F474193

General Info

Members Datasets Scaffolds Average Seq Length
671 277 1342 203

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_326364_c1|nmdc:mga0qj67_326364_c1_412_1041
Length 209
Sequence MQANPRKTSSLRHLGKVDIAQLREAVLTIPESVWDAEDQNKPNRRYQQVVGGAWVPVPGRVFATTRHIIFRFIASQQDWRESADWPLWXXXRERLLPVMEQATRPYGYVHAAYPRVMLARMASGAEILPHMDNKPAAQWPHKIHVPLLTNPQVGFRIGDTIHHLPEGEAVEVNNLGIHAVRNDGTTDRIHLIFEYYDLDQPDPDWMLAR

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
191 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
192 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
193 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
194 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
197 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
198 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
199 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
200 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
201 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
202 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
203 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
204 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
205 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
206 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
256 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
257 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
258 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
259 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
264 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
265 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
266 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
269 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
270 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
271 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
272 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
273 2643221573 Lysobacter sp. Root604 Isolate Unclassified
274 2643221695 Lysobacter sp. Root494 Isolate Unclassified
275 2643221720 Lysobacter sp. Root916 Isolate Unclassified
276 2643221728 Lysobacter sp. Root983 Isolate Unclassified
277 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.9
Nodule 0
Rhizoplane 4.17
Rhizosphere 85.54
Stem 0
Stem Tuber 0
Unclassified 4.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_326364_c1 3300050509 Bacteria 1242
2 JGI24741J21665_1003534 3300001915 Bacteria 3699
3 JGI24740J21852_10000857 3300001979 Bacteria 13446
4 JGI24740J21852_10001632 3300001979 Bacteria 10338
5 JGI24739J22299_10003054 3300001989 Bacteria 6393
6 JGI24739J22299_10042028 3300001989 Bacteria 1517
7 JGI24737J22298_10000013 3300001990 Bacteria 50248
8 JGI24737J22298_10012867 3300001990 Bacteria 2728
9 JGI24743J22301_10049743 3300001991 Bacteria 852
10 JGI24735J21928_10009048 3300002067 Bacteria 3207
11 JGI24735J21928_10025709 3300002067 Bacteria 1775
12 JGI24738J21930_10000935 3300002075 Bacteria 8390
13 JGI24738J21930_10001252 3300002075 Bacteria 7139
14 JGI24034J26672_10003481 3300002239 Bacteria 2198
15 JGI25151J46595_10031913 3300003187 Bacteria 2050
16 rootL2_10004035 3300003322 Bacteria 4936
17 rootL2_10285272 3300003322 Bacteria 1196
18 rootH1_10017335 3300003323 Bacteria 2589
19 Ga0055526_1033652 3300003771 Bacteria 1418
20 Ga0055524_1028215 3300003775 Bacteria 1686
21 Ga0055524_1030132 3300003775 Bacteria 1587
22 Ga0055524_1043564 3300003775 Bacteria 1102
23 Ga0055536_1010416 3300003781 Bacteria 3692
24 Ga0055536_1010650 3300003781 Bacteria 3618
25 Ga0055536_1033813 3300003781 Bacteria 1300
26 Ga0055536_1035068 3300003781 Bacteria 1259
27 Ga0055536_1061546 3300003781 Bacteria 775
28 Ga0055530_10001236 3300003791 Bacteria 19505
29 Ga0055531_10003252 3300003794 Bacteria 10433
30 Ga0055531_10005027 3300003794 Bacteria 7838
31 Ga0055531_10006427 3300003794 Bacteria 6675
32 Ga0055531_10010682 3300003794 Bacteria 4530
33 Ga0055531_10060621 3300003794 Bacteria 927
34 Ga0065715_10117808 3300005293 Bacteria 2333
35 Ga0065715_10132066 3300005293 Bacteria 1996
36 Ga0065715_10175878 3300005293 Unclassified 1512
37 Ga0065707_10355873 3300005295 Bacteria 911
38 Ga0070658_10018232 3300005327 Bacteria 5617
39 Ga0070658_10100047 3300005327 Bacteria 2396
40 Ga0070658_10399850 3300005327 Bacteria 1180
41 Ga0070676_10005926 3300005328 Bacteria 6524
42 Ga0070676_10160367 3300005328 Bacteria 1447
43 Ga0070670_100015868 3300005331 Bacteria 6463
44 Ga0070670_100092998 3300005331 Bacteria 2593
45 Ga0070670_100149741 3300005331 Bacteria 2020
46 Ga0070670_100329365 3300005331 Bacteria 1339
47 Ga0070670_100334446 3300005331 Bacteria 1329
48 Ga0068869_100000651 3300005334 Bacteria 19629
49 Ga0068869_100018311 3300005334 Bacteria 4766
50 Ga0068869_101054087 3300005334 Bacteria 710
51 Ga0070666_10002844 3300005335 Bacteria 10459
52 Ga0070666_10007885 3300005335 Bacteria 6579
53 Ga0070680_100172409 3300005336 Unclassified 1821
54 Ga0070680_100244956 3300005336 Bacteria 1515
55 Ga0070682_100009836 3300005337 Bacteria 5416
56 Ga0068868_100005000 3300005338 Bacteria 9316
57 Ga0068868_100005456 3300005338 Bacteria 8939
58 Ga0070660_100004844 3300005339 Bacteria 9298
59 Ga0070660_100015525 3300005339 Bacteria 5503
60 Ga0070660_100041116 3300005339 Bacteria 3522
61 Ga0070660_100163807 3300005339 Bacteria 1793
62 Ga0070689_100035338 3300005340 Bacteria 3819
63 Ga0070687_100019629 3300005343 Bacteria 3148
64 Ga0070661_100014003 3300005344 Bacteria 5640
65 Ga0070661_100029851 3300005344 Bacteria 3937
66 Ga0070661_100059002 3300005344 Bacteria 2813
67 Ga0070661_100134669 3300005344 Bacteria 1858
68 Ga0070661_100848087 3300005344 Bacteria 752
69 Ga0070692_10008464 3300005345 Bacteria 4591
70 Ga0070692_10020838 3300005345 Bacteria 3183
71 Ga0070668_100006224 3300005347 Bacteria 8841
72 Ga0070668_100063822 3300005347 Bacteria 2855
73 Ga0070668_100111974 3300005347 Bacteria 2173
74 Ga0070668_100124506 3300005347 Bacteria 2064
75 Ga0070668_100376224 3300005347 Bacteria 1208
76 Ga0070668_100488934 3300005347 Bacteria 1064
77 Ga0070669_100000319 3300005353 Bacteria 37553
78 Ga0070669_100090988 3300005353 Bacteria 2287
79 Ga0070669_100210320 3300005353 Bacteria 1534
80 Ga0070669_100300199 3300005353 Unclassified 1291
81 Ga0070669_100437139 3300005353 Bacteria 1076
82 Ga0070669_100494997 3300005353 Bacteria 1013
83 Ga0070675_100008839 3300005354 Bacteria 7830
84 Ga0070675_100010756 3300005354 Bacteria 7158
85 Ga0070675_100354169 3300005354 Bacteria 1302
86 Ga0070671_100000356 3300005355 Bacteria 31426
87 Ga0070671_100001617 3300005355 Bacteria 16971
88 Ga0070671_100003440 3300005355 Bacteria 12355
89 Ga0070671_100004676 3300005355 Bacteria 10862
90 Ga0070671_100036498 3300005355 Bacteria 4076
91 Ga0070671_100068598 3300005355 Bacteria 2958
92 Ga0070671_100238383 3300005355 Bacteria 1544
93 Ga0070674_100010722 3300005356 Bacteria 5554
94 Ga0070674_100017030 3300005356 Bacteria 4563
95 Ga0070674_100052279 3300005356 Bacteria 2818
96 Ga0070674_100085184 3300005356 Bacteria 2267
97 Ga0070674_100170102 3300005356 Bacteria 1660
98 Ga0070674_100286761 3300005356 Bacteria 1307
99 Ga0070674_100432097 3300005356 Bacteria 1083
100 Ga0070674_100525659 3300005356 Bacteria 989
101 Ga0070673_100000675 3300005364 Bacteria 18818
102 Ga0070673_100025388 3300005364 Bacteria 4360
103 Ga0070673_100440349 3300005364 Bacteria 1171
104 Ga0070673_100561239 3300005364 Bacteria 1038
105 Ga0070659_100001722 3300005366 Bacteria 15711
106 Ga0070659_100007979 3300005366 Bacteria 7715
107 Ga0070659_100045598 3300005366 Bacteria 3434
108 Ga0070659_100129051 3300005366 Bacteria 2052
109 Ga0070659_100174895 3300005366 Bacteria 1760
110 Ga0070659_100411285 3300005366 Bacteria 1143
111 Ga0070667_100001265 3300005367 Bacteria 22928
112 Ga0070667_100008606 3300005367 Bacteria 8459
113 Ga0070667_100044671 3300005367 Bacteria 3722
114 Ga0070667_100639329 3300005367 Unclassified 982
115 Ga0070714_100043979 3300005435 Bacteria 3780
116 Ga0070713_100693070 3300005436 Unclassified 972
117 Ga0070694_100007483 3300005444 Bacteria 6660
118 Ga0070663_100004495 3300005455 Bacteria 8213
119 Ga0070663_100256763 3300005455 Bacteria 1385
120 Ga0070678_100011915 3300005456 Bacteria 5382
121 Ga0070678_100012540 3300005456 Bacteria 5275
122 Ga0070662_100001355 3300005457 Bacteria 15049
123 Ga0070662_100002363 3300005457 Bacteria 11597
124 Ga0070662_100003335 3300005457 Bacteria 10015
125 Ga0070662_100014311 3300005457 Bacteria 5298
126 Ga0070662_100030837 3300005457 Bacteria 3756
127 Ga0070662_100073125 3300005457 Bacteria 2533
128 Ga0070681_10076341 3300005458 Bacteria 3309
129 Ga0070681_10319216 3300005458 Bacteria 1463
130 Ga0070681_10691809 3300005458 Bacteria 935
131 Ga0068867_100003550 3300005459 Bacteria 10965
132 Ga0068867_100010679 3300005459 Bacteria 6477
133 Ga0068867_100223897 3300005459 Bacteria 1517
134 Ga0068867_100934711 3300005459 Bacteria 782
135 Ga0070706_100165529 3300005467 Bacteria 2065
136 Ga0070679_100061978 3300005530 Unclassified 3727
137 Ga0070679_100084097 3300005530 Bacteria 3170
138 Ga0070679_100283444 3300005530 Bacteria 1609
139 Ga0070679_100309920 3300005530 Bacteria 1528
140 Ga0070679_100599459 3300005530 Bacteria 1045
141 Ga0070684_100146234 3300005535 Bacteria 2139
142 Ga0068853_100008649 3300005539 Bacteria 8184
143 Ga0068853_100146353 3300005539 Bacteria 2123
144 Ga0068853_100579055 3300005539 Bacteria 1065
145 Ga0070672_100000668 3300005543 Bacteria 20156
146 Ga0070672_100024701 3300005543 Bacteria 4446
147 Ga0070672_100027847 3300005543 Bacteria 4220
148 Ga0070672_100060167 3300005543 Bacteria 2990
149 Ga0070672_100103270 3300005543 Bacteria 2315
150 Ga0070672_100270766 3300005543 Unclassified 1434
151 Ga0070695_100033084 3300005545 Bacteria 3234
152 Ga0070696_100022566 3300005546 Bacteria 4277
153 Ga0070693_100007166 3300005547 Bacteria 5439
154 Ga0070665_100034682 3300005548 Bacteria 5076
155 Ga0070665_100120974 3300005548 Bacteria 2619
156 Ga0070665_100363178 3300005548 Bacteria 1454
157 Ga0070704_100108118 3300005549 Bacteria 2111
158 Ga0068855_100003914 3300005563 Bacteria 18177
159 Ga0068855_100038250 3300005563 Bacteria 5701
160 Ga0068855_100090451 3300005563 Bacteria 3532
161 Ga0070664_100005277 3300005564 Bacteria 10368
162 Ga0070664_100006472 3300005564 Bacteria 9442
163 Ga0070664_100034748 3300005564 Bacteria 4229
164 Ga0070664_100055635 3300005564 Bacteria 3360
165 Ga0070664_100065545 3300005564 Bacteria 3099
166 Ga0070664_100261231 3300005564 Bacteria 1558
167 Ga0070664_100679635 3300005564 Bacteria 958
168 Ga0068857_100000246 3300005577 Bacteria 36409
169 Ga0068857_100066598 3300005577 Bacteria 3205
170 Ga0068857_100079147 3300005577 Bacteria 2934
171 Ga0068857_100386753 3300005577 Bacteria 1300
172 Ga0068854_100000337 3300005578 Bacteria 30470
173 Ga0068854_100008850 3300005578 Bacteria 6479
174 Ga0068854_100052088 3300005578 Bacteria 2934
175 Ga0068854_100269087 3300005578 Unclassified 1367
176 Ga0068854_100292429 3300005578 Bacteria 1315
177 Ga0068856_100310228 3300005614 Bacteria 1595
178 Ga0068852_100004492 3300005616 Bacteria 9861
179 Ga0068852_100015237 3300005616 Bacteria 5953
180 Ga0068852_100112161 3300005616 Bacteria 2481
181 Ga0068852_100526411 3300005616 Bacteria 1180
182 Ga0068859_100020576 3300005617 Bacteria 6621
183 Ga0068859_100102752 3300005617 Bacteria 2916
184 Ga0068864_100000810 3300005618 Bacteria 26293
185 Ga0068864_100034527 3300005618 Bacteria 4302
186 Ga0068864_100069433 3300005618 Bacteria 3064
187 Ga0068864_100078348 3300005618 Bacteria 2892
188 Ga0068861_100002114 3300005719 Bacteria 12859
189 Ga0068861_100118555 3300005719 Bacteria 2132
190 Ga0068861_100376400 3300005719 Bacteria 1253
191 Ga0068851_10046854 3300005834 Bacteria 2188
192 Ga0068870_10029673 3300005840 Bacteria 2757
193 Ga0068863_100006391 3300005841 Bacteria 11555
194 Ga0068863_100711167 3300005841 Bacteria 999
195 Ga0068858_100001398 3300005842 Bacteria 24841
196 Ga0068858_100005575 3300005842 Bacteria 12316
197 Ga0068858_100546919 3300005842 Bacteria 1121
198 Ga0068858_101116584 3300005842 Bacteria 774
199 Ga0068860_100013628 3300005843 Bacteria 7969
200 Ga0068860_100107091 3300005843 Bacteria 2671
201 Ga0068860_100193083 3300005843 Bacteria 1971
202 Ga0068862_100021398 3300005844 Bacteria 5404
203 Ga0068862_100071902 3300005844 Bacteria 2987
204 Ga0068862_100276550 3300005844 Bacteria 1537
205 Ga0081540_1093870 3300005983 Bacteria 1312
206 Ga0097621_100105496 3300006237 Bacteria 2376
207 Ga0097621_100538086 3300006237 Bacteria 1062
208 Ga0097621_100820258 3300006237 Bacteria 863
209 Ga0068871_100235563 3300006358 Unclassified 1590
210 Ga0075428_100028540 3300006844 Bacteria 6173
211 Ga0075428_100284426 3300006844 Bacteria 1779
212 Ga0075431_100157480 3300006847 Bacteria 2336
213 Ga0075429_100064132 3300006880 Bacteria 3200
214 Ga0068865_100000374 3300006881 Bacteria 24788
215 Ga0068865_100470784 3300006881 Bacteria 1042
216 Ga0097620_100020575 3300006931 Bacteria 6621
217 Ga0097620_100102753 3300006931 Bacteria 2916
218 Ga0097620_100696124 3300006931 Bacteria 1107
219 Ga0105240_10031565 3300009093 Bacteria 6868
220 Ga0105240_10547186 3300009093 Unclassified 1281
221 Ga0111539_10209784 3300009094 Bacteria 2270
222 Ga0105245_10000275 3300009098 Bacteria 48749
223 Ga0105243_10100127 3300009148 Bacteria 2404
224 Ga0105241_10021669 3300009174 Bacteria 4754
225 Ga0105241_10201404 3300009174 Unclassified 1663
226 Ga0105242_10279981 3300009176 Bacteria 1515
227 Ga0105248_10000001 3300009177 Bacteria 1881304
228 Ga0105248_10001002 3300009177 Bacteria 31241
229 Ga0105248_10008541 3300009177 Bacteria 11243
230 Ga0105248_10041900 3300009177 Bacteria 5134
231 Ga0105248_10091476 3300009177 Bacteria 3426
232 Ga0105237_10003164 3300009545 Bacteria 19773
233 Ga0105238_10067722 3300009551 Bacteria 3571
234 Ga0105238_10185367 3300009551 Bacteria 2057
235 Ga0105249_10053856 3300009553 Bacteria 3678
236 Ga0105249_10095314 3300009553 Bacteria 2790
237 Ga0105239_10024971 3300010375 Bacteria 6583
238 Ga0105239_10877812 3300010375 Bacteria 1029
239 Ga0105246_10012920 3300011119 Bacteria 5224
240 Ga0157373_10025963 3300013100 Bacteria 4233
241 Ga0157373_10031370 3300013100 Bacteria 3826
242 Ga0157373_10043878 3300013100 Bacteria 3193
243 Ga0157373_10071003 3300013100 Bacteria 2460
244 Ga0157371_10000637 3300013102 Bacteria 41589
245 Ga0157371_10060928 3300013102 Bacteria 2675
246 Ga0157371_10137533 3300013102 Bacteria 1740
247 Ga0157371_10216097 3300013102 Unclassified 1376
248 Ga0157370_10006047 3300013104 Bacteria 13441
249 Ga0157374_10046999 3300013296 Bacteria 3999
250 Ga0157378_10002341 3300013297 Bacteria 16827
251 Ga0157378_10246727 3300013297 Bacteria 1708
252 Ga0163162_10058474 3300013306 Bacteria 3884
253 Ga0163162_10168603 3300013306 Bacteria 2314
254 Ga0157372_10146066 3300013307 Bacteria 2727
255 Ga0157372_10164726 3300013307 Bacteria 2563
256 Ga0157375_10088799 3300013308 Bacteria 3146
257 Ga0157375_10646789 3300013308 Bacteria 1214
258 Ga0157375_11315540 3300013308 Bacteria 850
259 Ga0157380_10009958 3300014326 Bacteria 6822
260 Ga0157380_10825366 3300014326 Bacteria 946
261 Ga0157379_10121365 3300014968 Bacteria 2351
262 Ga0207425_1017920 3300025245 Bacteria 1546
263 Ga0209130_1004853 3300025284 Bacteria 4909
264 Ga0209675_1010132 3300025291 Bacteria 3248
265 Ga0209675_1015047 3300025291 Bacteria 2319
266 Ga0209676_1000853 3300025292 Bacteria 39341
267 Ga0209676_1001374 3300025292 Bacteria 23748
268 Ga0209676_1004286 3300025292 Bacteria 8042
269 Ga0209676_1004361 3300025292 Bacteria 7920
270 Ga0209676_1009285 3300025292 Bacteria 4260
271 Ga0209676_1032853 3300025292 Bacteria 1554
272 Ga0209676_1038842 3300025292 Bacteria 1358
273 Ga0209025_1001514 3300025294 Bacteria 29830
274 Ga0209025_1045192 3300025294 Bacteria 1829
275 Ga0209050_1000652 3300025298 Bacteria 53645
276 Ga0209050_1010093 3300025298 Bacteria 4705
277 Ga0209256_1004674 3300025299 Bacteria 8409
278 Ga0209256_1005718 3300025299 Bacteria 6973
279 Ga0209256_1007836 3300025299 Bacteria 5132
280 Ga0209051_1018108 3300025303 Bacteria 3126
281 Ga0209257_1000378 3300025304 Bacteria 88945
282 Ga0209257_1001186 3300025304 Bacteria 32842
283 Ga0209257_1001359 3300025304 Bacteria 29586
284 Ga0209257_1001512 3300025304 Bacteria 27306
285 Ga0209257_1001632 3300025304 Bacteria 25694
286 Ga0209257_1031756 3300025304 Bacteria 1685
287 Ga0209257_1065175 3300025304 Bacteria 977
288 Ga0207697_10000112 3300025315 Bacteria 37791
289 Ga0207697_10128414 3300025315 Bacteria 1094
290 Ga0207656_10031573 3300025321 Bacteria 2196
291 Ga0207682_10053215 3300025893 Bacteria 1679
292 Ga0207688_10003553 3300025901 Bacteria 8506
293 Ga0207688_10042413 3300025901 Bacteria 2533
294 Ga0207688_10211327 3300025901 Bacteria 1166
295 Ga0207680_10000271 3300025903 Bacteria 24747
296 Ga0207680_10005882 3300025903 Bacteria 5891
297 Ga0207680_10077597 3300025903 Bacteria 2078
298 Ga0207647_10000101 3300025904 Bacteria 66258
299 Ga0207647_10001771 3300025904 Bacteria 16572
300 Ga0207647_10013159 3300025904 Bacteria 5748
301 Ga0207645_10000896 3300025907 Bacteria 24720
302 Ga0207645_10009043 3300025907 Bacteria 6915
303 Ga0207645_10265398 3300025907 Bacteria 1138
304 Ga0207643_10181846 3300025908 Bacteria 1273
305 Ga0207705_10001965 3300025909 Bacteria 16037
306 Ga0207705_10004972 3300025909 Bacteria 9974
307 Ga0207705_10051806 3300025909 Bacteria 2954
308 Ga0207707_10162887 3300025912 Bacteria 1950
309 Ga0207695_10070818 3300025913 Bacteria 3562
310 Ga0207671_10006191 3300025914 Bacteria 10744
311 Ga0207657_10002057 3300025919 Bacteria 21773
312 Ga0207657_10008696 3300025919 Bacteria 10278
313 Ga0207657_10020154 3300025919 Bacteria 6309
314 Ga0207657_10026236 3300025919 Bacteria 5358
315 Ga0207657_10083306 3300025919 Bacteria 2683
316 Ga0207657_10127354 3300025919 Bacteria 2090
317 Ga0207649_10009357 3300025920 Bacteria 5362
318 Ga0207649_10062811 3300025920 Bacteria 2342
319 Ga0207649_10104872 3300025920 Bacteria 1878
320 Ga0207652_10072744 3300025921 Unclassified 2990
321 Ga0207652_10215798 3300025921 Bacteria 1728
322 Ga0207652_10218738 3300025921 Bacteria 1716
323 Ga0207681_10001255 3300025923 Bacteria 16359
324 Ga0207681_10025491 3300025923 Bacteria 3804
325 Ga0207681_10402425 3300025923 Bacteria 1106
326 Ga0207681_10452786 3300025923 Bacteria 1044
327 Ga0207694_10182980 3300025924 Bacteria 1700
328 Ga0207650_10030898 3300025925 Bacteria 3863
329 Ga0207650_10710764 3300025925 Bacteria 849
330 Ga0207659_10002669 3300025926 Bacteria 10632
331 Ga0207659_10060116 3300025926 Bacteria 2734
332 Ga0207659_10173203 3300025926 Bacteria 1704
333 Ga0207687_10001375 3300025927 Bacteria 16604
334 Ga0207700_10715139 3300025928 Unclassified 894
335 Ga0207644_10000794 3300025931 Bacteria 20032
336 Ga0207644_10006565 3300025931 Bacteria 7578
337 Ga0207644_10013382 3300025931 Bacteria 5467
338 Ga0207644_10015555 3300025931 Bacteria 5110
339 Ga0207644_10083017 3300025931 Bacteria 2372
340 Ga0207644_10282663 3300025931 Bacteria 1333
341 Ga0207690_10000830 3300025932 Bacteria 19806
342 Ga0207690_10001735 3300025932 Bacteria 13389
343 Ga0207690_10012431 3300025932 Bacteria 5091
344 Ga0207690_10058154 3300025932 Bacteria 2614
345 Ga0207690_10284017 3300025932 Bacteria 1290
346 Ga0207690_10300264 3300025932 Bacteria 1256
347 Ga0207690_10515515 3300025932 Unclassified 968
348 Ga0207706_10000318 3300025933 Bacteria 52104
349 Ga0207706_10002476 3300025933 Bacteria 17998
350 Ga0207706_10004182 3300025933 Bacteria 13591
351 Ga0207706_10011384 3300025933 Bacteria 8104
352 Ga0207706_10019015 3300025933 Bacteria 6179
353 Ga0207706_10034041 3300025933 Bacteria 4534
354 Ga0207706_10037251 3300025933 Bacteria 4320
355 Ga0207706_10048438 3300025933 Bacteria 3758
356 Ga0207706_10518769 3300025933 Bacteria 1027
357 Ga0207706_10630625 3300025933 Bacteria 919
358 Ga0207686_10503411 3300025934 Bacteria 940
359 Ga0207709_10145224 3300025935 Bacteria 1636
360 Ga0207709_10228144 3300025935 Unclassified 1347
361 Ga0207670_10024552 3300025936 Bacteria 3769
362 Ga0207669_10003616 3300025937 Bacteria 6705
363 Ga0207669_10013957 3300025937 Bacteria 4012
364 Ga0207669_10020878 3300025937 Bacteria 3444
365 Ga0207669_10473846 3300025937 Bacteria 996
366 Ga0207669_10582272 3300025937 Bacteria 907
367 Ga0207704_10003539 3300025938 Bacteria 7103
368 Ga0207704_10147272 3300025938 Bacteria 1656
369 Ga0207691_10000593 3300025940 Bacteria 36106
370 Ga0207691_10002976 3300025940 Bacteria 16541
371 Ga0207691_10016716 3300025940 Bacteria 6967
372 Ga0207691_10040559 3300025940 Bacteria 4300
373 Ga0207691_10134588 3300025940 Bacteria 2181
374 Ga0207691_10157034 3300025940 Bacteria 1997
375 Ga0207691_10176782 3300025940 Bacteria 1867
376 Ga0207711_10000001 3300025941 Bacteria 1325674
377 Ga0207711_10000823 3300025941 Bacteria 30322
378 Ga0207711_10003620 3300025941 Bacteria 13367
379 Ga0207711_10077818 3300025941 Bacteria 2892
380 Ga0207689_10000016 3300025942 Bacteria 118140
381 Ga0207661_10014686 3300025944 Bacteria 5745
382 Ga0207679_10031679 3300025945 Bacteria 3703
383 Ga0207679_10089834 3300025945 Bacteria 2372
384 Ga0207679_10196631 3300025945 Bacteria 1681
385 Ga0207679_10262005 3300025945 Bacteria 1475
386 Ga0207679_10351965 3300025945 Bacteria 1284
387 Ga0207667_10015822 3300025949 Bacteria 8549
388 Ga0207667_10031806 3300025949 Bacteria 5693
389 Ga0207667_10256584 3300025949 Bacteria 1788
390 Ga0207651_10074504 3300025960 Bacteria 2418
391 Ga0207651_10198928 3300025960 Bacteria 1604
392 Ga0207651_10915413 3300025960 Bacteria 781
393 Ga0207712_10000146 3300025961 Bacteria 73378
394 Ga0207668_10000070 3300025972 Bacteria 78666
395 Ga0207668_10058010 3300025972 Bacteria 2704
396 Ga0207668_10189620 3300025972 Bacteria 1628
397 Ga0207668_10223882 3300025972 Unclassified 1512
398 Ga0207668_10669307 3300025972 Bacteria 910
399 Ga0207640_10007415 3300025981 Bacteria 6053
400 Ga0207640_10129552 3300025981 Bacteria 1821
401 Ga0207640_10263868 3300025981 Unclassified 1344
402 Ga0207658_10006101 3300025986 Bacteria 8228
403 Ga0207658_10012129 3300025986 Bacteria 5878
404 Ga0207658_10014061 3300025986 Bacteria 5479
405 Ga0207677_10001192 3300026023 Bacteria 14092
406 Ga0207677_10004539 3300026023 Bacteria 7468
407 Ga0207677_10913905 3300026023 Bacteria 792
408 Ga0207703_10004651 3300026035 Bacteria 11214
409 Ga0207703_10070440 3300026035 Bacteria 2886
410 Ga0207639_10018488 3300026041 Bacteria 4954
411 Ga0207639_10162971 3300026041 Bacteria 1881
412 Ga0207639_10330202 3300026041 Bacteria 1357
413 Ga0207678_10003724 3300026067 Bacteria 13714
414 Ga0207678_10106477 3300026067 Bacteria 2392
415 Ga0207678_10262728 3300026067 Bacteria 1479
416 Ga0207702_10020794 3300026078 Bacteria 5428
417 Ga0207702_10272806 3300026078 Bacteria 1596
418 Ga0207641_10024405 3300026088 Bacteria 4984
419 Ga0207641_10089142 3300026088 Bacteria 2695
420 Ga0207648_10001147 3300026089 Bacteria 29705
421 Ga0207648_10007206 3300026089 Bacteria 10966
422 Ga0207676_10001961 3300026095 Bacteria 14987
423 Ga0207676_10081042 3300026095 Bacteria 2636
424 Ga0207676_10094261 3300026095 Bacteria 2466
425 Ga0207676_10102195 3300026095 Bacteria 2379
426 Ga0207674_10000114 3300026116 Bacteria 93676
427 Ga0207674_10006404 3300026116 Bacteria 13848
428 Ga0207674_10078059 3300026116 Bacteria 3316
429 Ga0207675_100143220 3300026118 Bacteria 2271
430 Ga0207683_10048333 3300026121 Bacteria 3726
431 Ga0207683_10131758 3300026121 Bacteria 2249
432 Ga0207683_10484568 3300026121 Unclassified 1142
433 Ga0207683_10779031 3300026121 Bacteria 888
434 Ga0207698_10002635 3300026142 Bacteria 10659
435 Ga0207698_10068870 3300026142 Unclassified 2796
436 Ga0207698_10322858 3300026142 Bacteria 1447
437 Ga0209974_10008000 3300027876 Bacteria 3623
438 Ga0209974_10079573 3300027876 Bacteria 1126
439 Ga0268266_10022686 3300028379 Bacteria 5344
440 Ga0268266_10394512 3300028379 Bacteria 1307
441 Ga0268265_10010369 3300028380 Bacteria 6294
442 Ga0268265_10016177 3300028380 Bacteria 5121
443 Ga0268265_10151545 3300028380 Bacteria 1956
444 Ga0268264_10000594 3300028381 Bacteria 43886
445 Ga0268264_10054786 3300028381 Bacteria 3331
446 Ga0268264_10321431 3300028381 Unclassified 1463
447 Ga0265338_10082676 3300028800 Bacteria 2688
448 Ga0316182_1184530 3300030745 Bacteria 3386
449 Ga0316182_1278238 3300030745 Bacteria 3352
450 Ga0307408_100105786 3300031548 Bacteria 2152
451 Ga0307408_100142030 3300031548 Bacteria 1885
452 Ga0307408_100315572 3300031548 Bacteria 1315
453 Ga0307408_100379744 3300031548 Bacteria 1208
454 Ga0307408_100547643 3300031548 Bacteria 1020
455 Ga0265314_10004913 3300031711 Bacteria 12211
456 Ga0307405_10020352 3300031731 Bacteria 3706
457 Ga0307405_10032415 3300031731 Bacteria 3089
458 Ga0307405_10061804 3300031731 Bacteria 2369
459 Ga0307405_10331418 3300031731 Bacteria 1166
460 Ga0307413_10060648 3300031824 Bacteria 2330
461 Ga0307413_10116011 3300031824 Bacteria 1803
462 Ga0307413_10129647 3300031824 Bacteria 1723
463 Ga0307413_10140456 3300031824 Bacteria 1668
464 Ga0307413_10262954 3300031824 Unclassified 1287
465 Ga0307413_10920467 3300031824 Bacteria 744
466 Ga0307410_10005694 3300031852 Bacteria 6633
467 Ga0307410_10036610 3300031852 Bacteria 3197
468 Ga0307410_10040475 3300031852 Bacteria 3067
469 Ga0307410_10164828 3300031852 Bacteria 1664
470 Ga0307410_10169745 3300031852 Bacteria 1642
471 Ga0307410_10407287 3300031852 Bacteria 1100
472 Ga0307406_10030245 3300031901 Bacteria 3286
473 Ga0307406_10080479 3300031901 Bacteria 2163
474 Ga0307406_10194182 3300031901 Bacteria 1489
475 Ga0307407_10024481 3300031903 Bacteria 3167
476 Ga0307407_10058005 3300031903 Bacteria 2249
477 Ga0307407_10073810 3300031903 Bacteria 2040
478 Ga0307407_10300111 3300031903 Bacteria 1120
479 Ga0307407_10321665 3300031903 Bacteria 1086
480 Ga0307412_10007004 3300031911 Bacteria 6400
481 Ga0307412_10061212 3300031911 Bacteria 2530
482 Ga0307412_10125587 3300031911 Bacteria 1855
483 Ga0307412_10169349 3300031911 Bacteria 1631
484 Ga0307412_10520437 3300031911 Bacteria 994
485 Ga0307412_10749215 3300031911 Bacteria 843
486 Ga0307409_100049266 3300031995 Bacteria 3211
487 Ga0307409_100224737 3300031995 Bacteria 1697
488 Ga0307409_100495898 3300031995 Bacteria 1188
489 Ga0307416_100016481 3300032002 Bacteria 5139
490 Ga0307416_100069871 3300032002 Bacteria 2909
491 Ga0307416_100208283 3300032002 Bacteria 1862
492 Ga0307416_100228950 3300032002 Bacteria 1790
493 Ga0307416_100341072 3300032002 Bacteria 1511
494 Ga0307414_10017919 3300032004 Bacteria 4345
495 Ga0307414_10065996 3300032004 Bacteria 2585
496 Ga0307414_10108139 3300032004 Bacteria 2109
497 Ga0307414_10136988 3300032004 Bacteria 1910
498 Ga0307414_10226017 3300032004 Bacteria 1540
499 Ga0307414_10527122 3300032004 Bacteria 1049
500 Ga0307411_10003991 3300032005 Bacteria 6971
501 Ga0307411_10013366 3300032005 Bacteria 4528
502 Ga0307411_10069189 3300032005 Bacteria 2383
503 Ga0307411_10120820 3300032005 Bacteria 1895
504 Ga0307411_10187882 3300032005 Bacteria 1574
505 Ga0307411_10609363 3300032005 Bacteria 940
506 Ga0307411_11272591 3300032005 Bacteria 669
507 Ga0307415_100007851 3300032126 Bacteria 5868
508 Ga0307415_100169313 3300032126 Bacteria 1702
509 Ga0307415_100172209 3300032126 Bacteria 1689
510 Ga0307415_100533370 3300032126 Bacteria 1032
511 Ga0307415_100645149 3300032126 Bacteria 948
512 Ga0395899_0395559 3300037312 Bacteria 915
513 Ga0395900_0041349 3300037418 Bacteria 4752
514 Ga0395900_0049368 3300037418 Bacteria 4335
515 Ga0395900_0086592 3300037418 Bacteria 3219
516 Ga0395900_0317473 3300037418 Bacteria 1539
517 Ga0395900_0820216 3300037418 Bacteria 857
518 Ga0395898_0027957 3300037466 Bacteria 5656
519 Ga0395898_0093912 3300037466 Bacteria 2882
520 Ga0395898_0157863 3300037466 Bacteria 2169
521 Ga0395898_0919627 3300037466 Bacteria 812
522 Ga0395905_0000257 3300037471 Bacteria 79555
523 Ga0395905_0020203 3300037471 Bacteria 6309
524 Ga0395905_0026307 3300037471 Bacteria 5487
525 Ga0395905_0045919 3300037471 Bacteria 4097
526 Ga0395905_0046043 3300037471 Bacteria 4091
527 Ga0395905_0065556 3300037471 Bacteria 3400
528 Ga0395905_0069625 3300037471 Bacteria 3296
529 Ga0395905_0174002 3300037471 Bacteria 2021
530 Ga0395905_0204831 3300037471 Bacteria 1849
531 Ga0395905_0272106 3300037471 Unclassified 1580
532 Ga0395905_0298713 3300037471 Bacteria 1497
533 Ga0395905_0305460 3300037471 Bacteria 1479
534 Ga0395905_0317540 3300037471 Bacteria 1447
535 Ga0395905_0537686 3300037471 Unclassified 1069
536 Ga0395905_0660135 3300037471 Unclassified 948
537 Ga0395905_0817775 3300037471 Bacteria 835
538 Ga0395901_0042655 3300038443 Bacteria 4704
539 Ga0395901_0302129 3300038443 Bacteria 1659
540 Ga0395901_0393420 3300038443 Bacteria 1425
541 Ga0395901_0979877 3300038443 Bacteria 822
542 Ga0395901_1009510 3300038443 Bacteria 807
543 Ga0395901_1154210 3300038443 Bacteria 742
544 Ga0439465_0004297 3300041413 Bacteria 4625
545 Ga0451793_1352091 3300041452 Bacteria 925
546 Ga0451802_0622788 3300041460 Unclassified 1220
547 Ga0451806_810621 3300041462 Unclassified 2009
548 Ga0451807_1133111 3300041486 Bacteria 3618
549 Ga0451851_0473752 3300041507 Bacteria 1095
550 Ga0451853_0563708 3300041512 Unclassified 751
551 Ga0439441_051689 3300042001 Bacteria 848
552 Ga0439432_010691 3300042006 Bacteria 3174
553 Ga0439449_0007223 3300042007 Bacteria 4226
554 Ga0439449_0108666 3300042007 Bacteria 1027
555 Ga0439455_0063386 3300042012 Bacteria 983
556 Ga0439462_0001989 3300042015 Bacteria 4675
557 Ga0439462_0113252 3300042015 Bacteria 752
558 Ga0450917_000904 3300042120 Bacteria 2179
559 Ga0450905_002655 3300042142 Bacteria 2309
560 Ga0450889_005177 3300042144 Bacteria 1295
561 Ga0439464_0001880 3300042439 Bacteria 5076
562 Ga0439460_0004452 3300042461 Bacteria 3417
563 Ga0439440_0055322 3300042993 Bacteria 1001
564 Ga0466972_0257898 3300044658 Bacteria 815
565 Ga0466966_0012063 3300044684 Bacteria 5726
566 Ga0466966_0106303 3300044684 Bacteria 1732
567 Ga0466961_0466573 3300044693 Bacteria 764
568 Ga0466961_0485283 3300044693 Bacteria 747
569 Ga0466963_0299563 3300044694 Bacteria 1131
570 Ga0466963_0532399 3300044694 Bacteria 830
571 Ga0466957_0232497 3300044842 Bacteria 1221
572 Ga0466959_0075353 3300045049 Bacteria 2438
573 Ga0466959_0100096 3300045049 Bacteria 2075
574 Ga0466958_0134895 3300045836 Bacteria 1552
575 Ga0466958_0143927 3300045836 Bacteria 1502
576 Ga0466967_0047290 3300045976 Bacteria 3750
577 Ga0466967_0666590 3300045976 Bacteria 1029
578 Ga0495650_0000744 3300046471 Bacteria 40840
579 Ga0495650_0044906 3300046471 Bacteria 1864
580 Ga0495606_0087714 3300046507 Bacteria 1920
581 Ga0495637_0006928 3300046520 Bacteria 5655
582 Ga0495648_0000029 3300046524 Bacteria 223499
583 Ga0495663_0000865 3300046525 Bacteria 10240
584 Ga0495663_0034764 3300046525 Bacteria 1511
585 Ga0495663_0071238 3300046525 Bacteria 1107
586 Ga0495598_0009011 3300046537 Bacteria 2343
587 Ga0495598_0092411 3300046537 Bacteria 989
588 Ga0495621_0061372 3300046539 Bacteria 1365
589 Ga0495656_0081099 3300046615 Bacteria 1464
590 Ga0495668_0000014 3300046616 Bacteria 442055
591 Ga0495668_0017889 3300046616 Bacteria 4106
592 Ga0495625_0000777 3300046660 Bacteria 44363
593 Ga0495625_0337356 3300046660 Bacteria 956
594 Ga0495659_0133207 3300046664 Bacteria 987
595 Ga0495669_0000046 3300046684 Bacteria 83405
596 Ga0495669_0081276 3300046684 Bacteria 1487
597 Ga0495669_0307110 3300046684 Bacteria 765
598 Ga0495670_0077858 3300046691 Bacteria 1686
599 Ga0495636_0000118 3300047318 Bacteria 32623
600 Ga0495636_0014871 3300047318 Bacteria 3097
601 Ga0495636_0040629 3300047318 Bacteria 1928
602 Ga0495672_0002375 3300047320 Bacteria 17376
603 Ga0495685_032435 3300047447 Unclassified 1795
604 Ga0495673_0000597 3300047469 Bacteria 36148
605 Ga0495673_0005592 3300047469 Bacteria 7568
606 Ga0495686_0001938 3300047472 Bacteria 20595
607 Ga0495686_0003054 3300047472 Bacteria 14838
608 Ga0495686_0177379 3300047472 Bacteria 1236
609 Ga0496100_0249157 3300048903 Bacteria 1313
610 Ga0496100_0853191 3300048903 Bacteria 714
611 Ga0496101_0065888 3300048904 Bacteria 2641
612 Ga0496101_0072488 3300048904 Bacteria 2528
613 Ga0496101_0118819 3300048904 Bacteria 1997
614 Ga0496102_0622109 3300048905 Bacteria 1003
615 Ga0496106_0096639 3300048909 Bacteria 2286
616 Ga0496107_0000072 3300048910 Bacteria 48700
617 Ga0496107_0021772 3300048910 Bacteria 4530
618 Ga0496107_0067447 3300048910 Bacteria 2596
619 Ga0496108_0010651 3300048911 Bacteria 7459
620 Ga0496108_0278259 3300048911 Bacteria 1457
621 Ga0496109_0150348 3300048912 Bacteria 2180
622 Ga0496109_0170229 3300048912 Bacteria 2043
623 Ga0496110_0051866 3300048913 Bacteria 3605
624 Ga0496110_0722706 3300048913 Bacteria 898
625 Ga0496111_0028532 3300048914 Bacteria 3955
626 Ga0496111_0489035 3300048914 Bacteria 906
627 Ga0496112_0013201 3300048915 Bacteria 7620
628 Ga0496112_0063780 3300048915 Bacteria 3634
629 Ga0496113_0009123 3300048916 Bacteria 6499
630 Ga0496113_0529771 3300048916 Bacteria 945
631 Ga0496114_0061753 3300048917 Bacteria 3135
632 Ga0496115_0000488 3300048918 Bacteria 31339
633 Ga0496117_0067494 3300048920 Bacteria 2420
634 Ga0496118_0003515 3300048921 Bacteria 19633
635 Ga0496121_0002753 3300048924 Bacteria 26136
636 Ga0496121_0307995 3300048924 Bacteria 1072
637 Ga0496125_0111724 3300048928 Bacteria 1976
638 Ga0496126_0001950 3300048929 Bacteria 29310
639 Ga0496126_0309947 3300048929 Bacteria 1300
640 Ga0501043_0038647 3300049579 Bacteria 3752
641 Ga0501046_0122514 3300049580 Bacteria 1977
642 Ga0501067_0149612 3300049583 Bacteria 1301
643 Ga0501074_0180267 3300049590 Unclassified 1507
644 Ga0501223_040798 3300049663 Bacteria 901
645 Ga0501257_011848 3300049686 Bacteria 1993
646 Ga0501257_070402 3300049686 Bacteria 893
647 Ga0501221_026311 3300049704 Bacteria 1182
648 Ga0501273_036973 3300049770 Bacteria 712
649 Ga0501279_019839 3300049775 Bacteria 953
650 nmdc:mga09592_23810_c1 3300050508 Bacteria 5059
651 nmdc:mga0qj67_118338_c1 3300050509 Bacteria 2142
652 nmdc:mga0qj67_513599_c1 3300050509 Bacteria 963
653 nmdc:mga06r32_602170_c1 3300050510 Bacteria 1070
654 nmdc:mga06r32_7607_c1 3300050510 Bacteria 9742
655 nmdc:mga08y16_188500_c1 3300050511 Bacteria 2140
656 Ga0500644_0000043 3300053088 Bacteria 76139
657 Ga0500566_0260410 3300053094 Bacteria 838
658 Ga0500556_0000466 3300053104 Bacteria 28540
659 Ga0500614_002794 3300053123 Bacteria 3845
660 Ga0500559_0064128 3300053136 Bacteria 1643
661 Ga0500564_000015 3300053138 Bacteria 52672
662 Ga0500604_0000478 3300053151 Bacteria 11043
663 Ga0500619_035578 3300053154 Unclassified 1546
664 Ga0500622_0003266 3300053156 Bacteria 10998
665 Ga0500645_000289 3300053730 Bacteria 36194
666 Ga0500645_021925 3300053730 Bacteria 1968
667 2643881917 2643221573 Bacteria 4784121
668 2644529669 2643221695 Bacteria 3441323
669 2644661576 2643221720 Bacteria 4694283
670 2644701275 2643221728 Bacteria 4797149
671 8003016797 8003014200 Bacteria 4059994
672 nmdc:mga0qj67_326364_c1
673 JGI24741J21665_1003534
674 JGI24740J21852_10000857
675 JGI24740J21852_10001632
676 JGI24739J22299_10003054
677 JGI24739J22299_10042028
678 JGI24737J22298_10000013
679 JGI24737J22298_10012867
680 JGI24743J22301_10049743
681 JGI24735J21928_10009048
682 JGI24735J21928_10025709
683 JGI24738J21930_10000935
684 JGI24738J21930_10001252
685 JGI24034J26672_10003481
686 JGI25151J46595_10031913
687 rootL2_10004035
688 rootL2_10285272
689 rootH1_10017335
690 Ga0055526_1033652
691 Ga0055524_1028215
692 Ga0055524_1030132
693 Ga0055524_1043564
694 Ga0055536_1010416
695 Ga0055536_1010650
696 Ga0055536_1033813
697 Ga0055536_1035068
698 Ga0055536_1061546
699 Ga0055530_10001236
700 Ga0055531_10003252
701 Ga0055531_10005027
702 Ga0055531_10006427
703 Ga0055531_10010682
704 Ga0055531_10060621
705 Ga0065715_10117808
706 Ga0065715_10132066
707 Ga0065715_10175878
708 Ga0065707_10355873
709 Ga0070658_10018232
710 Ga0070658_10100047
711 Ga0070658_10399850
712 Ga0070676_10005926
713 Ga0070676_10160367
714 Ga0070670_100015868
715 Ga0070670_100092998
716 Ga0070670_100149741
717 Ga0070670_100329365
718 Ga0070670_100334446
719 Ga0068869_100000651
720 Ga0068869_100018311
721 Ga0068869_101054087
722 Ga0070666_10002844
723 Ga0070666_10007885
724 Ga0070680_100172409
725 Ga0070680_100244956
726 Ga0070682_100009836
727 Ga0068868_100005000
728 Ga0068868_100005456
729 Ga0070660_100004844
730 Ga0070660_100015525
731 Ga0070660_100041116
732 Ga0070660_100163807
733 Ga0070689_100035338
734 Ga0070687_100019629
735 Ga0070661_100014003
736 Ga0070661_100029851
737 Ga0070661_100059002
738 Ga0070661_100134669
739 Ga0070661_100848087
740 Ga0070692_10008464
741 Ga0070692_10020838
742 Ga0070668_100006224
743 Ga0070668_100063822
744 Ga0070668_100111974
745 Ga0070668_100124506
746 Ga0070668_100376224
747 Ga0070668_100488934
748 Ga0070669_100000319
749 Ga0070669_100090988
750 Ga0070669_100210320
751 Ga0070669_100300199
752 Ga0070669_100437139
753 Ga0070669_100494997
754 Ga0070675_100008839
755 Ga0070675_100010756
756 Ga0070675_100354169
757 Ga0070671_100000356
758 Ga0070671_100001617
759 Ga0070671_100003440
760 Ga0070671_100004676
761 Ga0070671_100036498
762 Ga0070671_100068598
763 Ga0070671_100238383
764 Ga0070674_100010722
765 Ga0070674_100017030
766 Ga0070674_100052279
767 Ga0070674_100085184
768 Ga0070674_100170102
769 Ga0070674_100286761
770 Ga0070674_100432097
771 Ga0070674_100525659
772 Ga0070673_100000675
773 Ga0070673_100025388
774 Ga0070673_100440349
775 Ga0070673_100561239
776 Ga0070659_100001722
777 Ga0070659_100007979
778 Ga0070659_100045598
779 Ga0070659_100129051
780 Ga0070659_100174895
781 Ga0070659_100411285
782 Ga0070667_100001265
783 Ga0070667_100008606
784 Ga0070667_100044671
785 Ga0070667_100639329
786 Ga0070714_100043979
787 Ga0070713_100693070
788 Ga0070694_100007483
789 Ga0070663_100004495
790 Ga0070663_100256763
791 Ga0070678_100011915
792 Ga0070678_100012540
793 Ga0070662_100001355
794 Ga0070662_100002363
795 Ga0070662_100003335
796 Ga0070662_100014311
797 Ga0070662_100030837
798 Ga0070662_100073125
799 Ga0070681_10076341
800 Ga0070681_10319216
801 Ga0070681_10691809
802 Ga0068867_100003550
803 Ga0068867_100010679
804 Ga0068867_100223897
805 Ga0068867_100934711
806 Ga0070706_100165529
807 Ga0070679_100061978
808 Ga0070679_100084097
809 Ga0070679_100283444
810 Ga0070679_100309920
811 Ga0070679_100599459
812 Ga0070684_100146234
813 Ga0068853_100008649
814 Ga0068853_100146353
815 Ga0068853_100579055
816 Ga0070672_100000668
817 Ga0070672_100024701
818 Ga0070672_100027847
819 Ga0070672_100060167
820 Ga0070672_100103270
821 Ga0070672_100270766
822 Ga0070695_100033084
823 Ga0070696_100022566
824 Ga0070693_100007166
825 Ga0070665_100034682
826 Ga0070665_100120974
827 Ga0070665_100363178
828 Ga0070704_100108118
829 Ga0068855_100003914
830 Ga0068855_100038250
831 Ga0068855_100090451
832 Ga0070664_100005277
833 Ga0070664_100006472
834 Ga0070664_100034748
835 Ga0070664_100055635
836 Ga0070664_100065545
837 Ga0070664_100261231
838 Ga0070664_100679635
839 Ga0068857_100000246
840 Ga0068857_100066598
841 Ga0068857_100079147
842 Ga0068857_100386753
843 Ga0068854_100000337
844 Ga0068854_100008850
845 Ga0068854_100052088
846 Ga0068854_100269087
847 Ga0068854_100292429
848 Ga0068856_100310228
849 Ga0068852_100004492
850 Ga0068852_100015237
851 Ga0068852_100112161
852 Ga0068852_100526411
853 Ga0068859_100020576
854 Ga0068859_100102752
855 Ga0068864_100000810
856 Ga0068864_100034527
857 Ga0068864_100069433
858 Ga0068864_100078348
859 Ga0068861_100002114
860 Ga0068861_100118555
861 Ga0068861_100376400
862 Ga0068851_10046854
863 Ga0068870_10029673
864 Ga0068863_100006391
865 Ga0068863_100711167
866 Ga0068858_100001398
867 Ga0068858_100005575
868 Ga0068858_100546919
869 Ga0068858_101116584
870 Ga0068860_100013628
871 Ga0068860_100107091
872 Ga0068860_100193083
873 Ga0068862_100021398
874 Ga0068862_100071902
875 Ga0068862_100276550
876 Ga0081540_1093870
877 Ga0097621_100105496
878 Ga0097621_100538086
879 Ga0097621_100820258
880 Ga0068871_100235563
881 Ga0075428_100028540
882 Ga0075428_100284426
883 Ga0075431_100157480
884 Ga0075429_100064132
885 Ga0068865_100000374
886 Ga0068865_100470784
887 Ga0097620_100020575
888 Ga0097620_100102753
889 Ga0097620_100696124
890 Ga0105240_10031565
891 Ga0105240_10547186
892 Ga0111539_10209784
893 Ga0105245_10000275
894 Ga0105243_10100127
895 Ga0105241_10021669
896 Ga0105241_10201404
897 Ga0105242_10279981
898 Ga0105248_10000001
899 Ga0105248_10001002
900 Ga0105248_10008541
901 Ga0105248_10041900
902 Ga0105248_10091476
903 Ga0105237_10003164
904 Ga0105238_10067722
905 Ga0105238_10185367
906 Ga0105249_10053856
907 Ga0105249_10095314
908 Ga0105239_10024971
909 Ga0105239_10877812
910 Ga0105246_10012920
911 Ga0157373_10025963
912 Ga0157373_10031370
913 Ga0157373_10043878
914 Ga0157373_10071003
915 Ga0157371_10000637
916 Ga0157371_10060928
917 Ga0157371_10137533
918 Ga0157371_10216097
919 Ga0157370_10006047
920 Ga0157374_10046999
921 Ga0157378_10002341
922 Ga0157378_10246727
923 Ga0163162_10058474
924 Ga0163162_10168603
925 Ga0157372_10146066
926 Ga0157372_10164726
927 Ga0157375_10088799
928 Ga0157375_10646789
929 Ga0157375_11315540
930 Ga0157380_10009958
931 Ga0157380_10825366
932 Ga0157379_10121365
933 Ga0207425_1017920
934 Ga0209130_1004853
935 Ga0209675_1010132
936 Ga0209675_1015047
937 Ga0209676_1000853
938 Ga0209676_1001374
939 Ga0209676_1004286
940 Ga0209676_1004361
941 Ga0209676_1009285
942 Ga0209676_1032853
943 Ga0209676_1038842
944 Ga0209025_1001514
945 Ga0209025_1045192
946 Ga0209050_1000652
947 Ga0209050_1010093
948 Ga0209256_1004674
949 Ga0209256_1005718
950 Ga0209256_1007836
951 Ga0209051_1018108
952 Ga0209257_1000378
953 Ga0209257_1001186
954 Ga0209257_1001359
955 Ga0209257_1001512
956 Ga0209257_1001632
957 Ga0209257_1031756
958 Ga0209257_1065175
959 Ga0207697_10000112
960 Ga0207697_10128414
961 Ga0207656_10031573
962 Ga0207682_10053215
963 Ga0207688_10003553
964 Ga0207688_10042413
965 Ga0207688_10211327
966 Ga0207680_10000271
967 Ga0207680_10005882
968 Ga0207680_10077597
969 Ga0207647_10000101
970 Ga0207647_10001771
971 Ga0207647_10013159
972 Ga0207645_10000896
973 Ga0207645_10009043
974 Ga0207645_10265398
975 Ga0207643_10181846
976 Ga0207705_10001965
977 Ga0207705_10004972
978 Ga0207705_10051806
979 Ga0207707_10162887
980 Ga0207695_10070818
981 Ga0207671_10006191
982 Ga0207657_10002057
983 Ga0207657_10008696
984 Ga0207657_10020154
985 Ga0207657_10026236
986 Ga0207657_10083306
987 Ga0207657_10127354
988 Ga0207649_10009357
989 Ga0207649_10062811
990 Ga0207649_10104872
991 Ga0207652_10072744
992 Ga0207652_10215798
993 Ga0207652_10218738
994 Ga0207681_10001255
995 Ga0207681_10025491
996 Ga0207681_10402425
997 Ga0207681_10452786
998 Ga0207694_10182980
999 Ga0207650_10030898
1000 Ga0207650_10710764
1001 Ga0207659_10002669
1002 Ga0207659_10060116
1003 Ga0207659_10173203
1004 Ga0207687_10001375
1005 Ga0207700_10715139
1006 Ga0207644_10000794
1007 Ga0207644_10006565
1008 Ga0207644_10013382
1009 Ga0207644_10015555
1010 Ga0207644_10083017
1011 Ga0207644_10282663
1012 Ga0207690_10000830
1013 Ga0207690_10001735
1014 Ga0207690_10012431
1015 Ga0207690_10058154
1016 Ga0207690_10284017
1017 Ga0207690_10300264
1018 Ga0207690_10515515
1019 Ga0207706_10000318
1020 Ga0207706_10002476
1021 Ga0207706_10004182
1022 Ga0207706_10011384
1023 Ga0207706_10019015
1024 Ga0207706_10034041
1025 Ga0207706_10037251
1026 Ga0207706_10048438
1027 Ga0207706_10518769
1028 Ga0207706_10630625
1029 Ga0207686_10503411
1030 Ga0207709_10145224
1031 Ga0207709_10228144
1032 Ga0207670_10024552
1033 Ga0207669_10003616
1034 Ga0207669_10013957
1035 Ga0207669_10020878
1036 Ga0207669_10473846
1037 Ga0207669_10582272
1038 Ga0207704_10003539
1039 Ga0207704_10147272
1040 Ga0207691_10000593
1041 Ga0207691_10002976
1042 Ga0207691_10016716
1043 Ga0207691_10040559
1044 Ga0207691_10134588
1045 Ga0207691_10157034
1046 Ga0207691_10176782
1047 Ga0207711_10000001
1048 Ga0207711_10000823
1049 Ga0207711_10003620
1050 Ga0207711_10077818
1051 Ga0207689_10000016
1052 Ga0207661_10014686
1053 Ga0207679_10031679
1054 Ga0207679_10089834
1055 Ga0207679_10196631
1056 Ga0207679_10262005
1057 Ga0207679_10351965
1058 Ga0207667_10015822
1059 Ga0207667_10031806
1060 Ga0207667_10256584
1061 Ga0207651_10074504
1062 Ga0207651_10198928
1063 Ga0207651_10915413
1064 Ga0207712_10000146
1065 Ga0207668_10000070
1066 Ga0207668_10058010
1067 Ga0207668_10189620
1068 Ga0207668_10223882
1069 Ga0207668_10669307
1070 Ga0207640_10007415
1071 Ga0207640_10129552
1072 Ga0207640_10263868
1073 Ga0207658_10006101
1074 Ga0207658_10012129
1075 Ga0207658_10014061
1076 Ga0207677_10001192
1077 Ga0207677_10004539
1078 Ga0207677_10913905
1079 Ga0207703_10004651
1080 Ga0207703_10070440
1081 Ga0207639_10018488
1082 Ga0207639_10162971
1083 Ga0207639_10330202
1084 Ga0207678_10003724
1085 Ga0207678_10106477
1086 Ga0207678_10262728
1087 Ga0207702_10020794
1088 Ga0207702_10272806
1089 Ga0207641_10024405
1090 Ga0207641_10089142
1091 Ga0207648_10001147
1092 Ga0207648_10007206
1093 Ga0207676_10001961
1094 Ga0207676_10081042
1095 Ga0207676_10094261
1096 Ga0207676_10102195
1097 Ga0207674_10000114
1098 Ga0207674_10006404
1099 Ga0207674_10078059
1100 Ga0207675_100143220
1101 Ga0207683_10048333
1102 Ga0207683_10131758
1103 Ga0207683_10484568
1104 Ga0207683_10779031
1105 Ga0207698_10002635
1106 Ga0207698_10068870
1107 Ga0207698_10322858
1108 Ga0209974_10008000
1109 Ga0209974_10079573
1110 Ga0268266_10022686
1111 Ga0268266_10394512
1112 Ga0268265_10010369
1113 Ga0268265_10016177
1114 Ga0268265_10151545
1115 Ga0268264_10000594
1116 Ga0268264_10054786
1117 Ga0268264_10321431
1118 Ga0265338_10082676
1119 Ga0316182_1184530
1120 Ga0316182_1278238
1121 Ga0307408_100105786
1122 Ga0307408_100142030
1123 Ga0307408_100315572
1124 Ga0307408_100379744
1125 Ga0307408_100547643
1126 Ga0265314_10004913
1127 Ga0307405_10020352
1128 Ga0307405_10032415
1129 Ga0307405_10061804
1130 Ga0307405_10331418
1131 Ga0307413_10060648
1132 Ga0307413_10116011
1133 Ga0307413_10129647
1134 Ga0307413_10140456
1135 Ga0307413_10262954
1136 Ga0307413_10920467
1137 Ga0307410_10005694
1138 Ga0307410_10036610
1139 Ga0307410_10040475
1140 Ga0307410_10164828
1141 Ga0307410_10169745
1142 Ga0307410_10407287
1143 Ga0307406_10030245
1144 Ga0307406_10080479
1145 Ga0307406_10194182
1146 Ga0307407_10024481
1147 Ga0307407_10058005
1148 Ga0307407_10073810
1149 Ga0307407_10300111
1150 Ga0307407_10321665
1151 Ga0307412_10007004
1152 Ga0307412_10061212
1153 Ga0307412_10125587
1154 Ga0307412_10169349
1155 Ga0307412_10520437
1156 Ga0307412_10749215
1157 Ga0307409_100049266
1158 Ga0307409_100224737
1159 Ga0307409_100495898
1160 Ga0307416_100016481
1161 Ga0307416_100069871
1162 Ga0307416_100208283
1163 Ga0307416_100228950
1164 Ga0307416_100341072
1165 Ga0307414_10017919
1166 Ga0307414_10065996
1167 Ga0307414_10108139
1168 Ga0307414_10136988
1169 Ga0307414_10226017
1170 Ga0307414_10527122
1171 Ga0307411_10003991
1172 Ga0307411_10013366
1173 Ga0307411_10069189
1174 Ga0307411_10120820
1175 Ga0307411_10187882
1176 Ga0307411_10609363
1177 Ga0307411_11272591
1178 Ga0307415_100007851
1179 Ga0307415_100169313
1180 Ga0307415_100172209
1181 Ga0307415_100533370
1182 Ga0307415_100645149
1183 Ga0395899_0395559
1184 Ga0395900_0041349
1185 Ga0395900_0049368
1186 Ga0395900_0086592
1187 Ga0395900_0317473
1188 Ga0395900_0820216
1189 Ga0395898_0027957
1190 Ga0395898_0093912
1191 Ga0395898_0157863
1192 Ga0395898_0919627
1193 Ga0395905_0000257
1194 Ga0395905_0020203
1195 Ga0395905_0026307
1196 Ga0395905_0045919
1197 Ga0395905_0046043
1198 Ga0395905_0065556
1199 Ga0395905_0069625
1200 Ga0395905_0174002
1201 Ga0395905_0204831
1202 Ga0395905_0272106
1203 Ga0395905_0298713
1204 Ga0395905_0305460
1205 Ga0395905_0317540
1206 Ga0395905_0537686
1207 Ga0395905_0660135
1208 Ga0395905_0817775
1209 Ga0395901_0042655
1210 Ga0395901_0302129
1211 Ga0395901_0393420
1212 Ga0395901_0979877
1213 Ga0395901_1009510
1214 Ga0395901_1154210
1215 Ga0439465_0004297
1216 Ga0451793_1352091
1217 Ga0451802_0622788
1218 Ga0451806_810621
1219 Ga0451807_1133111
1220 Ga0451851_0473752
1221 Ga0451853_0563708
1222 Ga0439441_051689
1223 Ga0439432_010691
1224 Ga0439449_0007223
1225 Ga0439449_0108666
1226 Ga0439455_0063386
1227 Ga0439462_0001989
1228 Ga0439462_0113252
1229 Ga0450917_000904
1230 Ga0450905_002655
1231 Ga0450889_005177
1232 Ga0439464_0001880
1233 Ga0439460_0004452
1234 Ga0439440_0055322
1235 Ga0466972_0257898
1236 Ga0466966_0012063
1237 Ga0466966_0106303
1238 Ga0466961_0466573
1239 Ga0466961_0485283
1240 Ga0466963_0299563
1241 Ga0466963_0532399
1242 Ga0466957_0232497
1243 Ga0466959_0075353
1244 Ga0466959_0100096
1245 Ga0466958_0134895
1246 Ga0466958_0143927
1247 Ga0466967_0047290
1248 Ga0466967_0666590
1249 Ga0495650_0000744
1250 Ga0495650_0044906
1251 Ga0495606_0087714
1252 Ga0495637_0006928
1253 Ga0495648_0000029
1254 Ga0495663_0000865
1255 Ga0495663_0034764
1256 Ga0495663_0071238
1257 Ga0495598_0009011
1258 Ga0495598_0092411
1259 Ga0495621_0061372
1260 Ga0495656_0081099
1261 Ga0495668_0000014
1262 Ga0495668_0017889
1263 Ga0495625_0000777
1264 Ga0495625_0337356
1265 Ga0495659_0133207
1266 Ga0495669_0000046
1267 Ga0495669_0081276
1268 Ga0495669_0307110
1269 Ga0495670_0077858
1270 Ga0495636_0000118
1271 Ga0495636_0014871
1272 Ga0495636_0040629
1273 Ga0495672_0002375
1274 Ga0495685_032435
1275 Ga0495673_0000597
1276 Ga0495673_0005592
1277 Ga0495686_0001938
1278 Ga0495686_0003054
1279 Ga0495686_0177379
1280 Ga0496100_0249157
1281 Ga0496100_0853191
1282 Ga0496101_0065888
1283 Ga0496101_0072488
1284 Ga0496101_0118819
1285 Ga0496102_0622109
1286 Ga0496106_0096639
1287 Ga0496107_0000072
1288 Ga0496107_0021772
1289 Ga0496107_0067447
1290 Ga0496108_0010651
1291 Ga0496108_0278259
1292 Ga0496109_0150348
1293 Ga0496109_0170229
1294 Ga0496110_0051866
1295 Ga0496110_0722706
1296 Ga0496111_0028532
1297 Ga0496111_0489035
1298 Ga0496112_0013201
1299 Ga0496112_0063780
1300 Ga0496113_0009123
1301 Ga0496113_0529771
1302 Ga0496114_0061753
1303 Ga0496115_0000488
1304 Ga0496117_0067494
1305 Ga0496118_0003515
1306 Ga0496121_0002753
1307 Ga0496121_0307995
1308 Ga0496125_0111724
1309 Ga0496126_0001950
1310 Ga0496126_0309947
1311 Ga0501043_0038647
1312 Ga0501046_0122514
1313 Ga0501067_0149612
1314 Ga0501074_0180267
1315 Ga0501223_040798
1316 Ga0501257_011848
1317 Ga0501257_070402
1318 Ga0501221_026311
1319 Ga0501273_036973
1320 Ga0501279_019839
1321 nmdc:mga09592_23810_c1
1322 nmdc:mga0qj67_118338_c1
1323 nmdc:mga0qj67_513599_c1
1324 nmdc:mga06r32_602170_c1
1325 nmdc:mga06r32_7607_c1
1326 nmdc:mga08y16_188500_c1
1327 Ga0500644_0000043
1328 Ga0500566_0260410
1329 Ga0500556_0000466
1330 Ga0500614_002794
1331 Ga0500559_0064128
1332 Ga0500564_000015
1333 Ga0500604_0000478
1334 Ga0500619_035578
1335 Ga0500622_0003266
1336 Ga0500645_000289
1337 Ga0500645_021925
1338 2643881917
1339 2644529669
1340 2644661576
1341 2644701275
1342 8003016797

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05118

Asp_Arg_Hydrox

Aspartyl/Asparaginyl beta-hydroxylase

90

197

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.8461 105 184
6b8w-assembly1.cif.gz_B 1.9 angstrom resolution crystal structure of cupin_2 domain (pfam 07883) of xre family transcriptional regulator from enterobacter cloacae. 0.8446 105 186
7zvy-assembly4.cif.gz_H thermococcus kadokarensis phosphomannose isomerase 0.8437 105 184
5wse-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.8332 54 185
5wsf-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.8316 54 185
ID Description Score Start End Superfamily
af_P0A9U6_79_184_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8421 105 185 2.60.120.10
af_P76555_101_233_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8363 105 185 2.60.120.10
af_O86372_11_115_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.825 105 191 2.60.120.10
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8241 105 189 2.60.120.10
af_Q2G2A6_62_177_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8239 105 184 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A522Y629-F1-model_v4 Aspartyl beta-hydroxylase 1.001 7 199
AF-A0A7W3Y531-F1-model_v4 Aspartyl/asparaginyl beta-hydroxylase domain-containing protein 0.9973 3 201
AF-A0A841MAX3-F1-model_v4 deleted 0.9939 3 198
AF-A0A552F449-F1-model_v4 Aspartyl beta-hydroxylase 0.9913 7 187
AF-A0A6N9NNQ7-F1-model_v4 Aspartyl beta-hydroxylase 0.9877 6 188

Map