F474203

General Info

Members Datasets Scaffolds Average Seq Length
672 255 1344 374

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10002767|rootL2_100027672
Length 405
Sequence MNLLPAQQRGGPVAWSGIIAATCVVLFLLQQMLFLAIPFLLGIVLYYILQPPMQRLIRMGVSQNAATLIVGAVFLLLATLAGLAAVLWNSTPSASWQEMLATYTKGGLAFVRHTMRALERQFPLLAQLRLAEMVNDRVSAYTGDFVRAHLTDILVSVAGWLPSLLLAPFLAFFFLRDGLRFKKFLARAVPNAFFERTLCLLHEVDQTAHRYFQGLIRLTILDTAVLALGLWAIGVSSPLVLGLVAAVLAWVPYVGSIVGCVLVVMVASTDAPAEPSVAYLAIGVFILVRLLDDFVFMPLTLGRSLHIHPLITVLMIFIGGSVAGVAGLMLVLPLLGVVMVIGETLGRLITDPRLRARHRNAKRLRTSRPVTISEVKNPCGRCRRQGSGMETARLRRSSHACRPIR

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
91 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
113 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
129 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
132 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
197 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
198 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
199 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
205 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
225 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
226 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
227 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
228 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
229 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
233 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
234 2547132512 Azospira oryzae 6a3 Isolate Unclassified
235 2643221556 Massilia sp. Root1485 Isolate Unclassified
236 2643221645 Massilia sp. Root351 Isolate Unclassified
237 2643221664 Massilia sp. Root418 Isolate Unclassified
238 2643221684 Massilia sp. Root133 Isolate Unclassified
239 2738541280 Massilia sp. GV090 Isolate Unclassified
240 2738541297 Duganella sp. GV083 Isolate Unclassified
241 2738541300 Massilia sp. GV016 Isolate Unclassified
242 2738541357 Duganella sp. GV053 Isolate Unclassified
243 2738543003 Duganella sp. GV066 Isolate Unclassified
244 2738543018 Massilia sp. GV045 Isolate Unclassified
245 2738543026 Duganella sp. GV089 Isolate Unclassified
246 2738543029 Duganella sp. GV039 Isolate Unclassified
247 2738543030 Massilia sp. GV097 Isolate Unclassified
248 2821131069 Duganella sp. 1224 Isolate Unclassified
249 2842711865 Duganella sp. R-73148 Isolate Unclassified
250 2857553236 Duganella sp. R-74557 Isolate Unclassified
251 2857558681 Duganella sp. R-74565 Isolate Unclassified
252 2857564685 Duganella sp. R-74599 Isolate Unclassified
253 2904424332 Duganella sp. 1411 Isolate Rhizosphere
254 2919476304 Duganella sp. 3397 Isolate Unclassified
255 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 0
Isolates 3.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.61
Nodule 0.6
Rhizoplane 2.53
Rhizosphere 86.31
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10002767 3300003322 Bacteria 2271
2 JGI25150J39212_1001795 3300002774 Bacteria 5713
3 JGI25150J39212_1003691 3300002774 Bacteria 3542
4 JGI25159J45721_1006024 3300002987 Bacteria 3699
5 rootH1_10044854 3300003316 Bacteria 1602
6 rootL2_10028108 3300003322 Bacteria 7638
7 Ga0055529_1000015 3300003763 Bacteria 366950
8 Ga0055526_1000007 3300003771 Bacteria 321998
9 Ga0055526_1000037 3300003771 Bacteria 134834
10 Ga0055526_1003417 3300003771 Bacteria 10082
11 Ga0055537_1000236 3300003773 Bacteria 40412
12 Ga0055524_1000439 3300003775 Bacteria 34734
13 Ga0055534_1000544 3300003784 Bacteria 20117
14 Ga0055528_1000136 3300003790 Bacteria 58873
15 Ga0055543_1001195 3300004625 Bacteria 10935
16 Ga0065165_1001295 3300005262 Bacteria 28121
17 Ga0070676_10039038 3300005328 Bacteria 2744
18 Ga0070676_10068598 3300005328 Bacteria 2123
19 Ga0070690_100028400 3300005330 Bacteria 3465
20 Ga0070670_100000689 3300005331 Bacteria 26249
21 Ga0070670_100013594 3300005331 Bacteria 6976
22 Ga0070670_100022939 3300005331 Bacteria 5370
23 Ga0070670_100074011 3300005331 Bacteria 2926
24 Ga0068869_100029485 3300005334 Bacteria 3845
25 Ga0070668_100217061 3300005347 Bacteria 1576
26 Ga0070669_100005113 3300005353 Bacteria 9486
27 Ga0070675_100003057 3300005354 Bacteria 12634
28 Ga0070675_100019380 3300005354 Bacteria 5420
29 Ga0070671_100059881 3300005355 Bacteria 3169
30 Ga0070671_100065644 3300005355 Bacteria 3024
31 Ga0070674_100096447 3300005356 Bacteria 2146
32 Ga0070673_100052655 3300005364 Bacteria 3195
33 Ga0070673_100191944 3300005364 Bacteria 1755
34 Ga0070688_100145446 3300005365 Bacteria 1615
35 Ga0070667_100108852 3300005367 Bacteria 2401
36 Ga0070667_100131469 3300005367 Bacteria 2185
37 Ga0070662_100287400 3300005457 Bacteria 1332
38 Ga0068867_100027693 3300005459 Bacteria 4076
39 Ga0068867_100052665 3300005459 Bacteria 3004
40 Ga0068867_100270360 3300005459 Bacteria 1389
41 Ga0070672_100005705 3300005543 Bacteria 8293
42 Ga0070672_100012074 3300005543 Bacteria 6046
43 Ga0070665_100080218 3300005548 Bacteria 3269
44 Ga0070702_100107829 3300005615 Bacteria 1720
45 Ga0068864_100000792 3300005618 Bacteria 26534
46 Ga0068864_100029176 3300005618 Bacteria 4668
47 Ga0068866_10046624 3300005718 Bacteria 2181
48 Ga0068861_100010977 3300005719 Bacteria 6295
49 Ga0068861_100181652 3300005719 Bacteria 1752
50 Ga0068870_10058125 3300005840 Bacteria 2070
51 Ga0068863_100013377 3300005841 Bacteria 7911
52 Ga0068863_100218272 3300005841 Bacteria 1837
53 Ga0068863_100348973 3300005841 Bacteria 1441
54 Ga0068860_100107214 3300005843 Bacteria 2669
55 Ga0068862_100038883 3300005844 Bacteria 4038
56 Ga0097621_100023782 3300006237 Bacteria 4775
57 Ga0097621_100126074 3300006237 Bacteria 2175
58 Ga0068871_100016954 3300006358 Bacteria 5500
59 Ga0068871_100054896 3300006358 Bacteria 3233
60 Ga0075428_100143224 3300006844 Bacteria 2598
61 Ga0068865_100096255 3300006881 Bacteria 2158
62 Ga0079104_1007153 3300006946 Bacteria 4092
63 Ga0099826_10000008 3300006948 Bacteria 380974
64 Ga0105244_10000395 3300009036 Bacteria 40415
65 Ga0105244_10002014 3300009036 Bacteria 15661
66 Ga0105244_10051662 3300009036 Bacteria 2094
67 Ga0105244_10093950 3300009036 Bacteria 1473
68 Ga0105242_10092527 3300009176 Bacteria 2547
69 Ga0105242_10187820 3300009176 Bacteria 1827
70 Ga0105242_10237946 3300009176 Bacteria 1635
71 Ga0105248_10036202 3300009177 Bacteria 5519
72 Ga0105248_10071080 3300009177 Bacteria 3909
73 Ga0157378_10202122 3300013297 Bacteria 1880
74 Ga0157375_10000063 3300013308 Bacteria 113258
75 Ga0157375_10375149 3300013308 Bacteria 1589
76 Ga0163163_10000086 3300014325 Bacteria 102881
77 Ga0163163_10041872 3300014325 Bacteria 4482
78 Ga0163163_10074233 3300014325 Bacteria 3393
79 Ga0157376_10163738 3300014969 Bacteria 2019
80 Ga0182006_1000023 3300015261 Bacteria 275031
81 Ga0182005_1000154 3300015265 Bacteria 48125
82 Ga0213872_10000024 3300021361 Bacteria 155437
83 Ga0213872_10000340 3300021361 Bacteria 39602
84 Ga0213872_10046295 3300021361 Bacteria 1979
85 Ga0209563_100011 3300025230 Bacteria 1187808
86 Ga0209437_104169 3300025233 Bacteria 2563
87 Ga0207425_1000208 3300025245 Bacteria 46700
88 Ga0209646_1000125 3300025246 Bacteria 135847
89 Ga0209677_100866 3300025253 Bacteria 14884
90 Ga0209148_1000379 3300025254 Bacteria 54104
91 Ga0209565_1000082 3300025263 Bacteria 154452
92 Ga0209455_1000031 3300025272 Bacteria 519952
93 Ga0209673_1000381 3300025273 Bacteria 80068
94 Ga0209130_1000016 3300025284 Bacteria 395540
95 Ga0209675_1000166 3300025291 Bacteria 80138
96 Ga0209564_1000010 3300025295 Bacteria 885399
97 Ga0209564_1000042 3300025295 Bacteria 392805
98 Ga0209564_1001111 3300025295 Bacteria 31685
99 Ga0209758_1001194 3300025297 Bacteria 32812
100 Ga0209256_1000018 3300025299 Bacteria 568467
101 Ga0209256_1000380 3300025299 Bacteria 70995
102 Ga0207655_1005987 3300025728 Bacteria 8137
103 Ga0207655_1008368 3300025728 Bacteria 6576
104 Ga0207642_10029397 3300025899 Bacteria 2275
105 Ga0207645_10056139 3300025907 Bacteria 2514
106 Ga0207705_10006415 3300025909 Bacteria 8715
107 Ga0207654_10000725 3300025911 Bacteria 18374
108 Ga0207681_10007482 3300025923 Bacteria 6692
109 Ga0207650_10001128 3300025925 Bacteria 19636
110 Ga0207650_10001856 3300025925 Bacteria 14900
111 Ga0207650_10021866 3300025925 Bacteria 4525
112 Ga0207650_10038736 3300025925 Bacteria 3483
113 Ga0207659_10004008 3300025926 Bacteria 8886
114 Ga0207659_10013629 3300025926 Bacteria 5214
115 Ga0207659_10036761 3300025926 Bacteria 3395
116 Ga0207659_10120609 3300025926 Bacteria 2009
117 Ga0207644_10008980 3300025931 Bacteria 6549
118 Ga0207690_10130721 3300025932 Bacteria 1837
119 Ga0207690_10155448 3300025932 Bacteria 1699
120 Ga0207709_10011996 3300025935 Bacteria 4777
121 Ga0207691_10000768 3300025940 Bacteria 31732
122 Ga0207691_10015748 3300025940 Bacteria 7187
123 Ga0207711_10048418 3300025941 Bacteria 3637
124 Ga0207689_10037375 3300025942 Bacteria 4027
125 Ga0207651_10005944 3300025960 Bacteria 6321
126 Ga0207651_10158319 3300025960 Bacteria 1772
127 Ga0207668_10018766 3300025972 Bacteria 4360
128 Ga0207668_10276001 3300025972 Bacteria 1376
129 Ga0207658_10033073 3300025986 Bacteria 3686
130 Ga0207703_10333475 3300026035 Bacteria 1392
131 Ga0207678_10131225 3300026067 Bacteria 2137
132 Ga0207648_10023620 3300026089 Bacteria 5504
133 Ga0207648_10027645 3300026089 Bacteria 5034
134 Ga0207648_10139614 3300026089 Bacteria 2135
135 Ga0207676_10001161 3300026095 Bacteria 19810
136 Ga0207675_100020796 3300026118 Bacteria 6118
137 Ga0207683_10093836 3300026121 Bacteria 2674
138 Ga0207683_10095998 3300026121 Bacteria 2643
139 Ga0209281_1003620 3300027111 Bacteria 5005
140 Ga0209282_1000005 3300027666 Bacteria 380858
141 Ga0268266_10086094 3300028379 Bacteria 2747
142 Ga0268265_10059990 3300028380 Bacteria 2913
143 Ga0268265_10068328 3300028380 Bacteria 2755
144 Ga0268264_10062991 3300028381 Bacteria 3116
145 Ga0268264_10151451 3300028381 Bacteria 2080
146 Ga0265330_10002449 3300031235 Bacteria 10108
147 Ga0265332_10000100 3300031238 Bacteria 74633
148 Ga0265332_10000293 3300031238 Bacteria 39227
149 Ga0265325_10045317 3300031241 Bacteria 2285
150 Ga0265329_10002818 3300031242 Bacteria 7765
151 Ga0265331_10000348 3300031250 Bacteria 49051
152 Ga0265327_10002496 3300031251 Bacteria 19267
153 Ga0307408_100000122 3300031548 Bacteria 85798
154 Ga0265314_10007313 3300031711 Bacteria 9591
155 Ga0265314_10024080 3300031711 Bacteria 4624
156 Ga0265342_10012270 3300031712 Bacteria 5810
157 Ga0373927_0101267 3300035695 Unclassified 1874
158 Ga0395899_0029253 3300037312 Bacteria 4144
159 Ga0395899_0066997 3300037312 Bacteria 2635
160 Ga0395899_0170583 3300037312 Bacteria 1532
161 Ga0395900_0000252 3300037418 Bacteria 83358
162 Ga0395900_0000304 3300037418 Bacteria 73219
163 Ga0395900_0021601 3300037418 Bacteria 6579
164 Ga0395900_0033682 3300037418 Bacteria 5272
165 Ga0395900_0033714 3300037418 Bacteria 5269
166 Ga0395900_0052740 3300037418 Bacteria 4186
167 Ga0395900_0261932 3300037418 Bacteria 1726
168 Ga0395900_0270622 3300037418 Bacteria 1693
169 Ga0395900_0341259 3300037418 Bacteria 1473
170 Ga0395898_0052464 3300037466 Bacteria 3984
171 Ga0395898_0059044 3300037466 Bacteria 3733
172 Ga0395898_0119082 3300037466 Bacteria 2529
173 Ga0395905_0053312 3300037471 Bacteria 3785
174 Ga0395905_0106043 3300037471 Bacteria 2639
175 Ga0395905_0106655 3300037471 Bacteria 2630
176 Ga0395901_0001103 3300038443 Bacteria 28723
177 Ga0395901_0154613 3300038443 Bacteria 2409
178 Ga0395901_0605340 3300038443 Bacteria 1104
179 Ga0436361_0061503 3300039447 Bacteria 127805
180 Ga0436361_0224368 3300039447 Bacteria 99317
181 Ga0436361_0243744 3300039447 Bacteria 3479
182 Ga0436361_0340644 3300039447 Bacteria 1558
183 Ga0436361_0811535 3300039447 Bacteria 1756
184 Ga0439449_0026963 3300042007 Bacteria 2144
185 Ga0439455_0002224 3300042012 Bacteria 3479
186 Ga0439455_0021164 3300042012 Bacteria 1548
187 Ga0439458_0014779 3300042157 Bacteria 1764
188 Ga0451577_0016606 3300042876 Bacteria 6812
189 Ga0451577_0142648 3300042876 Bacteria 2153
190 Ga0453683_0003664 3300044673 Bacteria 11259
191 Ga0466965_0022001 3300044683 Bacteria 3073
192 Ga0466965_0037514 3300044683 Bacteria 2379
193 Ga0466966_0008272 3300044684 Bacteria 6898
194 Ga0466963_0092194 3300044694 Bacteria 2064
195 Ga0466964_0000408 3300044706 Bacteria 12996
196 Ga0466964_0000677 3300044706 Bacteria 10953
197 Ga0453684_0000969 3300044712 Bacteria 94503
198 Ga0453684_0035209 3300044712 Bacteria 6926
199 Ga0453684_0064348 3300044712 Bacteria 4685
200 Ga0453684_0303261 3300044712 Bacteria 1815
201 Ga0466968_0001749 3300044735 Bacteria 7831
202 Ga0466970_0112372 3300044765 Bacteria 1488
203 Ga0466957_0009600 3300044842 Bacteria 5526
204 Ga0466957_0012053 3300044842 Bacteria 4997
205 Ga0466957_0077579 3300044842 Bacteria 2064
206 Ga0466959_0001432 3300045049 Bacteria 14596
207 Ga0466959_0029745 3300045049 Bacteria 4047
208 Ga0451576_0000119 3300045051 Bacteria 200621
209 Ga0451576_0000554 3300045051 Bacteria 80199
210 Ga0451576_0002961 3300045051 Bacteria 24050
211 Ga0451576_0010602 3300045051 Bacteria 10555
212 Ga0451576_0014401 3300045051 Bacteria 8806
213 Ga0451576_0015236 3300045051 Bacteria 8525
214 Ga0451576_0032109 3300045051 Bacteria 5595
215 Ga0451576_0038987 3300045051 Bacteria 5029
216 Ga0451576_0152156 3300045051 Bacteria 2413
217 Ga0451576_0234518 3300045051 Bacteria 1916
218 Ga0466958_0010418 3300045836 Bacteria 5206
219 Ga0466958_0023803 3300045836 Bacteria 3599
220 Ga0466967_0029579 3300045976 Bacteria 4586
221 Ga0466967_0104655 3300045976 Bacteria 2591
222 Ga0495617_000020 3300046452 Bacteria 230257
223 Ga0495617_000153 3300046452 Bacteria 44371
224 Ga0495617_007470 3300046452 Bacteria 3792
225 Ga0495617_042010 3300046452 Bacteria 1528
226 Ga0495617_062807 3300046452 Bacteria 1227
227 Ga0495627_000004 3300046453 Bacteria 640612
228 Ga0495627_000170 3300046453 Bacteria 74046
229 Ga0495627_008608 3300046453 Bacteria 3808
230 Ga0495627_056839 3300046453 Bacteria 1165
231 Ga0495603_0019706 3300046455 Bacteria 4084
232 Ga0495603_0048585 3300046455 Bacteria 2526
233 Ga0495590_0000009 3300046457 Bacteria 320425
234 Ga0495590_0000039 3300046457 Bacteria 126693
235 Ga0495590_0012321 3300046457 Bacteria 3175
236 Ga0495591_000409 3300046458 Bacteria 35837
237 Ga0495629_0059906 3300046459 Bacteria 2661
238 Ga0495629_0093708 3300046459 Bacteria 2095
239 Ga0495638_0000407 3300046460 Bacteria 52515
240 Ga0495638_0005864 3300046460 Bacteria 9032
241 Ga0495638_0022676 3300046460 Bacteria 4119
242 Ga0495638_0028608 3300046460 Bacteria 3597
243 Ga0495638_0037141 3300046460 Bacteria 3100
244 Ga0495638_0051405 3300046460 Bacteria 2570
245 Ga0495653_0000035 3300046463 Bacteria 129875
246 Ga0495653_0009175 3300046463 Bacteria 8089
247 Ga0495653_0023654 3300046463 Bacteria 4958
248 Ga0495653_0114583 3300046463 Bacteria 1931
249 Ga0495653_0193349 3300046463 Bacteria 1386
250 Ga0495650_0000128 3300046471 Bacteria 177256
251 Ga0495650_0000157 3300046471 Bacteria 155023
252 Ga0495650_0000261 3300046471 Bacteria 101830
253 Ga0495650_0000970 3300046471 Bacteria 32845
254 Ga0495650_0028673 3300046471 Bacteria 2550
255 Ga0495580_0137983 3300046472 Bacteria 1691
256 Ga0495582_0003125 3300046473 Bacteria 9289
257 Ga0495582_0005833 3300046473 Bacteria 6860
258 Ga0495582_0119184 3300046473 Bacteria 1486
259 Ga0495605_0000018 3300046474 Bacteria 270187
260 Ga0495605_0000055 3300046474 Bacteria 157514
261 Ga0495605_0000208 3300046474 Bacteria 72057
262 Ga0495605_0007130 3300046474 Bacteria 6360
263 Ga0495605_0014919 3300046474 Bacteria 4238
264 Ga0495605_0030381 3300046474 Bacteria 2771
265 Ga0495639_0007784 3300046475 Bacteria 4609
266 Ga0495584_0000073 3300046491 Bacteria 72062
267 Ga0495584_0000498 3300046491 Bacteria 26903
268 Ga0495584_0000507 3300046491 Bacteria 26732
269 Ga0495584_0000754 3300046491 Bacteria 21400
270 Ga0495584_0010266 3300046491 Bacteria 4811
271 Ga0495584_0046332 3300046491 Bacteria 2193
272 Ga0495585_0000033 3300046492 Bacteria 143282
273 Ga0495585_0000042 3300046492 Bacteria 125286
274 Ga0495585_0000828 3300046492 Bacteria 26722
275 Ga0495585_0001955 3300046492 Bacteria 15382
276 Ga0495585_0002326 3300046492 Bacteria 13689
277 Ga0495585_0004126 3300046492 Bacteria 9511
278 Ga0495585_0038148 3300046492 Bacteria 2704
279 Ga0495585_0117115 3300046492 Bacteria 1412
280 Ga0495594_0006032 3300046499 Bacteria 6223
281 Ga0495594_0019182 3300046499 Bacteria 3633
282 Ga0495594_0028860 3300046499 Bacteria 2995
283 Ga0495596_0000599 3300046500 Bacteria 22625
284 Ga0495596_0001145 3300046500 Bacteria 15592
285 Ga0495596_0004087 3300046500 Bacteria 7183
286 Ga0495596_0004646 3300046500 Bacteria 6642
287 Ga0495596_0018988 3300046500 Bacteria 2828
288 Ga0495596_0033489 3300046500 Bacteria 2044
289 Ga0495607_0000908 3300046501 Bacteria 27591
290 Ga0495607_0001106 3300046501 Bacteria 24541
291 Ga0495607_0003657 3300046501 Bacteria 11669
292 Ga0495607_0009922 3300046501 Bacteria 6415
293 Ga0495607_0011191 3300046501 Bacteria 5988
294 Ga0495607_0027705 3300046501 Bacteria 3500
295 Ga0495607_0043191 3300046501 Bacteria 2668
296 Ga0495583_0000132 3300046506 Bacteria 125343
297 Ga0495583_0000981 3300046506 Bacteria 32711
298 Ga0495583_0001153 3300046506 Bacteria 28766
299 Ga0495583_0007681 3300046506 Bacteria 6720
300 Ga0495583_0010627 3300046506 Bacteria 5352
301 Ga0495606_0000180 3300046507 Bacteria 111330
302 Ga0495606_0000228 3300046507 Bacteria 99761
303 Ga0495606_0000512 3300046507 Bacteria 63012
304 Ga0495606_0000828 3300046507 Bacteria 46954
305 Ga0495606_0000850 3300046507 Bacteria 45884
306 Ga0495606_0001374 3300046507 Bacteria 32916
307 Ga0495606_0002886 3300046507 Bacteria 19000
308 Ga0495606_0004799 3300046507 Bacteria 13285
309 Ga0495606_0017477 3300046507 Bacteria 5419
310 Ga0495606_0022531 3300046507 Bacteria 4586
311 Ga0495606_0049794 3300046507 Bacteria 2745
312 Ga0495606_0083150 3300046507 Bacteria 1986
313 Ga0495606_0101469 3300046507 Bacteria 1751
314 Ga0495606_0120187 3300046507 Bacteria 1573
315 Ga0495610_0000014 3300046512 Bacteria 444708
316 Ga0495610_0000738 3300046512 Bacteria 31001
317 Ga0495610_0009819 3300046512 Bacteria 5999
318 Ga0495610_0011744 3300046512 Bacteria 5322
319 Ga0495610_0016104 3300046512 Bacteria 4320
320 Ga0495616_0000261 3300046513 Bacteria 42599
321 Ga0495616_0000679 3300046513 Bacteria 25161
322 Ga0495616_0001443 3300046513 Bacteria 16542
323 Ga0495616_0005802 3300046513 Bacteria 7548
324 Ga0495616_0012408 3300046513 Bacteria 4839
325 Ga0495616_0023825 3300046513 Bacteria 3289
326 Ga0495616_0027254 3300046513 Bacteria 3033
327 Ga0495616_0035105 3300046513 Bacteria 2597
328 Ga0495616_0042924 3300046513 Bacteria 2299
329 Ga0495616_0069717 3300046513 Bacteria 1703
330 Ga0495620_0003521 3300046515 Bacteria 8952
331 Ga0495631_0001599 3300046518 Bacteria 13547
332 Ga0495631_0003271 3300046518 Bacteria 8908
333 Ga0495631_0003612 3300046518 Bacteria 8441
334 Ga0495631_0005077 3300046518 Bacteria 6929
335 Ga0495631_0011763 3300046518 Bacteria 4292
336 Ga0495631_0016916 3300046518 Bacteria 3461
337 Ga0495631_0020434 3300046518 Bacteria 3094
338 Ga0495631_0023449 3300046518 Bacteria 2859
339 Ga0495631_0024919 3300046518 Bacteria 2758
340 Ga0495631_0028657 3300046518 Bacteria 2539
341 Ga0495632_0000252 3300046519 Bacteria 53265
342 Ga0495632_0000327 3300046519 Bacteria 45721
343 Ga0495632_0000441 3300046519 Bacteria 39547
344 Ga0495632_0000551 3300046519 Bacteria 35088
345 Ga0495632_0003471 3300046519 Bacteria 11151
346 Ga0495637_0000003 3300046520 Bacteria 623293
347 Ga0495637_0000678 3300046520 Bacteria 23655
348 Ga0495637_0001262 3300046520 Bacteria 15277
349 Ga0495637_0007532 3300046520 Bacteria 5387
350 Ga0495643_0000082 3300046522 Bacteria 159651
351 Ga0495643_0000160 3300046522 Bacteria 107502
352 Ga0495643_0001457 3300046522 Bacteria 21735
353 Ga0495643_0002059 3300046522 Bacteria 16668
354 Ga0495643_0006996 3300046522 Bacteria 7330
355 Ga0495643_0009136 3300046522 Bacteria 6197
356 Ga0495643_0037120 3300046522 Bacteria 2674
357 Ga0495644_0004547 3300046523 Bacteria 5453
358 Ga0495644_0004840 3300046523 Bacteria 5291
359 Ga0495644_0022203 3300046523 Bacteria 2419
360 Ga0495648_0000019 3300046524 Bacteria 276407
361 Ga0495648_0000052 3300046524 Bacteria 162169
362 Ga0495648_0000432 3300046524 Bacteria 45814
363 Ga0495648_0005052 3300046524 Bacteria 11080
364 Ga0495648_0007994 3300046524 Bacteria 8387
365 Ga0495648_0010938 3300046524 Bacteria 6881
366 Ga0495648_0022403 3300046524 Bacteria 4349
367 Ga0495648_0029745 3300046524 Bacteria 3620
368 Ga0495648_0052141 3300046524 Bacteria 2487
369 Ga0495648_0059795 3300046524 Bacteria 2271
370 Ga0495648_0068530 3300046524 Bacteria 2069
371 Ga0495648_0095589 3300046524 Bacteria 1653
372 Ga0495663_0007301 3300046525 Bacteria 3051
373 Ga0495666_0001189 3300046526 Bacteria 12540
374 Ga0495642_0000222 3300046528 Bacteria 32616
375 Ga0495642_0000806 3300046528 Bacteria 15208
376 Ga0495642_0002620 3300046528 Bacteria 7246
377 Ga0495642_0003287 3300046528 Bacteria 6393
378 Ga0495642_0005268 3300046528 Bacteria 4971
379 Ga0495642_0008365 3300046528 Bacteria 3960
380 Ga0495642_0009696 3300046528 Bacteria 3685
381 Ga0495642_0012401 3300046528 Bacteria 3286
382 Ga0495642_0019025 3300046528 Bacteria 2689
383 Ga0495642_0039396 3300046528 Bacteria 1917
384 Ga0495654_0000014 3300046530 Bacteria 312126
385 Ga0495654_0008245 3300046530 Bacteria 5766
386 Ga0495654_0009189 3300046530 Bacteria 5421
387 Ga0495654_0019229 3300046530 Bacteria 3574
388 Ga0495654_0021923 3300046530 Bacteria 3321
389 Ga0495654_0026379 3300046530 Bacteria 2986
390 Ga0495640_0114709 3300046533 Bacteria 1756
391 Ga0495586_0000782 3300046535 Bacteria 18318
392 Ga0495586_0048141 3300046535 Bacteria 2303
393 Ga0495586_0135073 3300046535 Bacteria 1382
394 Ga0495587_0079911 3300046536 Bacteria 1896
395 Ga0495609_0000038 3300046538 Bacteria 182264
396 Ga0495609_0000859 3300046538 Bacteria 22380
397 Ga0495609_0003202 3300046538 Bacteria 9503
398 Ga0495609_0003922 3300046538 Bacteria 8341
399 Ga0495609_0005917 3300046538 Bacteria 6322
400 Ga0495609_0012286 3300046538 Bacteria 4061
401 Ga0495609_0027987 3300046538 Bacteria 2574
402 Ga0495609_0028526 3300046538 Bacteria 2547
403 Ga0495609_0033675 3300046538 Bacteria 2325
404 Ga0495609_0033857 3300046538 Bacteria 2317
405 Ga0495597_0000133 3300046542 Bacteria 67356
406 Ga0495597_0000180 3300046542 Bacteria 56208
407 Ga0495597_0000364 3300046542 Bacteria 40081
408 Ga0495597_0001403 3300046542 Bacteria 17393
409 Ga0495597_0004349 3300046542 Bacteria 7811
410 Ga0495597_0006422 3300046542 Bacteria 6083
411 Ga0495597_0010187 3300046542 Bacteria 4605
412 Ga0495597_0019169 3300046542 Bacteria 3203
413 Ga0495597_0023939 3300046542 Bacteria 2822
414 Ga0495597_0033505 3300046542 Bacteria 2325
415 Ga0495597_0075319 3300046542 Bacteria 1449
416 Ga0495645_0025263 3300046543 Bacteria 4311
417 Ga0495622_0000034 3300046557 Bacteria 123671
418 Ga0495622_0000071 3300046557 Bacteria 89071
419 Ga0495622_0059996 3300046557 Bacteria 1761
420 Ga0495633_0000077 3300046558 Bacteria 129051
421 Ga0495633_0000100 3300046558 Bacteria 116284
422 Ga0495633_0002802 3300046558 Bacteria 12056
423 Ga0495633_0005027 3300046558 Bacteria 8242
424 Ga0495633_0016281 3300046558 Bacteria 3839
425 Ga0495633_0019341 3300046558 Bacteria 3445
426 Ga0495633_0021784 3300046558 Bacteria 3199
427 Ga0495633_0038059 3300046558 Bacteria 2299
428 Ga0495633_0069201 3300046558 Bacteria 1647
429 Ga0495633_0077110 3300046558 Bacteria 1552
430 Ga0495656_0006136 3300046615 Bacteria 4197
431 Ga0495656_0016846 3300046615 Bacteria 2779
432 Ga0495668_0000231 3300046616 Bacteria 79433
433 Ga0495668_0000308 3300046616 Bacteria 67599
434 Ga0495668_0000351 3300046616 Bacteria 61353
435 Ga0495668_0000602 3300046616 Bacteria 43544
436 Ga0495668_0003350 3300046616 Bacteria 12079
437 Ga0495668_0005511 3300046616 Bacteria 8541
438 Ga0495668_0006404 3300046616 Bacteria 7715
439 Ga0495668_0006574 3300046616 Bacteria 7587
440 Ga0495668_0015046 3300046616 Bacteria 4526
441 Ga0495668_0027407 3300046616 Bacteria 3228
442 Ga0495668_0049578 3300046616 Bacteria 2328
443 Ga0495668_0138233 3300046616 Bacteria 1333
444 Ga0495668_0205067 3300046616 Bacteria 1079
445 Ga0495634_0005407 3300046642 Bacteria 9837
446 Ga0495611_0001042 3300046648 Bacteria 14662
447 Ga0495611_0003262 3300046648 Bacteria 7173
448 Ga0495611_0004561 3300046648 Bacteria 5967
449 Ga0495611_0010182 3300046648 Bacteria 3978
450 Ga0495611_0017046 3300046648 Bacteria 3105
451 Ga0495625_0001017 3300046660 Bacteria 36954
452 Ga0495625_0001111 3300046660 Bacteria 34888
453 Ga0495625_0022022 3300046660 Bacteria 4893
454 Ga0495625_0027562 3300046660 Bacteria 4275
455 Ga0495625_0035300 3300046660 Bacteria 3686
456 Ga0495625_0085834 3300046660 Bacteria 2184
457 Ga0495625_0111825 3300046660 Bacteria 1866
458 Ga0495625_0125603 3300046660 Bacteria 1742
459 Ga0495635_0003980 3300046663 Bacteria 10272
460 Ga0495659_0000049 3300046664 Bacteria 52682
461 Ga0495659_0001305 3300046664 Bacteria 8554
462 Ga0495661_0000070 3300046665 Bacteria 124795
463 Ga0495661_0001176 3300046665 Bacteria 22750
464 Ga0495661_0001533 3300046665 Bacteria 19179
465 Ga0495661_0002205 3300046665 Bacteria 15188
466 Ga0495661_0004687 3300046665 Bacteria 9823
467 Ga0495661_0007175 3300046665 Bacteria 7776
468 Ga0495661_0009106 3300046665 Bacteria 6826
469 Ga0495661_0010600 3300046665 Bacteria 6285
470 Ga0495661_0066721 3300046665 Bacteria 2116
471 Ga0495661_0072029 3300046665 Bacteria 2017
472 Ga0495661_0088034 3300046665 Bacteria 1773
473 Ga0495661_0110869 3300046665 Bacteria 1529
474 Ga0495588_0000156 3300046674 Bacteria 93559
475 Ga0495588_0024390 3300046674 Bacteria 3004
476 Ga0495588_0038944 3300046674 Bacteria 2420
477 Ga0495588_0064882 3300046674 Bacteria 1894
478 Ga0495588_0103023 3300046674 Bacteria 1500
479 Ga0495623_0026050 3300046679 Bacteria 3766
480 Ga0495623_0032004 3300046679 Bacteria 3381
481 Ga0495623_0038351 3300046679 Bacteria 3064
482 Ga0495669_0000032 3300046684 Bacteria 100472
483 Ga0495669_0000481 3300046684 Bacteria 18511
484 Ga0495669_0000840 3300046684 Bacteria 13067
485 Ga0495669_0008174 3300046684 Bacteria 4391
486 Ga0495613_0010463 3300046689 Bacteria 6889
487 Ga0495670_0000144 3300046691 Bacteria 31081
488 Ga0495670_0000401 3300046691 Bacteria 20739
489 Ga0495670_0012352 3300046691 Bacteria 4198
490 Ga0495670_0041706 3300046691 Bacteria 2290
491 Ga0495671_0000005 3300046692 Bacteria 509397
492 Ga0495671_0003630 3300046692 Bacteria 9404
493 Ga0495671_0004998 3300046692 Bacteria 7814
494 Ga0495671_0006502 3300046692 Bacteria 6747
495 Ga0495671_0009288 3300046692 Bacteria 5497
496 Ga0495671_0016893 3300046692 Bacteria 3889
497 Ga0495671_0032263 3300046692 Bacteria 2674
498 Ga0495671_0036522 3300046692 Bacteria 2488
499 Ga0495671_0042367 3300046692 Bacteria 2288
500 Ga0495649_0002755 3300046694 Bacteria 12234
501 Ga0495649_0007541 3300046694 Bacteria 6622
502 Ga0495649_0034473 3300046694 Bacteria 2785
503 Ga0495649_0063857 3300046694 Bacteria 1978
504 Ga0495589_0000074 3300046794 Bacteria 93716
505 Ga0495589_0000099 3300046794 Bacteria 83606
506 Ga0495589_0002047 3300046794 Bacteria 11411
507 Ga0495589_0030324 3300046794 Bacteria 2723
508 Ga0495589_0031465 3300046794 Bacteria 2671
509 Ga0495589_0072921 3300046794 Bacteria 1676
510 Ga0495660_0000047 3300046810 Bacteria 149291
511 Ga0495660_0000203 3300046810 Bacteria 62255
512 Ga0495660_0000514 3300046810 Bacteria 31796
513 Ga0495660_0008423 3300046810 Bacteria 6036
514 Ga0495660_0012375 3300046810 Bacteria 4951
515 Ga0495660_0015362 3300046810 Bacteria 4424
516 Ga0495660_0017313 3300046810 Bacteria 4149
517 Ga0495660_0030318 3300046810 Bacteria 3047
518 Ga0495581_0015728 3300047315 Bacteria 4393
519 Ga0495581_0040472 3300047315 Bacteria 2697
520 Ga0495604_0008261 3300047317 Bacteria 8233
521 Ga0495604_0030254 3300047317 Bacteria 4302
522 Ga0495604_0041736 3300047317 Bacteria 3597
523 Ga0495604_0077162 3300047317 Bacteria 2504
524 Ga0495636_0001566 3300047318 Bacteria 8704
525 Ga0495636_0005882 3300047318 Bacteria 4812
526 Ga0495672_0000026 3300047320 Bacteria 340319
527 Ga0495672_0000081 3300047320 Bacteria 159863
528 Ga0495672_0000256 3300047320 Bacteria 74232
529 Ga0495672_0000356 3300047320 Bacteria 58626
530 Ga0495672_0004203 3300047320 Bacteria 11926
531 Ga0495672_0043469 3300047320 Bacteria 2701
532 Ga0495676_0000031 3300047321 Bacteria 132364
533 Ga0495676_0028182 3300047321 Bacteria 4802
534 Ga0495676_0048092 3300047321 Bacteria 3442
535 Ga0495676_0242667 3300047321 Bacteria 1233
536 Ga0495680_0004349 3300047322 Bacteria 13568
537 Ga0495683_0000260 3300047323 Bacteria 47332
538 Ga0495683_0000309 3300047323 Bacteria 41291
539 Ga0495683_0003892 3300047323 Bacteria 8588
540 Ga0495683_0008632 3300047323 Bacteria 5442
541 Ga0495683_0017674 3300047323 Bacteria 3694
542 Ga0495683_0033214 3300047323 Bacteria 2627
543 Ga0495683_0038036 3300047323 Bacteria 2437
544 Ga0495683_0038535 3300047323 Bacteria 2420
545 Ga0495683_0052221 3300047323 Bacteria 2041
546 Ga0495687_000071 3300047443 Bacteria 159096
547 Ga0495687_000238 3300047443 Bacteria 76186
548 Ga0495687_000448 3300047443 Bacteria 50806
549 Ga0495687_001351 3300047443 Bacteria 22781
550 Ga0495687_002105 3300047443 Bacteria 16691
551 Ga0495687_008516 3300047443 Bacteria 5865
552 Ga0495687_013290 3300047443 Bacteria 4308
553 Ga0495675_0006032 3300047444 Bacteria 7415
554 Ga0495675_0018492 3300047444 Bacteria 4423
555 Ga0495677_0000016 3300047445 Bacteria 126981
556 Ga0495677_0000325 3300047445 Bacteria 20654
557 Ga0495677_0000856 3300047445 Bacteria 12318
558 Ga0495677_0006131 3300047445 Bacteria 4549
559 Ga0495677_0009183 3300047445 Bacteria 3653
560 Ga0495677_0011737 3300047445 Bacteria 3202
561 Ga0495677_0021452 3300047445 Bacteria 2340
562 Ga0495677_0024290 3300047445 Bacteria 2198
563 Ga0495677_0031625 3300047445 Bacteria 1926
564 Ga0495677_0035213 3300047445 Bacteria 1827
565 Ga0495677_0037882 3300047445 Bacteria 1762
566 Ga0495679_004505 3300047446 Bacteria 6393
567 Ga0495679_007538 3300047446 Bacteria 4522
568 Ga0495685_001651 3300047447 Bacteria 6878
569 Ga0495685_035787 3300047447 Bacteria 1705
570 Ga0495673_0000008 3300047469 Bacteria 752462
571 Ga0495673_0000009 3300047469 Bacteria 731993
572 Ga0495673_0000012 3300047469 Bacteria 656908
573 Ga0495673_0007005 3300047469 Bacteria 6550
574 Ga0495681_0003255 3300047470 Bacteria 11324
575 Ga0495681_0004599 3300047470 Bacteria 9385
576 Ga0495681_0006400 3300047470 Bacteria 7749
577 Ga0495681_0009064 3300047470 Bacteria 6168
578 Ga0495681_0014874 3300047470 Bacteria 4436
579 Ga0495681_0018026 3300047470 Bacteria 3903
580 Ga0495681_0026590 3300047470 Bacteria 3008
581 Ga0495681_0047094 3300047470 Bacteria 2052
582 Ga0495681_0048196 3300047470 Bacteria 2021
583 Ga0495681_0076073 3300047470 Bacteria 1509
584 Ga0495686_0000114 3300047472 Bacteria 167232
585 Ga0495686_0000130 3300047472 Bacteria 152244
586 Ga0495686_0005614 3300047472 Bacteria 9846
587 Ga0495686_0015414 3300047472 Bacteria 5220
588 Ga0495686_0077087 3300047472 Bacteria 2041
589 Ga0495593_0001916 3300047673 Bacteria 12402
590 Ga0495593_0106699 3300047673 Bacteria 1432
591 Ga0495602_0032162 3300048088 Bacteria 4944
592 Ga0495614_0002030 3300048089 Bacteria 8900
593 Ga0495614_0007966 3300048089 Bacteria 4708
594 Ga0495615_0016509 3300048090 Bacteria 1594
595 Ga0495626_0000042 3300048091 Bacteria 169058
596 Ga0495626_0000543 3300048091 Bacteria 37476
597 Ga0495626_0001457 3300048091 Bacteria 18719
598 Ga0495626_0006386 3300048091 Bacteria 6713
599 Ga0495626_0007234 3300048091 Bacteria 6202
600 Ga0495626_0017945 3300048091 Bacteria 3566
601 Ga0495626_0036624 3300048091 Bacteria 2336
602 Ga0496100_0015159 3300048903 Bacteria 4496
603 Ga0496101_0171628 3300048904 Bacteria 1667
604 Ga0496102_0000338 3300048905 Bacteria 57280
605 Ga0496102_0035158 3300048905 Bacteria 4508
606 Ga0496103_0020193 3300048906 Bacteria 4000
607 Ga0496105_0082530 3300048908 Bacteria 2655
608 Ga0496106_0010626 3300048909 Bacteria 6802
609 Ga0496107_0063262 3300048910 Bacteria 2681
610 Ga0496107_0090037 3300048910 Bacteria 2241
611 Ga0496107_0120373 3300048910 Bacteria 1934
612 Ga0496108_0265402 3300048911 Bacteria 1494
613 Ga0496110_0000005 3300048913 Bacteria 117293
614 Ga0496110_0038156 3300048913 Bacteria 4178
615 Ga0496110_0269304 3300048913 Bacteria 1551
616 Ga0496111_0040056 3300048914 Bacteria 3361
617 Ga0496111_0132177 3300048914 Bacteria 1847
618 Ga0496113_0010035 3300048916 Bacteria 6246
619 Ga0496116_0014961 3300048919 Bacteria 6158
620 Ga0496121_0015595 3300048924 Bacteria 7938
621 Ga0496121_0054530 3300048924 Bacteria 3339
622 Ga0496122_0000482 3300048925 Bacteria 82868
623 Ga0496122_0015889 3300048925 Bacteria 7167
624 Ga0496122_0017057 3300048925 Bacteria 6816
625 Ga0496123_0000662 3300048926 Bacteria 56930
626 Ga0496123_0002188 3300048926 Bacteria 24891
627 Ga0496123_0005907 3300048926 Bacteria 12085
628 Ga0496123_0077877 3300048926 Bacteria 2034
629 Ga0496124_0028622 3300048927 Bacteria 4982
630 Ga0496124_0042266 3300048927 Bacteria 3926
631 Ga0496124_0065299 3300048927 Bacteria 3035
632 Ga0496124_0112271 3300048927 Bacteria 2192
633 Ga0496125_0008226 3300048928 Bacteria 10967
634 Ga0496126_0010059 3300048929 Bacteria 9979
635 Ga0495678_000027 3300049459 Bacteria 222075
636 Ga0495678_000074 3300049459 Bacteria 125964
637 Ga0495678_001024 3300049459 Bacteria 23725
638 Ga0495678_004034 3300049459 Bacteria 8738
639 Ga0495678_005941 3300049459 Bacteria 6598
640 Ga0495678_048157 3300049459 Bacteria 1664
641 Ga0495678_063428 3300049459 Bacteria 1380
642 Ga0495682_0000611 3300049460 Bacteria 24094
643 Ga0501230_003092 3300049667 Bacteria 2180
644 Ga0501235_035744 3300049669 Bacteria 1129
645 Ga0501269_000005 3300049766 Bacteria 77832
646 Ga0501279_002472 3300049775 Bacteria 2424
647 Ga0501035_0012712 3300049822 Bacteria 7779
648 Ga0495619_0092193 3300053085 Bacteria 2052
649 Ga0500618_000752 3300053125 Bacteria 18351
650 Ga0500586_000124 3300053145 Bacteria 13969
651 2548849007 2547132512 Bacteria 3416496
652 2643800981 2643221556 Bacteria 7251154
653 2644250496 2643221645 Bacteria 7207331
654 2644358817 2643221664 Bacteria 7272945
655 2644471347 2643221684 Bacteria 7145183
656 2738738727 2738541280 Bacteria 6630198
657 2738826174 2738541297 Bacteria 6549566
658 2738842454 2738541300 Bacteria 6675882
659 2739149971 2738541357 Bacteria 6549408
660 2739191890 2738543003 Bacteria 6549560
661 2739273201 2738543018 Bacteria 6718814
662 2739318367 2738543026 Bacteria 6549408
663 2739336608 2738543029 Bacteria 6549249
664 2739342245 2738543030 Bacteria 6719714
665 2821135021 2821131069 Bacteria 6108407
666 2842715888 2842711865 Bacteria 7155354
667 2857558009 2857553236 Bacteria 6166726
668 2857558726 2857558681 Bacteria 6617694
669 2857569606 2857564685 Bacteria 6290584
670 2904428394 2904424332 Bacteria 7633521
671 2919476386 2919476304 Bacteria 5888696
672 8047674697 8047673197 Bacteria 7395230
673 rootL2_10002767
674 JGI25150J39212_1001795
675 JGI25150J39212_1003691
676 JGI25159J45721_1006024
677 rootH1_10044854
678 rootL2_10028108
679 Ga0055529_1000015
680 Ga0055526_1000007
681 Ga0055526_1000037
682 Ga0055526_1003417
683 Ga0055537_1000236
684 Ga0055524_1000439
685 Ga0055534_1000544
686 Ga0055528_1000136
687 Ga0055543_1001195
688 Ga0065165_1001295
689 Ga0070676_10039038
690 Ga0070676_10068598
691 Ga0070690_100028400
692 Ga0070670_100000689
693 Ga0070670_100013594
694 Ga0070670_100022939
695 Ga0070670_100074011
696 Ga0068869_100029485
697 Ga0070668_100217061
698 Ga0070669_100005113
699 Ga0070675_100003057
700 Ga0070675_100019380
701 Ga0070671_100059881
702 Ga0070671_100065644
703 Ga0070674_100096447
704 Ga0070673_100052655
705 Ga0070673_100191944
706 Ga0070688_100145446
707 Ga0070667_100108852
708 Ga0070667_100131469
709 Ga0070662_100287400
710 Ga0068867_100027693
711 Ga0068867_100052665
712 Ga0068867_100270360
713 Ga0070672_100005705
714 Ga0070672_100012074
715 Ga0070665_100080218
716 Ga0070702_100107829
717 Ga0068864_100000792
718 Ga0068864_100029176
719 Ga0068866_10046624
720 Ga0068861_100010977
721 Ga0068861_100181652
722 Ga0068870_10058125
723 Ga0068863_100013377
724 Ga0068863_100218272
725 Ga0068863_100348973
726 Ga0068860_100107214
727 Ga0068862_100038883
728 Ga0097621_100023782
729 Ga0097621_100126074
730 Ga0068871_100016954
731 Ga0068871_100054896
732 Ga0075428_100143224
733 Ga0068865_100096255
734 Ga0079104_1007153
735 Ga0099826_10000008
736 Ga0105244_10000395
737 Ga0105244_10002014
738 Ga0105244_10051662
739 Ga0105244_10093950
740 Ga0105242_10092527
741 Ga0105242_10187820
742 Ga0105242_10237946
743 Ga0105248_10036202
744 Ga0105248_10071080
745 Ga0157378_10202122
746 Ga0157375_10000063
747 Ga0157375_10375149
748 Ga0163163_10000086
749 Ga0163163_10041872
750 Ga0163163_10074233
751 Ga0157376_10163738
752 Ga0182006_1000023
753 Ga0182005_1000154
754 Ga0213872_10000024
755 Ga0213872_10000340
756 Ga0213872_10046295
757 Ga0209563_100011
758 Ga0209437_104169
759 Ga0207425_1000208
760 Ga0209646_1000125
761 Ga0209677_100866
762 Ga0209148_1000379
763 Ga0209565_1000082
764 Ga0209455_1000031
765 Ga0209673_1000381
766 Ga0209130_1000016
767 Ga0209675_1000166
768 Ga0209564_1000010
769 Ga0209564_1000042
770 Ga0209564_1001111
771 Ga0209758_1001194
772 Ga0209256_1000018
773 Ga0209256_1000380
774 Ga0207655_1005987
775 Ga0207655_1008368
776 Ga0207642_10029397
777 Ga0207645_10056139
778 Ga0207705_10006415
779 Ga0207654_10000725
780 Ga0207681_10007482
781 Ga0207650_10001128
782 Ga0207650_10001856
783 Ga0207650_10021866
784 Ga0207650_10038736
785 Ga0207659_10004008
786 Ga0207659_10013629
787 Ga0207659_10036761
788 Ga0207659_10120609
789 Ga0207644_10008980
790 Ga0207690_10130721
791 Ga0207690_10155448
792 Ga0207709_10011996
793 Ga0207691_10000768
794 Ga0207691_10015748
795 Ga0207711_10048418
796 Ga0207689_10037375
797 Ga0207651_10005944
798 Ga0207651_10158319
799 Ga0207668_10018766
800 Ga0207668_10276001
801 Ga0207658_10033073
802 Ga0207703_10333475
803 Ga0207678_10131225
804 Ga0207648_10023620
805 Ga0207648_10027645
806 Ga0207648_10139614
807 Ga0207676_10001161
808 Ga0207675_100020796
809 Ga0207683_10093836
810 Ga0207683_10095998
811 Ga0209281_1003620
812 Ga0209282_1000005
813 Ga0268266_10086094
814 Ga0268265_10059990
815 Ga0268265_10068328
816 Ga0268264_10062991
817 Ga0268264_10151451
818 Ga0265330_10002449
819 Ga0265332_10000100
820 Ga0265332_10000293
821 Ga0265325_10045317
822 Ga0265329_10002818
823 Ga0265331_10000348
824 Ga0265327_10002496
825 Ga0307408_100000122
826 Ga0265314_10007313
827 Ga0265314_10024080
828 Ga0265342_10012270
829 Ga0373927_0101267
830 Ga0395899_0029253
831 Ga0395899_0066997
832 Ga0395899_0170583
833 Ga0395900_0000252
834 Ga0395900_0000304
835 Ga0395900_0021601
836 Ga0395900_0033682
837 Ga0395900_0033714
838 Ga0395900_0052740
839 Ga0395900_0261932
840 Ga0395900_0270622
841 Ga0395900_0341259
842 Ga0395898_0052464
843 Ga0395898_0059044
844 Ga0395898_0119082
845 Ga0395905_0053312
846 Ga0395905_0106043
847 Ga0395905_0106655
848 Ga0395901_0001103
849 Ga0395901_0154613
850 Ga0395901_0605340
851 Ga0436361_0061503
852 Ga0436361_0224368
853 Ga0436361_0243744
854 Ga0436361_0340644
855 Ga0436361_0811535
856 Ga0439449_0026963
857 Ga0439455_0002224
858 Ga0439455_0021164
859 Ga0439458_0014779
860 Ga0451577_0016606
861 Ga0451577_0142648
862 Ga0453683_0003664
863 Ga0466965_0022001
864 Ga0466965_0037514
865 Ga0466966_0008272
866 Ga0466963_0092194
867 Ga0466964_0000408
868 Ga0466964_0000677
869 Ga0453684_0000969
870 Ga0453684_0035209
871 Ga0453684_0064348
872 Ga0453684_0303261
873 Ga0466968_0001749
874 Ga0466970_0112372
875 Ga0466957_0009600
876 Ga0466957_0012053
877 Ga0466957_0077579
878 Ga0466959_0001432
879 Ga0466959_0029745
880 Ga0451576_0000119
881 Ga0451576_0000554
882 Ga0451576_0002961
883 Ga0451576_0010602
884 Ga0451576_0014401
885 Ga0451576_0015236
886 Ga0451576_0032109
887 Ga0451576_0038987
888 Ga0451576_0152156
889 Ga0451576_0234518
890 Ga0466958_0010418
891 Ga0466958_0023803
892 Ga0466967_0029579
893 Ga0466967_0104655
894 Ga0495617_000020
895 Ga0495617_000153
896 Ga0495617_007470
897 Ga0495617_042010
898 Ga0495617_062807
899 Ga0495627_000004
900 Ga0495627_000170
901 Ga0495627_008608
902 Ga0495627_056839
903 Ga0495603_0019706
904 Ga0495603_0048585
905 Ga0495590_0000009
906 Ga0495590_0000039
907 Ga0495590_0012321
908 Ga0495591_000409
909 Ga0495629_0059906
910 Ga0495629_0093708
911 Ga0495638_0000407
912 Ga0495638_0005864
913 Ga0495638_0022676
914 Ga0495638_0028608
915 Ga0495638_0037141
916 Ga0495638_0051405
917 Ga0495653_0000035
918 Ga0495653_0009175
919 Ga0495653_0023654
920 Ga0495653_0114583
921 Ga0495653_0193349
922 Ga0495650_0000128
923 Ga0495650_0000157
924 Ga0495650_0000261
925 Ga0495650_0000970
926 Ga0495650_0028673
927 Ga0495580_0137983
928 Ga0495582_0003125
929 Ga0495582_0005833
930 Ga0495582_0119184
931 Ga0495605_0000018
932 Ga0495605_0000055
933 Ga0495605_0000208
934 Ga0495605_0007130
935 Ga0495605_0014919
936 Ga0495605_0030381
937 Ga0495639_0007784
938 Ga0495584_0000073
939 Ga0495584_0000498
940 Ga0495584_0000507
941 Ga0495584_0000754
942 Ga0495584_0010266
943 Ga0495584_0046332
944 Ga0495585_0000033
945 Ga0495585_0000042
946 Ga0495585_0000828
947 Ga0495585_0001955
948 Ga0495585_0002326
949 Ga0495585_0004126
950 Ga0495585_0038148
951 Ga0495585_0117115
952 Ga0495594_0006032
953 Ga0495594_0019182
954 Ga0495594_0028860
955 Ga0495596_0000599
956 Ga0495596_0001145
957 Ga0495596_0004087
958 Ga0495596_0004646
959 Ga0495596_0018988
960 Ga0495596_0033489
961 Ga0495607_0000908
962 Ga0495607_0001106
963 Ga0495607_0003657
964 Ga0495607_0009922
965 Ga0495607_0011191
966 Ga0495607_0027705
967 Ga0495607_0043191
968 Ga0495583_0000132
969 Ga0495583_0000981
970 Ga0495583_0001153
971 Ga0495583_0007681
972 Ga0495583_0010627
973 Ga0495606_0000180
974 Ga0495606_0000228
975 Ga0495606_0000512
976 Ga0495606_0000828
977 Ga0495606_0000850
978 Ga0495606_0001374
979 Ga0495606_0002886
980 Ga0495606_0004799
981 Ga0495606_0017477
982 Ga0495606_0022531
983 Ga0495606_0049794
984 Ga0495606_0083150
985 Ga0495606_0101469
986 Ga0495606_0120187
987 Ga0495610_0000014
988 Ga0495610_0000738
989 Ga0495610_0009819
990 Ga0495610_0011744
991 Ga0495610_0016104
992 Ga0495616_0000261
993 Ga0495616_0000679
994 Ga0495616_0001443
995 Ga0495616_0005802
996 Ga0495616_0012408
997 Ga0495616_0023825
998 Ga0495616_0027254
999 Ga0495616_0035105
1000 Ga0495616_0042924
1001 Ga0495616_0069717
1002 Ga0495620_0003521
1003 Ga0495631_0001599
1004 Ga0495631_0003271
1005 Ga0495631_0003612
1006 Ga0495631_0005077
1007 Ga0495631_0011763
1008 Ga0495631_0016916
1009 Ga0495631_0020434
1010 Ga0495631_0023449
1011 Ga0495631_0024919
1012 Ga0495631_0028657
1013 Ga0495632_0000252
1014 Ga0495632_0000327
1015 Ga0495632_0000441
1016 Ga0495632_0000551
1017 Ga0495632_0003471
1018 Ga0495637_0000003
1019 Ga0495637_0000678
1020 Ga0495637_0001262
1021 Ga0495637_0007532
1022 Ga0495643_0000082
1023 Ga0495643_0000160
1024 Ga0495643_0001457
1025 Ga0495643_0002059
1026 Ga0495643_0006996
1027 Ga0495643_0009136
1028 Ga0495643_0037120
1029 Ga0495644_0004547
1030 Ga0495644_0004840
1031 Ga0495644_0022203
1032 Ga0495648_0000019
1033 Ga0495648_0000052
1034 Ga0495648_0000432
1035 Ga0495648_0005052
1036 Ga0495648_0007994
1037 Ga0495648_0010938
1038 Ga0495648_0022403
1039 Ga0495648_0029745
1040 Ga0495648_0052141
1041 Ga0495648_0059795
1042 Ga0495648_0068530
1043 Ga0495648_0095589
1044 Ga0495663_0007301
1045 Ga0495666_0001189
1046 Ga0495642_0000222
1047 Ga0495642_0000806
1048 Ga0495642_0002620
1049 Ga0495642_0003287
1050 Ga0495642_0005268
1051 Ga0495642_0008365
1052 Ga0495642_0009696
1053 Ga0495642_0012401
1054 Ga0495642_0019025
1055 Ga0495642_0039396
1056 Ga0495654_0000014
1057 Ga0495654_0008245
1058 Ga0495654_0009189
1059 Ga0495654_0019229
1060 Ga0495654_0021923
1061 Ga0495654_0026379
1062 Ga0495640_0114709
1063 Ga0495586_0000782
1064 Ga0495586_0048141
1065 Ga0495586_0135073
1066 Ga0495587_0079911
1067 Ga0495609_0000038
1068 Ga0495609_0000859
1069 Ga0495609_0003202
1070 Ga0495609_0003922
1071 Ga0495609_0005917
1072 Ga0495609_0012286
1073 Ga0495609_0027987
1074 Ga0495609_0028526
1075 Ga0495609_0033675
1076 Ga0495609_0033857
1077 Ga0495597_0000133
1078 Ga0495597_0000180
1079 Ga0495597_0000364
1080 Ga0495597_0001403
1081 Ga0495597_0004349
1082 Ga0495597_0006422
1083 Ga0495597_0010187
1084 Ga0495597_0019169
1085 Ga0495597_0023939
1086 Ga0495597_0033505
1087 Ga0495597_0075319
1088 Ga0495645_0025263
1089 Ga0495622_0000034
1090 Ga0495622_0000071
1091 Ga0495622_0059996
1092 Ga0495633_0000077
1093 Ga0495633_0000100
1094 Ga0495633_0002802
1095 Ga0495633_0005027
1096 Ga0495633_0016281
1097 Ga0495633_0019341
1098 Ga0495633_0021784
1099 Ga0495633_0038059
1100 Ga0495633_0069201
1101 Ga0495633_0077110
1102 Ga0495656_0006136
1103 Ga0495656_0016846
1104 Ga0495668_0000231
1105 Ga0495668_0000308
1106 Ga0495668_0000351
1107 Ga0495668_0000602
1108 Ga0495668_0003350
1109 Ga0495668_0005511
1110 Ga0495668_0006404
1111 Ga0495668_0006574
1112 Ga0495668_0015046
1113 Ga0495668_0027407
1114 Ga0495668_0049578
1115 Ga0495668_0138233
1116 Ga0495668_0205067
1117 Ga0495634_0005407
1118 Ga0495611_0001042
1119 Ga0495611_0003262
1120 Ga0495611_0004561
1121 Ga0495611_0010182
1122 Ga0495611_0017046
1123 Ga0495625_0001017
1124 Ga0495625_0001111
1125 Ga0495625_0022022
1126 Ga0495625_0027562
1127 Ga0495625_0035300
1128 Ga0495625_0085834
1129 Ga0495625_0111825
1130 Ga0495625_0125603
1131 Ga0495635_0003980
1132 Ga0495659_0000049
1133 Ga0495659_0001305
1134 Ga0495661_0000070
1135 Ga0495661_0001176
1136 Ga0495661_0001533
1137 Ga0495661_0002205
1138 Ga0495661_0004687
1139 Ga0495661_0007175
1140 Ga0495661_0009106
1141 Ga0495661_0010600
1142 Ga0495661_0066721
1143 Ga0495661_0072029
1144 Ga0495661_0088034
1145 Ga0495661_0110869
1146 Ga0495588_0000156
1147 Ga0495588_0024390
1148 Ga0495588_0038944
1149 Ga0495588_0064882
1150 Ga0495588_0103023
1151 Ga0495623_0026050
1152 Ga0495623_0032004
1153 Ga0495623_0038351
1154 Ga0495669_0000032
1155 Ga0495669_0000481
1156 Ga0495669_0000840
1157 Ga0495669_0008174
1158 Ga0495613_0010463
1159 Ga0495670_0000144
1160 Ga0495670_0000401
1161 Ga0495670_0012352
1162 Ga0495670_0041706
1163 Ga0495671_0000005
1164 Ga0495671_0003630
1165 Ga0495671_0004998
1166 Ga0495671_0006502
1167 Ga0495671_0009288
1168 Ga0495671_0016893
1169 Ga0495671_0032263
1170 Ga0495671_0036522
1171 Ga0495671_0042367
1172 Ga0495649_0002755
1173 Ga0495649_0007541
1174 Ga0495649_0034473
1175 Ga0495649_0063857
1176 Ga0495589_0000074
1177 Ga0495589_0000099
1178 Ga0495589_0002047
1179 Ga0495589_0030324
1180 Ga0495589_0031465
1181 Ga0495589_0072921
1182 Ga0495660_0000047
1183 Ga0495660_0000203
1184 Ga0495660_0000514
1185 Ga0495660_0008423
1186 Ga0495660_0012375
1187 Ga0495660_0015362
1188 Ga0495660_0017313
1189 Ga0495660_0030318
1190 Ga0495581_0015728
1191 Ga0495581_0040472
1192 Ga0495604_0008261
1193 Ga0495604_0030254
1194 Ga0495604_0041736
1195 Ga0495604_0077162
1196 Ga0495636_0001566
1197 Ga0495636_0005882
1198 Ga0495672_0000026
1199 Ga0495672_0000081
1200 Ga0495672_0000256
1201 Ga0495672_0000356
1202 Ga0495672_0004203
1203 Ga0495672_0043469
1204 Ga0495676_0000031
1205 Ga0495676_0028182
1206 Ga0495676_0048092
1207 Ga0495676_0242667
1208 Ga0495680_0004349
1209 Ga0495683_0000260
1210 Ga0495683_0000309
1211 Ga0495683_0003892
1212 Ga0495683_0008632
1213 Ga0495683_0017674
1214 Ga0495683_0033214
1215 Ga0495683_0038036
1216 Ga0495683_0038535
1217 Ga0495683_0052221
1218 Ga0495687_000071
1219 Ga0495687_000238
1220 Ga0495687_000448
1221 Ga0495687_001351
1222 Ga0495687_002105
1223 Ga0495687_008516
1224 Ga0495687_013290
1225 Ga0495675_0006032
1226 Ga0495675_0018492
1227 Ga0495677_0000016
1228 Ga0495677_0000325
1229 Ga0495677_0000856
1230 Ga0495677_0006131
1231 Ga0495677_0009183
1232 Ga0495677_0011737
1233 Ga0495677_0021452
1234 Ga0495677_0024290
1235 Ga0495677_0031625
1236 Ga0495677_0035213
1237 Ga0495677_0037882
1238 Ga0495679_004505
1239 Ga0495679_007538
1240 Ga0495685_001651
1241 Ga0495685_035787
1242 Ga0495673_0000008
1243 Ga0495673_0000009
1244 Ga0495673_0000012
1245 Ga0495673_0007005
1246 Ga0495681_0003255
1247 Ga0495681_0004599
1248 Ga0495681_0006400
1249 Ga0495681_0009064
1250 Ga0495681_0014874
1251 Ga0495681_0018026
1252 Ga0495681_0026590
1253 Ga0495681_0047094
1254 Ga0495681_0048196
1255 Ga0495681_0076073
1256 Ga0495686_0000114
1257 Ga0495686_0000130
1258 Ga0495686_0005614
1259 Ga0495686_0015414
1260 Ga0495686_0077087
1261 Ga0495593_0001916
1262 Ga0495593_0106699
1263 Ga0495602_0032162
1264 Ga0495614_0002030
1265 Ga0495614_0007966
1266 Ga0495615_0016509
1267 Ga0495626_0000042
1268 Ga0495626_0000543
1269 Ga0495626_0001457
1270 Ga0495626_0006386
1271 Ga0495626_0007234
1272 Ga0495626_0017945
1273 Ga0495626_0036624
1274 Ga0496100_0015159
1275 Ga0496101_0171628
1276 Ga0496102_0000338
1277 Ga0496102_0035158
1278 Ga0496103_0020193
1279 Ga0496105_0082530
1280 Ga0496106_0010626
1281 Ga0496107_0063262
1282 Ga0496107_0090037
1283 Ga0496107_0120373
1284 Ga0496108_0265402
1285 Ga0496110_0000005
1286 Ga0496110_0038156
1287 Ga0496110_0269304
1288 Ga0496111_0040056
1289 Ga0496111_0132177
1290 Ga0496113_0010035
1291 Ga0496116_0014961
1292 Ga0496121_0015595
1293 Ga0496121_0054530
1294 Ga0496122_0000482
1295 Ga0496122_0015889
1296 Ga0496122_0017057
1297 Ga0496123_0000662
1298 Ga0496123_0002188
1299 Ga0496123_0005907
1300 Ga0496123_0077877
1301 Ga0496124_0028622
1302 Ga0496124_0042266
1303 Ga0496124_0065299
1304 Ga0496124_0112271
1305 Ga0496125_0008226
1306 Ga0496126_0010059
1307 Ga0495678_000027
1308 Ga0495678_000074
1309 Ga0495678_001024
1310 Ga0495678_004034
1311 Ga0495678_005941
1312 Ga0495678_048157
1313 Ga0495678_063428
1314 Ga0495682_0000611
1315 Ga0501230_003092
1316 Ga0501235_035744
1317 Ga0501269_000005
1318 Ga0501279_002472
1319 Ga0501035_0012712
1320 Ga0495619_0092193
1321 Ga0500618_000752
1322 Ga0500586_000124
1323 2548849007
1324 2643800981
1325 2644250496
1326 2644358817
1327 2644471347
1328 2738738727
1329 2738826174
1330 2738842454
1331 2739149971
1332 2739191890
1333 2739273201
1334 2739318367
1335 2739336608
1336 2739342245
1337 2821135021
1338 2842715888
1339 2857558009
1340 2857558726
1341 2857569606
1342 2904428394
1343 2919476386
1344 8047674697

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01594

AI-2E_transport

AI-2E family transporter

16

345

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nb6-assembly1.cif.gz_A structure of the autoinducer-2 exporter tqsa from e. coli 0.6925 13 356
7nb6-assembly1.cif.gz_A structure of the autoinducer-2 exporter tqsa from e. coli 0.6576 13 356
7dfe-assembly1.cif.gz_B nmr structure of tusp2-rp 0.3144 188 308
7dfe-assembly1.cif.gz_B nmr structure of tusp2-rp 0.2799 188 308
7z14-assembly1.cif.gz_A cryo-em structure of torpedo nicotinic acetylcholine receptor in complex with a short-chain neurotoxin. 0.2665 211 349
ID Description Score Start End Superfamily
af_Q2G0C3_21_158_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5846 212 318 1.10.1760.20
af_Q2G0C3_21_158_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4578 212 318 1.10.1760.20
af_A0A0B4LG94_465_794_1.20.1110.10 Mainly Alpha;Up-down Bundle;Calcium-transporting ATPase, transmembrane domain;Calcium-transporting ATPase, transmembrane domain 0.3175 238 356 1.20.1110.10
af_Q10E40_4_147_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.2945 207 304 1.20.120.550
af_Q4CLS6_2_157_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2726 217 355 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A238Y2M7-F1-model_v4 Predicted PurR-regulated permease PerM 0.8291 11 375 GO:0016020
AF-A0A1A9T1I6-F1-model_v4 AI-2E family transporter 0.8261 11 373 GO:0016020
AF-A0A1A8Y126-F1-model_v4 Putative permease 0.8148 5 375 GO:0005886
AF-A0A2N9NWC5-F1-model_v4 AI-2E family transporter 0.8115 13 371 GO:0016020
AF-A0A4Q2J6Y1-F1-model_v4 AI-2E family transporter 0.8093 1 373 GO:0016020

Map