 2842077413 Bacteria 6508645
564 2842110502 2842110456 Bacteria 7656360
565 2842119347 2842118031 Bacteria 7033875
566 2842148573 2842146304 Bacteria 5957337
567 2842157424 2842156927 Bacteria 6894975
568 2842164615 2842163707 Bacteria 6916235
569 2842180991 2842180545 Bacteria 6888678
570 2842194514 2842192696 Bacteria 6147454
571 2842203816 2842198810 Bacteria 6608673
572 2842206045 2842205361 Bacteria 6340321
573 2842217225 2842217011 Bacteria 7497767
574 2842230950 2842229732 Bacteria 7475766
575 2842239383 2842237096 Bacteria 6620661
576 2842244942 2842243621 Bacteria 7421798
577 2842254367 2842250916 Bacteria 6579627
578 2842258755 2842257432 Bacteria 7401195
579 2842266052 2842264693 Bacteria 6472963
580 2842273509 2842271015 Bacteria 7807131
581 2842279502 2842278818 Bacteria 6340002
582 2842286148 2842285085 Bacteria 6011953
583 2842291807 2842291075 Bacteria 7076806
584 2842302041 2842298080 Bacteria 6123127
585 2842304286 2842304105 Bacteria 7023636
586 2842316700 2842311132 Bacteria 6616990
587 2842317911 2842317721 Bacteria 6793725
588 2842345844 2842341865 Bacteria 7003929
589 2842357492 2842357229 Bacteria 6485165
590 2842364525 2842363717 Bacteria 6844742
591 2842372784 2842370503 Bacteria 7038661
592 2842378203 2842377471 Bacteria 7140707
593 2842385856 2842384541 Bacteria 7057858
594 2842401862 2842395702 Bacteria 6780583
595 2842403508 2842402390 Bacteria 6681310
596 2842409119 2842409023 Bacteria 6687331
597 2842415773 2842415677 Bacteria 6596907
598 2842428067 2842422224 Bacteria 6239196
599 2842429311 2842428310 Bacteria 6767288
600 2842435924 2842434925 Bacteria 6502746
601 2842442271 2842441272 Bacteria 6769273
602 2842450562 2842447887 Bacteria 6754142
603 2842463732 2842462802 Bacteria 6588055
604 2842470253 2842469257 Bacteria 6752936
605 2842476626 2842475841 Bacteria 6603183
606 2842484834 2842482326 Bacteria 7212537
607 2842490019 2842489311 Bacteria 6620893
608 2842496181 2842495871 Bacteria 6820686
609 2842503617 2842502639 Bacteria 6604161
610 2842511434 2842509118 Bacteria 6850950
611 2844459170 2844454524 Bacteria 7952546
612 2852389901 2852387548 Bacteria 8025568
613 2857518711 2857516855 Bacteria 7787325
614 2891052118 2891048133 Bacteria 4447501
615 2919411687 2919408235 Bacteria 6149349
616 2923557929 2923556063 Bacteria 6793593
617 2933571562 2933570622 Bacteria 7023390
618 2933586531 2933586486 Bacteria 7667493
619 2933603936 2933599457 Bacteria 5858799
620 2935897355 2935894831 Bacteria 6620579
621 2935904735 2935901341 Bacteria 7341747
622 2936372710 2936367885 Bacteria 7324495
623 2936378563 2936375103 Bacteria 6652732
624 2936384985 2936381700 Bacteria 7006523
625 2989779030 2989776772 Bacteria 4843317
626 2996891699 2996887358 Bacteria 5795980
627 2996894170 2996893221 Bacteria 5823108
628 3005415146 3005409236 Bacteria 7188837
629 3005420104 3005416602 Bacteria 7064308
630 3005454219 3005452660 Bacteria 5889319
631 639648525 639633055 Bacteria 7751309
632 8005248585 8005246636 Bacteria 4933972
633 8005263029 8005258706 Bacteria 6184835
634 8005280560 8005275841 Bacteria 6929066
635 8005283180 8005282627 Bacteria 6675747
636 8005290263 8005289223 Bacteria 6634003
637 8005302556 8005301065 Bacteria 6614431
638 8005311200 8005307578 Bacteria 7395396
639 8005317055 8005314921 Bacteria 7072929
640 8005326226 8005321885 Bacteria 5795980
641 8005379207 8005376324 Bacteria 6590079
642 8005388320 8005382845 Bacteria 6732062
643 8005397152 8005395548 Bacteria 6806915
644 8005432127 8005430974 Bacteria 6689030
645 8005462931 8005460587 Bacteria 7157962
646 8005485150 8005484373 Bacteria 6297373
647 8005500327 8005497431 Bacteria 6477605
648 8005545147 8005542996 Bacteria 7077758
649 8005557725 8005556819 Bacteria 6908598
650 8005568897 8005563573 Bacteria 7153261
651 8005570808 8005570704 Bacteria 6957481
652 8005621702 8005619151 Bacteria 7030230
653 8005626522 8005626139 Bacteria 6534237
654 8005645313 8005645114 Bacteria 6950293
655 8005671744 8005668836 Bacteria 6953162
656 8005683186 8005682033 Bacteria 6726518
657 8005694569 8005688590 Bacteria 6610080
658 8005700030 8005695170 Bacteria 6912330
659 8018129911 8018127388 Bacteria 7351159
660 8018166811 8018163183 Bacteria 7277977
661 8018179843 8018176218 Bacteria 6896178
662 8023685398 8023680758 Bacteria 7729763
663 8024483552 8024479707 Bacteria 6954785
664 8024492263 8024486573 Bacteria 6540512
665 8024506602 8024501048 Bacteria 6427847
666 8046773791 8046767195 Bacteria 7547379
667 8056376616 8056375014 Bacteria 7006639
668 8056387827 8056382006 Bacteria 6408074
669 8056877535 8056875544 Bacteria 4355797
670 8057576835 8057575449 Bacteria 7367519
671 8057875075 8057874678 Bacteria 7494653
672 Ga0501080_0048319
673 JGI24740J21852_10000136
674 JGI25155J39150_1000001
675 JGI25156J39149_1000001
676 JGI25162J39368_1001158
677 JGI25162J39368_1002359
678 JGI25162J39368_1003705
679 JGI25154J39366_1000011
680 JGI25158J39367_1000255
681 JGI25157J39369_1000030
682 JGI25152J39213_1002860
683 JGI25152J39213_1009190
684 JGI25152J39213_1030848
685 JGI25150J39212_1000137
686 JGI25150J39212_1032174
687 JGI25159J45721_1000272
688 JGI25159J45721_1001295
689 JGI25151J46595_10000134
690 JGI25151J46595_10000300
691 JGI25151J46595_10002851
692 JGI25165J46597_1001317
693 JGI25165J46597_1001387
694 JGI25165J46597_1002284
695 JGI25153J46596_10005686
696 JGI25153J46596_10009240
697 JGI25153J46596_10015744
698 JGI25153J46596_10058660
699 JGI25153J46596_10097949
700 rootH1_10010859
701 rootH1_10138550
702 rootH2_10055022
703 rootH2_10217396
704 rootL2_10037168
705 rootL2_10067723
706 JGI25160J50197_1000010
707 JGI25161J50226_1000006
708 JGI25161J50226_1000282
709 JGI25161J50226_1003736
710 JGI25161J50226_1006287
711 Ga0055526_1000191
712 Ga0055526_1005036
713 Ga0055526_1011041
714 Ga0055526_1017456
715 Ga0055526_1039379
716 Ga0055524_1005678
717 Ga0055524_1007042
718 Ga0055524_1010213
719 Ga0055524_1014795
720 Ga0055524_1016704
721 Ga0055524_1028517
722 Ga0055528_1000794
723 Ga0055528_1001243
724 Ga0055528_1003681
725 Ga0055528_1004133
726 Ga0055528_1014390
727 Ga0055528_1018780
728 Ga0055528_1032091
729 Ga0055540_1003033
730 Ga0055540_1012330
731 Ga0055540_1016002
732 Ga0055531_10048294
733 Ga0058692_1012924
734 Ga0055543_1000014
735 Ga0055543_1000020
736 Ga0055543_1001626
737 Ga0065165_1000251
738 Ga0065165_1010297
739 Ga0065165_1014133
740 Ga0065165_1024832
741 Ga0070670_100002269
742 Ga0070668_100806915
743 Ga0070671_100081122
744 Ga0070663_100907622
745 Ga0070665_100156677
746 Ga0068855_100066371
747 Ga0068856_100075976
748 Ga0068856_100163634
749 Ga0068861_100498561
750 Ga0081455_10551087
751 Ga0075368_10007373
752 Ga0075368_10247019
753 Ga0075363_100028582
754 Ga0075363_100040896
755 Ga0075363_100071222
756 Ga0075364_10579894
757 Ga0075362_10001489
758 Ga0075362_10231945
759 Ga0075367_10002471
760 Ga0075367_10002760
761 Ga0075367_10380351
762 Ga0075367_10527163
763 Ga0075369_10000330
764 Ga0075369_10032046
765 Ga0075366_10078014
766 Ga0075370_10001061
767 Ga0075370_10003623
768 Ga0075370_10489312
769 Ga0105240_10000005
770 Ga0105248_10514549
771 Ga0105237_10000809
772 Ga0105249_10361728
773 Ga0123341_1000004
774 Ga0123342_1006869
775 Ga0105239_10004791
776 Ga0105239_11980068
777 Ga0157370_10001170
778 Ga0157369_11115730
779 Ga0163162_11061907
780 Ga0157372_11001975
781 Ga0182008_10026604
782 Ga0182007_10005859
783 Ga0182005_1012463
784 Ga0209435_100012
785 Ga0209760_103929
786 Ga0209436_100034
787 Ga0209436_106118
788 Ga0209437_100047
789 Ga0209437_100165
790 Ga0207425_1000024
791 Ga0207425_1002510
792 Ga0207425_1010394
793 Ga0207425_1044298
794 Ga0209646_1000026
795 Ga0209646_1014159
796 Ga0209026_1000014
797 Ga0209677_100570
798 Ga0209759_1000012
799 Ga0209129_1000069
800 Ga0209129_1000133
801 Ga0209129_1000732
802 Ga0209129_1000817
803 Ga0209129_1027073
804 Ga0209233_1000048
805 Ga0209233_1000069
806 Ga0209233_1000195
807 Ga0209673_1000013
808 Ga0209673_1000048
809 Ga0209673_1000552
810 Ga0209673_1000580
811 Ga0209673_1000959
812 Ga0209673_1004682
813 Ga0209673_1005882
814 Ga0209673_1007231
815 Ga0209130_1000004
816 Ga0209130_1000021
817 Ga0209675_1015462
818 Ga0209676_1095737
819 Ga0209025_1000050
820 Ga0209025_1000166
821 Ga0209025_1003517
822 Ga0209025_1005057
823 Ga0209025_1011274
824 Ga0209025_1012989
825 Ga0209025_1036997
826 Ga0209564_1000273
827 Ga0209564_1001066
828 Ga0209564_1002209
829 Ga0209564_1005653
830 Ga0209564_1008240
831 Ga0209758_1000083
832 Ga0209758_1000384
833 Ga0209758_1000749
834 Ga0209758_1001310
835 Ga0209758_1004443
836 Ga0209758_1004646
837 Ga0209758_1007723
838 Ga0209256_1000371
839 Ga0209256_1003416
840 Ga0209256_1004340
841 Ga0209256_1004711
842 Ga0209256_1010986
843 Ga0209256_1012055
844 Ga0209256_1081155
845 Ga0207426_1000003
846 Ga0207426_1000010
847 Ga0207426_1000039
848 Ga0207426_1000671
849 Ga0209051_1000142
850 Ga0209051_1007308
851 Ga0209051_1008288
852 Ga0209051_1029198
853 Ga0209051_1084409
854 Ga0209257_1004899
855 Ga0209257_1062481
856 Ga0207695_10000011
857 Ga0207671_10003637
858 Ga0207650_10003188
859 Ga0207667_10069632
860 Ga0207668_10503487
861 Ga0207639_10838813
862 Ga0207678_10696384
863 Ga0207702_10128849
864 Ga0207675_100319457
865 Ga0209813_10191286
866 Ga0268266_10121073
867 Ga0268265_11482618
868 Ga0307515_10127177
869 Ga0307515_10379389
870 Ga0265338_10014309
871 Ga0307405_10002522
872 Ga0307412_10006359
873 Ga0439465_0000344
874 Ga0439465_0005512
875 Ga0439465_0021824
876 Ga0439465_0035462
877 Ga0451833_0423070
878 Ga0451833_0687010
879 Ga0451837_0108696
880 Ga0451837_0381245
881 Ga0451839_0828661
882 Ga0451841_0584862
883 Ga0451845_0871543
884 Ga0451847_0139396
885 Ga0451849_1076091
886 Ga0451849_1390237
887 Ga0451851_0204499
888 Ga0451851_0631139
889 Ga0451843_0630401
890 Ga0451855_0141101
891 Ga0451855_1995774
892 Ga0451853_1345831
893 Ga0439431_0152225
894 Ga0439432_050355
895 Ga0439449_0005557
896 Ga0466966_0025673
897 Ga0466963_0105375
898 Ga0466970_0000649
899 Ga0466957_0032447
900 Ga0466959_0072429
901 Ga0466958_0073571
902 Ga0466967_1384992
903 Ga0495617_112574
904 Ga0495592_0064949
905 Ga0495638_0000145
906 Ga0495638_0130856
907 Ga0495650_0026325
908 Ga0495650_0105711
909 Ga0495605_0000715
910 Ga0495605_0034646
911 Ga0495605_0380348
912 Ga0495662_0000738
913 Ga0495664_0091918
914 Ga0495585_0013441
915 Ga0495585_0021340
916 Ga0495607_0029168
917 Ga0495583_0004516
918 Ga0495583_0132988
919 Ga0495606_0002372
920 Ga0495606_0008918
921 Ga0495606_0077069
922 Ga0495606_0222298
923 Ga0495610_0000703
924 Ga0495610_0034788
925 Ga0495616_0026298
926 Ga0495616_0196244
927 Ga0495620_0006623
928 Ga0495620_0016476
929 Ga0495631_0001539
930 Ga0495632_0001929
931 Ga0495632_0002877
932 Ga0495632_0013737
933 Ga0495632_0297083
934 Ga0495643_0029212
935 Ga0495643_0033938
936 Ga0495643_0038213
937 Ga0495643_0086102
938 Ga0495652_0119334
939 Ga0495640_0058710
940 Ga0495587_0056697
941 Ga0495597_0012545
942 Ga0495633_0047575
943 Ga0495633_0279821
944 Ga0495656_0068928
945 Ga0495656_0127804
946 Ga0495668_0003583
947 Ga0495668_0037863
948 Ga0495611_0003021
949 Ga0495625_0002190
950 Ga0495625_0075147
951 Ga0495625_0297746
952 Ga0495635_0035183
953 Ga0495661_0226546
954 Ga0495588_0033187
955 Ga0495657_0054655
956 Ga0495624_0056174
957 Ga0495670_0023596
958 Ga0495670_0054915
959 Ga0495670_0460579
960 Ga0495671_0140042
961 Ga0495649_0201381
962 Ga0495649_0359782
963 Ga0495600_0110988
964 Ga0495604_0065192
965 Ga0495636_0019889
966 Ga0495674_0491206
967 Ga0495672_0005896
968 Ga0495687_020307
969 Ga0495687_102134
970 Ga0495679_055582
971 Ga0495681_0029736
972 Ga0495686_0001073
973 Ga0495686_0005102
974 Ga0495686_0101949
975 Ga0495686_0217949
976 Ga0495686_0306845
977 Ga0495686_0379424
978 Ga0495626_0023555
979 Ga0496100_0002352
980 Ga0496100_0438589
981 Ga0496101_0128394
982 Ga0496101_0254256
983 Ga0496102_0005955
984 Ga0496102_0198688
985 Ga0496103_0001184
986 Ga0496103_1050657
987 Ga0496104_0799759
988 Ga0496105_0026425
989 Ga0496106_0000125
990 Ga0496106_0106628
991 Ga0496106_0856927
992 Ga0496107_0062984
993 Ga0496111_0593016
994 Ga0496113_0016531
995 Ga0496113_0564739
996 Ga0496113_0913338
997 Ga0496114_0075401
998 Ga0496114_0175450
999 Ga0496116_0005363
1000 Ga0496116_0009212
1001 Ga0496116_0012844
1002 Ga0496116_0012915
1003 Ga0496116_0028834
1004 Ga0496116_0040914
1005 Ga0496116_0061961
1006 Ga0496116_0238011
1007 Ga0496117_0002198
1008 Ga0496117_0018379
1009 Ga0496117_0082333
1010 Ga0496117_0085495
1011 Ga0496117_0122131
1012 Ga0496118_0002392
1013 Ga0496118_0003857
1014 Ga0496118_0024594
1015 Ga0496118_0092262
1016 Ga0496118_0093505
1017 Ga0496118_0462469
1018 Ga0496119_0004664
1019 Ga0496119_0020340
1020 Ga0496119_0046424
1021 Ga0496119_0074982
1022 Ga0496119_0083065
1023 Ga0496119_0104765
1024 Ga0496120_0004195
1025 Ga0496121_0002775
1026 Ga0496121_0020325
1027 Ga0496121_0031045
1028 Ga0496121_0031418
1029 Ga0496121_0033635
1030 Ga0496121_0072638
1031 Ga0496121_0098968
1032 Ga0496121_0351628
1033 Ga0496121_0366015
1034 Ga0496121_0373303
1035 Ga0496121_0631817
1036 Ga0496122_0005990
1037 Ga0496122_0007088
1038 Ga0496122_0016747
1039 Ga0496122_0032632
1040 Ga0496122_0036840
1041 Ga0496122_0125558
1042 Ga0496122_0318512
1043 Ga0496123_0003616
1044 Ga0496123_0014496
1045 Ga0496123_0028689
1046 Ga0496123_0029563
1047 Ga0496123_0032137
1048 Ga0496123_0117400
1049 Ga0496124_0004003
1050 Ga0496124_0006551
1051 Ga0496124_0045320
1052 Ga0496124_0059163
1053 Ga0496124_0083422
1054 Ga0496124_0156837
1055 Ga0496124_0253195
1056 Ga0496124_0283813
1057 Ga0496124_0405590
1058 Ga0496125_0003639
1059 Ga0496125_0014114
1060 Ga0496125_0177067
1061 Ga0496125_0325152
1062 Ga0496125_0414426
1063 Ga0496125_0551548
1064 Ga0496126_0019302
1065 Ga0496126_0082458
1066 Ga0496126_0187659
1067 Ga0496126_0255179
1068 Ga0496126_0916269
1069 Ga0495678_024147
1070 Ga0495678_052731
1071 Ga0495678_060738
1072 Ga0501032_0034664
1073 Ga0501037_0208924
1074 Ga0501046_0450400
1075 Ga0501047_0431506
1076 Ga0501068_0156585
1077 Ga0501083_0757769
1078 Ga0501044_0174887
1079 nmdc:mga03683_3800_c1
1080 nmdc:mga03n38_100619_c1
1081 nmdc:mga03n38_242829_c1
1082 nmdc:mga00v17_141911_c2
1083 nmdc:mga0yw44_575629_c1
1084 nmdc:mga07m45_390974_c1
1085 nmdc:mga07m45_430618_c1
1086 Ga0500610_0005661
1087 Ga0495655_0122991
1088 Ga0500578_0069068
1089 Ga0500651_0176445
1090 Ga0500557_000494
1091 Ga0500569_003626
1092 Ga0500569_044354
1093 Ga0500594_0000222
1094 Ga0500608_008336
1095 Ga0500618_004170
1096 Ga0500618_012936
1097 Ga0500618_036631
1098 Ga0500658_0002500
1099 Ga0500658_0007286
1100 Ga0500568_0000846
1101 Ga0500568_0003503
1102 Ga0500590_000249
1103 Ga0500604_0295956
1104 Ga0500616_0006239
1105 Ga0500616_0008579
1106 Ga0500622_0242031
1107 Ga0500627_0056756
1108 Ga0500633_0020653
1109 Ga0500633_0103457
1110 Ga0500638_231715
1111 Ga0500636_0067338
1112 Ga0500645_006761
1113 Ga0466962_0188569
1114 2509386687
1115 2509443258
1116 2510133309
1117 2511135114
1118 2511183335
1119 2513572502
1120 2513577277
1121 2513594586
1122 2513708734
1123 2513864644
1124 2513912416
1125 2513926223
1126 2515112269
1127 2515637569
1128 2515639769
1129 2515738581
1130 2517036001
1131 2517076394
1132 2517095152
1133 2520375990
1134 2524460277
1135 2530645524
1136 2535516497
1137 2585200164
1138 2585229986
1139 2585270854
1140 2585277204
1141 2585323787
1142 2585331766
1143 2585402011
1144 2585527636
1145 2585534060
1146 2585537536
1147 2585552089
1148 2585558578
1149 2585821796
1150 2585835486
1151 2585846739
1152 2585897942
1153 2585904453
1154 2587980430
1155 2599417701
1156 2616292461
1157 2616308582
1158 2616557114
1159 2617385665
1160 2644003769
1161 2644192768
1162 2644298502
1163 2644656731
1164 2671111714
1165 2719181181
1166 2719385783
1167 2719665604
1168 2719731930
1169 2720492024
1170 2720613289
1171 2720620165
1172 2720631590
1173 2720775318
1174 2721147275
1175 2721158808
1176 2721164193
1177 2721399563
1178 2722840363
1179 2723026936
1180 2723560551
1181 2723567137
1182 2724038376
1183 2724044686
1184 2724089925
1185 2724104402
1186 2724110194
1187 2725950649
1188 2730107872
1189 2730164418
1190 2730298440
1191 2738802059
1192 2739036498
1193 2766063165
1194 2778174019
1195 2793294669
1196 2793312250
1197 2793322021
1198 2793326659
1199 2793335736
1200 2793341516
1201 2793349077
1202 2793353071
1203 2793361174
1204 2793369264
1205 2805925702
1206 2805933573
1207 2806046048
1208 2806054427
1209 2806060432
1210 2806065110
1211 2806072375
1212 2819241633
1213 2819612794
1214 2819637907
1215 2837653606
1216 2838021476
1217 2838027868
1218 2838030089
1219 2838038086
1220 2838043434
1221 2838052428
1222 2838067744
1223 2838073582
1224 2838667227
1225 2838672033
1226 2838682218
1227 2838689489
1228 2838696789
1229 2838704687
1230 2838709971
1231 2838730822
1232 2838743763
1233 2841857839
1234 2842078144
1235 2842110502
1236 2842119347
1237 2842148573
1238 2842157424
1239 2842164615
1240 2842180991
1241 2842194514
1242 2842203816
1243 2842206045
1244 2842217225
1245 2842230950
1246 2842239383
1247 2842244942
1248 2842254367
1249 2842258755
1250 2842266052
1251 2842273509
1252 2842279502
1253 2842286148
1254 2842291807
1255 2842302041
1256 2842304286
1257 2842316700
1258 2842317911
1259 2842345844
1260 2842357492
1261 2842364525
1262 2842372784
1263 2842378203
1264 2842385856
1265 2842401862
1266 2842403508
1267 2842409119
1268 2842415773
1269 2842428067
1270 2842429311
1271 2842435924
1272 2842442271
1273 2842450562
1274 2842463732
1275 2842470253
1276 2842476626
1277 2842484834
1278 2842490019
1279 2842496181
1280 2842503617
1281 2842511434
1282 2844459170
1283 2852389901
1284 2857518711
1285 2891052118
1286 2919411687
1287 2923557929
1288 2933571562
1289 2933586531
1290 2933603936
1291 2935897355
1292 2935904735
1293 2936372710
1294 2936378563
1295 2936384985
1296 2989779030
1297 2996891699
1298 2996894170
1299 3005415146
1300 3005420104
1301 3005454219
1302 639648525
1303 8005248585
1304 8005263029
1305 8005280560
1306 8005283180
1307 8005290263
1308 8005302556
1309 8005311200
1310 8005317055
1311 8005326226
1312 8005379207
1313 8005388320
1314 8005397152
1315 8005432127
1316 8005462931
1317 8005485150
1318 8005500327
1319 8005545147
1320 8005557725
1321 8005568897
1322 8005570808
1323 8005621702
1324 8005626522
1325 8005645313
1326 8005671744
1327 8005683186
1328 8005694569
1329 8005700030
1330 8018129911
1331 8018166811
1332 8018179843
1333 8023685398
1334 8024483552
1335 8024492263
1336 8024506602
1337 8046773791
1338 8056376616
1339 8056387827
1340 8056877535
1341 8057576835
1342 8057875075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01288

HPPK

7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)

4

132

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ru1-assembly1.cif.gz_A crystal structure of a ternary complex of e. coli hppk(v83g/del84-89) with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin at 1.40 angstrom resolution (monoclinic form) 0.944 4 130
2cg8-assembly1.cif.gz_D-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.942 3 129
6an4-assembly1.cif.gz_A crystal structure of escherichia coli hppk in complex with bisubstrate analogue inhibitor hp-39 (j1f) 0.9419 4 130
3hsg-assembly1.cif.gz_A crystal structure of e. coli hppk(y53a) in complex with mgampcpp 0.9386 3 130
2cg8-assembly1.cif.gz_B-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9321 3 129
ID Description Score Start End Superfamily
2cg8A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9304 3 128 3.30.70.560
3mcmB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8994 3 136 3.30.70.560
af_Q4LB35_295_465_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8977 4 138 3.30.70.560
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.893 2 130 3.30.70.560
4cyuA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8819 4 138 3.30.70.560
ID Description Score Start End GO Terms
AF-A0A6S6N7D3-F1-model_v4 deleted 0.963 1 149
AF-A0A1M6JUQ0-F1-model_v4 deleted 0.962 1 146
AF-A0A7Z7YSH0-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9594 4 127 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A657LQ54-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase) 0.9587 1 148 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A7W3ZGZ2-F1-model_v4 deleted 0.9581 1 149

Map