F474203
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 672 | 255 | 1344 | 374 |
Family's Representative Sequence
| Representative Sequence | 3300003322|rootL2_10002767|rootL2_100027672 |
| Length | 405 |
| Sequence | MNLLPAQQRGGPVAWSGIIAATCVVLFLLQQMLFLAIPFLLGIVLYYILQPPMQRLIRMGVSQNAATLIVGAVFLLLATLAGLAAVLWNSTPSASWQEMLATYTKGGLAFVRHTMRALERQFPLLAQLRLAEMVNDRVSAYTGDFVRAHLTDILVSVAGWLPSLLLAPFLAFFFLRDGLRFKKFLARAVPNAFFERTLCLLHEVDQTAHRYFQGLIRLTILDTAVLALGLWAIGVSSPLVLGLVAAVLAWVPYVGSIVGCVLVVMVASTDAPAEPSVAYLAIGVFILVRLLDDFVFMPLTLGRSLHIHPLITVLMIFIGGSVAGVAGLMLVLPLLGVVMVIGETLGRLITDPRLRARHRNAKRLRTSRPVTISEVKNPCGRCRRQGSGMETARLRRSSHACRPIR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 2 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 42 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 43 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 51 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 53 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 57 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 62 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 91 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 98 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 99 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 104 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 105 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 106 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 107 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 108 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 111 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 112 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 113 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 114 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 115 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 116 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 117 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 118 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 119 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 120 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 121 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 122 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 123 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 124 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 125 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 126 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 127 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 128 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 213 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 216 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 217 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 218 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 219 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 220 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 221 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 222 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 223 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 224 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 227 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 228 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 229 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 230 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 233 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 234 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 235 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 236 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 237 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 238 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 239 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 240 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 241 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 242 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 243 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 244 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 245 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 246 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 247 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 248 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 249 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 250 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 251 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 252 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 253 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 254 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 255 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.73 |
| Metatranscriptomes | 0 |
| Isolates | 3.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.61 |
| Nodule | 0.6 |
| Rhizoplane | 2.53 |
| Rhizosphere | 86.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10002767 | 3300003322 | Bacteria | 2271 |
| 2 | JGI25150J39212_1001795 | 3300002774 | Bacteria | 5713 |
| 3 | JGI25150J39212_1003691 | 3300002774 | Bacteria | 3542 |
| 4 | JGI25159J45721_1006024 | 3300002987 | Bacteria | 3699 |
| 5 | rootH1_10044854 | 3300003316 | Bacteria | 1602 |
| 6 | rootL2_10028108 | 3300003322 | Bacteria | 7638 |
| 7 | Ga0055529_1000015 | 3300003763 | Bacteria | 366950 |
| 8 | Ga0055526_1000007 | 3300003771 | Bacteria | 321998 |
| 9 | Ga0055526_1000037 | 3300003771 | Bacteria | 134834 |
| 10 | Ga0055526_1003417 | 3300003771 | Bacteria | 10082 |
| 11 | Ga0055537_1000236 | 3300003773 | Bacteria | 40412 |
| 12 | Ga0055524_1000439 | 3300003775 | Bacteria | 34734 |
| 13 | Ga0055534_1000544 | 3300003784 | Bacteria | 20117 |
| 14 | Ga0055528_1000136 | 3300003790 | Bacteria | 58873 |
| 15 | Ga0055543_1001195 | 3300004625 | Bacteria | 10935 |
| 16 | Ga0065165_1001295 | 3300005262 | Bacteria | 28121 |
| 17 | Ga0070676_10039038 | 3300005328 | Bacteria | 2744 |
| 18 | Ga0070676_10068598 | 3300005328 | Bacteria | 2123 |
| 19 | Ga0070690_100028400 | 3300005330 | Bacteria | 3465 |
| 20 | Ga0070670_100000689 | 3300005331 | Bacteria | 26249 |
| 21 | Ga0070670_100013594 | 3300005331 | Bacteria | 6976 |
| 22 | Ga0070670_100022939 | 3300005331 | Bacteria | 5370 |
| 23 | Ga0070670_100074011 | 3300005331 | Bacteria | 2926 |
| 24 | Ga0068869_100029485 | 3300005334 | Bacteria | 3845 |
| 25 | Ga0070668_100217061 | 3300005347 | Bacteria | 1576 |
| 26 | Ga0070669_100005113 | 3300005353 | Bacteria | 9486 |
| 27 | Ga0070675_100003057 | 3300005354 | Bacteria | 12634 |
| 28 | Ga0070675_100019380 | 3300005354 | Bacteria | 5420 |
| 29 | Ga0070671_100059881 | 3300005355 | Bacteria | 3169 |
| 30 | Ga0070671_100065644 | 3300005355 | Bacteria | 3024 |
| 31 | Ga0070674_100096447 | 3300005356 | Bacteria | 2146 |
| 32 | Ga0070673_100052655 | 3300005364 | Bacteria | 3195 |
| 33 | Ga0070673_100191944 | 3300005364 | Bacteria | 1755 |
| 34 | Ga0070688_100145446 | 3300005365 | Bacteria | 1615 |
| 35 | Ga0070667_100108852 | 3300005367 | Bacteria | 2401 |
| 36 | Ga0070667_100131469 | 3300005367 | Bacteria | 2185 |
| 37 | Ga0070662_100287400 | 3300005457 | Bacteria | 1332 |
| 38 | Ga0068867_100027693 | 3300005459 | Bacteria | 4076 |
| 39 | Ga0068867_100052665 | 3300005459 | Bacteria | 3004 |
| 40 | Ga0068867_100270360 | 3300005459 | Bacteria | 1389 |
| 41 | Ga0070672_100005705 | 3300005543 | Bacteria | 8293 |
| 42 | Ga0070672_100012074 | 3300005543 | Bacteria | 6046 |
| 43 | Ga0070665_100080218 | 3300005548 | Bacteria | 3269 |
| 44 | Ga0070702_100107829 | 3300005615 | Bacteria | 1720 |
| 45 | Ga0068864_100000792 | 3300005618 | Bacteria | 26534 |
| 46 | Ga0068864_100029176 | 3300005618 | Bacteria | 4668 |
| 47 | Ga0068866_10046624 | 3300005718 | Bacteria | 2181 |
| 48 | Ga0068861_100010977 | 3300005719 | Bacteria | 6295 |
| 49 | Ga0068861_100181652 | 3300005719 | Bacteria | 1752 |
| 50 | Ga0068870_10058125 | 3300005840 | Bacteria | 2070 |
| 51 | Ga0068863_100013377 | 3300005841 | Bacteria | 7911 |
| 52 | Ga0068863_100218272 | 3300005841 | Bacteria | 1837 |
| 53 | Ga0068863_100348973 | 3300005841 | Bacteria | 1441 |
| 54 | Ga0068860_100107214 | 3300005843 | Bacteria | 2669 |
| 55 | Ga0068862_100038883 | 3300005844 | Bacteria | 4038 |
| 56 | Ga0097621_100023782 | 3300006237 | Bacteria | 4775 |
| 57 | Ga0097621_100126074 | 3300006237 | Bacteria | 2175 |
| 58 | Ga0068871_100016954 | 3300006358 | Bacteria | 5500 |
| 59 | Ga0068871_100054896 | 3300006358 | Bacteria | 3233 |
| 60 | Ga0075428_100143224 | 3300006844 | Bacteria | 2598 |
| 61 | Ga0068865_100096255 | 3300006881 | Bacteria | 2158 |
| 62 | Ga0079104_1007153 | 3300006946 | Bacteria | 4092 |
| 63 | Ga0099826_10000008 | 3300006948 | Bacteria | 380974 |
| 64 | Ga0105244_10000395 | 3300009036 | Bacteria | 40415 |
| 65 | Ga0105244_10002014 | 3300009036 | Bacteria | 15661 |
| 66 | Ga0105244_10051662 | 3300009036 | Bacteria | 2094 |
| 67 | Ga0105244_10093950 | 3300009036 | Bacteria | 1473 |
| 68 | Ga0105242_10092527 | 3300009176 | Bacteria | 2547 |
| 69 | Ga0105242_10187820 | 3300009176 | Bacteria | 1827 |
| 70 | Ga0105242_10237946 | 3300009176 | Bacteria | 1635 |
| 71 | Ga0105248_10036202 | 3300009177 | Bacteria | 5519 |
| 72 | Ga0105248_10071080 | 3300009177 | Bacteria | 3909 |
| 73 | Ga0157378_10202122 | 3300013297 | Bacteria | 1880 |
| 74 | Ga0157375_10000063 | 3300013308 | Bacteria | 113258 |
| 75 | Ga0157375_10375149 | 3300013308 | Bacteria | 1589 |
| 76 | Ga0163163_10000086 | 3300014325 | Bacteria | 102881 |
| 77 | Ga0163163_10041872 | 3300014325 | Bacteria | 4482 |
| 78 | Ga0163163_10074233 | 3300014325 | Bacteria | 3393 |
| 79 | Ga0157376_10163738 | 3300014969 | Bacteria | 2019 |
| 80 | Ga0182006_1000023 | 3300015261 | Bacteria | 275031 |
| 81 | Ga0182005_1000154 | 3300015265 | Bacteria | 48125 |
| 82 | Ga0213872_10000024 | 3300021361 | Bacteria | 155437 |
| 83 | Ga0213872_10000340 | 3300021361 | Bacteria | 39602 |
| 84 | Ga0213872_10046295 | 3300021361 | Bacteria | 1979 |
| 85 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 86 | Ga0209437_104169 | 3300025233 | Bacteria | 2563 |
| 87 | Ga0207425_1000208 | 3300025245 | Bacteria | 46700 |
| 88 | Ga0209646_1000125 | 3300025246 | Bacteria | 135847 |
| 89 | Ga0209677_100866 | 3300025253 | Bacteria | 14884 |
| 90 | Ga0209148_1000379 | 3300025254 | Bacteria | 54104 |
| 91 | Ga0209565_1000082 | 3300025263 | Bacteria | 154452 |
| 92 | Ga0209455_1000031 | 3300025272 | Bacteria | 519952 |
| 93 | Ga0209673_1000381 | 3300025273 | Bacteria | 80068 |
| 94 | Ga0209130_1000016 | 3300025284 | Bacteria | 395540 |
| 95 | Ga0209675_1000166 | 3300025291 | Bacteria | 80138 |
| 96 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 97 | Ga0209564_1000042 | 3300025295 | Bacteria | 392805 |
| 98 | Ga0209564_1001111 | 3300025295 | Bacteria | 31685 |
| 99 | Ga0209758_1001194 | 3300025297 | Bacteria | 32812 |
| 100 | Ga0209256_1000018 | 3300025299 | Bacteria | 568467 |
| 101 | Ga0209256_1000380 | 3300025299 | Bacteria | 70995 |
| 102 | Ga0207655_1005987 | 3300025728 | Bacteria | 8137 |
| 103 | Ga0207655_1008368 | 3300025728 | Bacteria | 6576 |
| 104 | Ga0207642_10029397 | 3300025899 | Bacteria | 2275 |
| 105 | Ga0207645_10056139 | 3300025907 | Bacteria | 2514 |
| 106 | Ga0207705_10006415 | 3300025909 | Bacteria | 8715 |
| 107 | Ga0207654_10000725 | 3300025911 | Bacteria | 18374 |
| 108 | Ga0207681_10007482 | 3300025923 | Bacteria | 6692 |
| 109 | Ga0207650_10001128 | 3300025925 | Bacteria | 19636 |
| 110 | Ga0207650_10001856 | 3300025925 | Bacteria | 14900 |
| 111 | Ga0207650_10021866 | 3300025925 | Bacteria | 4525 |
| 112 | Ga0207650_10038736 | 3300025925 | Bacteria | 3483 |
| 113 | Ga0207659_10004008 | 3300025926 | Bacteria | 8886 |
| 114 | Ga0207659_10013629 | 3300025926 | Bacteria | 5214 |
| 115 | Ga0207659_10036761 | 3300025926 | Bacteria | 3395 |
| 116 | Ga0207659_10120609 | 3300025926 | Bacteria | 2009 |
| 117 | Ga0207644_10008980 | 3300025931 | Bacteria | 6549 |
| 118 | Ga0207690_10130721 | 3300025932 | Bacteria | 1837 |
| 119 | Ga0207690_10155448 | 3300025932 | Bacteria | 1699 |
| 120 | Ga0207709_10011996 | 3300025935 | Bacteria | 4777 |
| 121 | Ga0207691_10000768 | 3300025940 | Bacteria | 31732 |
| 122 | Ga0207691_10015748 | 3300025940 | Bacteria | 7187 |
| 123 | Ga0207711_10048418 | 3300025941 | Bacteria | 3637 |
| 124 | Ga0207689_10037375 | 3300025942 | Bacteria | 4027 |
| 125 | Ga0207651_10005944 | 3300025960 | Bacteria | 6321 |
| 126 | Ga0207651_10158319 | 3300025960 | Bacteria | 1772 |
| 127 | Ga0207668_10018766 | 3300025972 | Bacteria | 4360 |
| 128 | Ga0207668_10276001 | 3300025972 | Bacteria | 1376 |
| 129 | Ga0207658_10033073 | 3300025986 | Bacteria | 3686 |
| 130 | Ga0207703_10333475 | 3300026035 | Bacteria | 1392 |
| 131 | Ga0207678_10131225 | 3300026067 | Bacteria | 2137 |
| 132 | Ga0207648_10023620 | 3300026089 | Bacteria | 5504 |
| 133 | Ga0207648_10027645 | 3300026089 | Bacteria | 5034 |
| 134 | Ga0207648_10139614 | 3300026089 | Bacteria | 2135 |
| 135 | Ga0207676_10001161 | 3300026095 | Bacteria | 19810 |
| 136 | Ga0207675_100020796 | 3300026118 | Bacteria | 6118 |
| 137 | Ga0207683_10093836 | 3300026121 | Bacteria | 2674 |
| 138 | Ga0207683_10095998 | 3300026121 | Bacteria | 2643 |
| 139 | Ga0209281_1003620 | 3300027111 | Bacteria | 5005 |
| 140 | Ga0209282_1000005 | 3300027666 | Bacteria | 380858 |
| 141 | Ga0268266_10086094 | 3300028379 | Bacteria | 2747 |
| 142 | Ga0268265_10059990 | 3300028380 | Bacteria | 2913 |
| 143 | Ga0268265_10068328 | 3300028380 | Bacteria | 2755 |
| 144 | Ga0268264_10062991 | 3300028381 | Bacteria | 3116 |
| 145 | Ga0268264_10151451 | 3300028381 | Bacteria | 2080 |
| 146 | Ga0265330_10002449 | 3300031235 | Bacteria | 10108 |
| 147 | Ga0265332_10000100 | 3300031238 | Bacteria | 74633 |
| 148 | Ga0265332_10000293 | 3300031238 | Bacteria | 39227 |
| 149 | Ga0265325_10045317 | 3300031241 | Bacteria | 2285 |
| 150 | Ga0265329_10002818 | 3300031242 | Bacteria | 7765 |
| 151 | Ga0265331_10000348 | 3300031250 | Bacteria | 49051 |
| 152 | Ga0265327_10002496 | 3300031251 | Bacteria | 19267 |
| 153 | Ga0307408_100000122 | 3300031548 | Bacteria | 85798 |
| 154 | Ga0265314_10007313 | 3300031711 | Bacteria | 9591 |
| 155 | Ga0265314_10024080 | 3300031711 | Bacteria | 4624 |
| 156 | Ga0265342_10012270 | 3300031712 | Bacteria | 5810 |
| 157 | Ga0373927_0101267 | 3300035695 | Unclassified | 1874 |
| 158 | Ga0395899_0029253 | 3300037312 | Bacteria | 4144 |
| 159 | Ga0395899_0066997 | 3300037312 | Bacteria | 2635 |
| 160 | Ga0395899_0170583 | 3300037312 | Bacteria | 1532 |
| 161 | Ga0395900_0000252 | 3300037418 | Bacteria | 83358 |
| 162 | Ga0395900_0000304 | 3300037418 | Bacteria | 73219 |
| 163 | Ga0395900_0021601 | 3300037418 | Bacteria | 6579 |
| 164 | Ga0395900_0033682 | 3300037418 | Bacteria | 5272 |
| 165 | Ga0395900_0033714 | 3300037418 | Bacteria | 5269 |
| 166 | Ga0395900_0052740 | 3300037418 | Bacteria | 4186 |
| 167 | Ga0395900_0261932 | 3300037418 | Bacteria | 1726 |
| 168 | Ga0395900_0270622 | 3300037418 | Bacteria | 1693 |
| 169 | Ga0395900_0341259 | 3300037418 | Bacteria | 1473 |
| 170 | Ga0395898_0052464 | 3300037466 | Bacteria | 3984 |
| 171 | Ga0395898_0059044 | 3300037466 | Bacteria | 3733 |
| 172 | Ga0395898_0119082 | 3300037466 | Bacteria | 2529 |
| 173 | Ga0395905_0053312 | 3300037471 | Bacteria | 3785 |
| 174 | Ga0395905_0106043 | 3300037471 | Bacteria | 2639 |
| 175 | Ga0395905_0106655 | 3300037471 | Bacteria | 2630 |
| 176 | Ga0395901_0001103 | 3300038443 | Bacteria | 28723 |
| 177 | Ga0395901_0154613 | 3300038443 | Bacteria | 2409 |
| 178 | Ga0395901_0605340 | 3300038443 | Bacteria | 1104 |
| 179 | Ga0436361_0061503 | 3300039447 | Bacteria | 127805 |
| 180 | Ga0436361_0224368 | 3300039447 | Bacteria | 99317 |
| 181 | Ga0436361_0243744 | 3300039447 | Bacteria | 3479 |
| 182 | Ga0436361_0340644 | 3300039447 | Bacteria | 1558 |
| 183 | Ga0436361_0811535 | 3300039447 | Bacteria | 1756 |
| 184 | Ga0439449_0026963 | 3300042007 | Bacteria | 2144 |
| 185 | Ga0439455_0002224 | 3300042012 | Bacteria | 3479 |
| 186 | Ga0439455_0021164 | 3300042012 | Bacteria | 1548 |
| 187 | Ga0439458_0014779 | 3300042157 | Bacteria | 1764 |
| 188 | Ga0451577_0016606 | 3300042876 | Bacteria | 6812 |
| 189 | Ga0451577_0142648 | 3300042876 | Bacteria | 2153 |
| 190 | Ga0453683_0003664 | 3300044673 | Bacteria | 11259 |
| 191 | Ga0466965_0022001 | 3300044683 | Bacteria | 3073 |
| 192 | Ga0466965_0037514 | 3300044683 | Bacteria | 2379 |
| 193 | Ga0466966_0008272 | 3300044684 | Bacteria | 6898 |
| 194 | Ga0466963_0092194 | 3300044694 | Bacteria | 2064 |
| 195 | Ga0466964_0000408 | 3300044706 | Bacteria | 12996 |
| 196 | Ga0466964_0000677 | 3300044706 | Bacteria | 10953 |
| 197 | Ga0453684_0000969 | 3300044712 | Bacteria | 94503 |
| 198 | Ga0453684_0035209 | 3300044712 | Bacteria | 6926 |
| 199 | Ga0453684_0064348 | 3300044712 | Bacteria | 4685 |
| 200 | Ga0453684_0303261 | 3300044712 | Bacteria | 1815 |
| 201 | Ga0466968_0001749 | 3300044735 | Bacteria | 7831 |
| 202 | Ga0466970_0112372 | 3300044765 | Bacteria | 1488 |
| 203 | Ga0466957_0009600 | 3300044842 | Bacteria | 5526 |
| 204 | Ga0466957_0012053 | 3300044842 | Bacteria | 4997 |
| 205 | Ga0466957_0077579 | 3300044842 | Bacteria | 2064 |
| 206 | Ga0466959_0001432 | 3300045049 | Bacteria | 14596 |
| 207 | Ga0466959_0029745 | 3300045049 | Bacteria | 4047 |
| 208 | Ga0451576_0000119 | 3300045051 | Bacteria | 200621 |
| 209 | Ga0451576_0000554 | 3300045051 | Bacteria | 80199 |
| 210 | Ga0451576_0002961 | 3300045051 | Bacteria | 24050 |
| 211 | Ga0451576_0010602 | 3300045051 | Bacteria | 10555 |
| 212 | Ga0451576_0014401 | 3300045051 | Bacteria | 8806 |
| 213 | Ga0451576_0015236 | 3300045051 | Bacteria | 8525 |
| 214 | Ga0451576_0032109 | 3300045051 | Bacteria | 5595 |
| 215 | Ga0451576_0038987 | 3300045051 | Bacteria | 5029 |
| 216 | Ga0451576_0152156 | 3300045051 | Bacteria | 2413 |
| 217 | Ga0451576_0234518 | 3300045051 | Bacteria | 1916 |
| 218 | Ga0466958_0010418 | 3300045836 | Bacteria | 5206 |
| 219 | Ga0466958_0023803 | 3300045836 | Bacteria | 3599 |
| 220 | Ga0466967_0029579 | 3300045976 | Bacteria | 4586 |
| 221 | Ga0466967_0104655 | 3300045976 | Bacteria | 2591 |
| 222 | Ga0495617_000020 | 3300046452 | Bacteria | 230257 |
| 223 | Ga0495617_000153 | 3300046452 | Bacteria | 44371 |
| 224 | Ga0495617_007470 | 3300046452 | Bacteria | 3792 |
| 225 | Ga0495617_042010 | 3300046452 | Bacteria | 1528 |
| 226 | Ga0495617_062807 | 3300046452 | Bacteria | 1227 |
| 227 | Ga0495627_000004 | 3300046453 | Bacteria | 640612 |
| 228 | Ga0495627_000170 | 3300046453 | Bacteria | 74046 |
| 229 | Ga0495627_008608 | 3300046453 | Bacteria | 3808 |
| 230 | Ga0495627_056839 | 3300046453 | Bacteria | 1165 |
| 231 | Ga0495603_0019706 | 3300046455 | Bacteria | 4084 |
| 232 | Ga0495603_0048585 | 3300046455 | Bacteria | 2526 |
| 233 | Ga0495590_0000009 | 3300046457 | Bacteria | 320425 |
| 234 | Ga0495590_0000039 | 3300046457 | Bacteria | 126693 |
| 235 | Ga0495590_0012321 | 3300046457 | Bacteria | 3175 |
| 236 | Ga0495591_000409 | 3300046458 | Bacteria | 35837 |
| 237 | Ga0495629_0059906 | 3300046459 | Bacteria | 2661 |
| 238 | Ga0495629_0093708 | 3300046459 | Bacteria | 2095 |
| 239 | Ga0495638_0000407 | 3300046460 | Bacteria | 52515 |
| 240 | Ga0495638_0005864 | 3300046460 | Bacteria | 9032 |
| 241 | Ga0495638_0022676 | 3300046460 | Bacteria | 4119 |
| 242 | Ga0495638_0028608 | 3300046460 | Bacteria | 3597 |
| 243 | Ga0495638_0037141 | 3300046460 | Bacteria | 3100 |
| 244 | Ga0495638_0051405 | 3300046460 | Bacteria | 2570 |
| 245 | Ga0495653_0000035 | 3300046463 | Bacteria | 129875 |
| 246 | Ga0495653_0009175 | 3300046463 | Bacteria | 8089 |
| 247 | Ga0495653_0023654 | 3300046463 | Bacteria | 4958 |
| 248 | Ga0495653_0114583 | 3300046463 | Bacteria | 1931 |
| 249 | Ga0495653_0193349 | 3300046463 | Bacteria | 1386 |
| 250 | Ga0495650_0000128 | 3300046471 | Bacteria | 177256 |
| 251 | Ga0495650_0000157 | 3300046471 | Bacteria | 155023 |
| 252 | Ga0495650_0000261 | 3300046471 | Bacteria | 101830 |
| 253 | Ga0495650_0000970 | 3300046471 | Bacteria | 32845 |
| 254 | Ga0495650_0028673 | 3300046471 | Bacteria | 2550 |
| 255 | Ga0495580_0137983 | 3300046472 | Bacteria | 1691 |
| 256 | Ga0495582_0003125 | 3300046473 | Bacteria | 9289 |
| 257 | Ga0495582_0005833 | 3300046473 | Bacteria | 6860 |
| 258 | Ga0495582_0119184 | 3300046473 | Bacteria | 1486 |
| 259 | Ga0495605_0000018 | 3300046474 | Bacteria | 270187 |
| 260 | Ga0495605_0000055 | 3300046474 | Bacteria | 157514 |
| 261 | Ga0495605_0000208 | 3300046474 | Bacteria | 72057 |
| 262 | Ga0495605_0007130 | 3300046474 | Bacteria | 6360 |
| 263 | Ga0495605_0014919 | 3300046474 | Bacteria | 4238 |
| 264 | Ga0495605_0030381 | 3300046474 | Bacteria | 2771 |
| 265 | Ga0495639_0007784 | 3300046475 | Bacteria | 4609 |
| 266 | Ga0495584_0000073 | 3300046491 | Bacteria | 72062 |
| 267 | Ga0495584_0000498 | 3300046491 | Bacteria | 26903 |
| 268 | Ga0495584_0000507 | 3300046491 | Bacteria | 26732 |
| 269 | Ga0495584_0000754 | 3300046491 | Bacteria | 21400 |
| 270 | Ga0495584_0010266 | 3300046491 | Bacteria | 4811 |
| 271 | Ga0495584_0046332 | 3300046491 | Bacteria | 2193 |
| 272 | Ga0495585_0000033 | 3300046492 | Bacteria | 143282 |
| 273 | Ga0495585_0000042 | 3300046492 | Bacteria | 125286 |
| 274 | Ga0495585_0000828 | 3300046492 | Bacteria | 26722 |
| 275 | Ga0495585_0001955 | 3300046492 | Bacteria | 15382 |
| 276 | Ga0495585_0002326 | 3300046492 | Bacteria | 13689 |
| 277 | Ga0495585_0004126 | 3300046492 | Bacteria | 9511 |
| 278 | Ga0495585_0038148 | 3300046492 | Bacteria | 2704 |
| 279 | Ga0495585_0117115 | 3300046492 | Bacteria | 1412 |
| 280 | Ga0495594_0006032 | 3300046499 | Bacteria | 6223 |
| 281 | Ga0495594_0019182 | 3300046499 | Bacteria | 3633 |
| 282 | Ga0495594_0028860 | 3300046499 | Bacteria | 2995 |
| 283 | Ga0495596_0000599 | 3300046500 | Bacteria | 22625 |
| 284 | Ga0495596_0001145 | 3300046500 | Bacteria | 15592 |
| 285 | Ga0495596_0004087 | 3300046500 | Bacteria | 7183 |
| 286 | Ga0495596_0004646 | 3300046500 | Bacteria | 6642 |
| 287 | Ga0495596_0018988 | 3300046500 | Bacteria | 2828 |
| 288 | Ga0495596_0033489 | 3300046500 | Bacteria | 2044 |
| 289 | Ga0495607_0000908 | 3300046501 | Bacteria | 27591 |
| 290 | Ga0495607_0001106 | 3300046501 | Bacteria | 24541 |
| 291 | Ga0495607_0003657 | 3300046501 | Bacteria | 11669 |
| 292 | Ga0495607_0009922 | 3300046501 | Bacteria | 6415 |
| 293 | Ga0495607_0011191 | 3300046501 | Bacteria | 5988 |
| 294 | Ga0495607_0027705 | 3300046501 | Bacteria | 3500 |
| 295 | Ga0495607_0043191 | 3300046501 | Bacteria | 2668 |
| 296 | Ga0495583_0000132 | 3300046506 | Bacteria | 125343 |
| 297 | Ga0495583_0000981 | 3300046506 | Bacteria | 32711 |
| 298 | Ga0495583_0001153 | 3300046506 | Bacteria | 28766 |
| 299 | Ga0495583_0007681 | 3300046506 | Bacteria | 6720 |
| 300 | Ga0495583_0010627 | 3300046506 | Bacteria | 5352 |
| 301 | Ga0495606_0000180 | 3300046507 | Bacteria | 111330 |
| 302 | Ga0495606_0000228 | 3300046507 | Bacteria | 99761 |
| 303 | Ga0495606_0000512 | 3300046507 | Bacteria | 63012 |
| 304 | Ga0495606_0000828 | 3300046507 | Bacteria | 46954 |
| 305 | Ga0495606_0000850 | 3300046507 | Bacteria | 45884 |
| 306 | Ga0495606_0001374 | 3300046507 | Bacteria | 32916 |
| 307 | Ga0495606_0002886 | 3300046507 | Bacteria | 19000 |
| 308 | Ga0495606_0004799 | 3300046507 | Bacteria | 13285 |
| 309 | Ga0495606_0017477 | 3300046507 | Bacteria | 5419 |
| 310 | Ga0495606_0022531 | 3300046507 | Bacteria | 4586 |
| 311 | Ga0495606_0049794 | 3300046507 | Bacteria | 2745 |
| 312 | Ga0495606_0083150 | 3300046507 | Bacteria | 1986 |
| 313 | Ga0495606_0101469 | 3300046507 | Bacteria | 1751 |
| 314 | Ga0495606_0120187 | 3300046507 | Bacteria | 1573 |
| 315 | Ga0495610_0000014 | 3300046512 | Bacteria | 444708 |
| 316 | Ga0495610_0000738 | 3300046512 | Bacteria | 31001 |
| 317 | Ga0495610_0009819 | 3300046512 | Bacteria | 5999 |
| 318 | Ga0495610_0011744 | 3300046512 | Bacteria | 5322 |
| 319 | Ga0495610_0016104 | 3300046512 | Bacteria | 4320 |
| 320 | Ga0495616_0000261 | 3300046513 | Bacteria | 42599 |
| 321 | Ga0495616_0000679 | 3300046513 | Bacteria | 25161 |
| 322 | Ga0495616_0001443 | 3300046513 | Bacteria | 16542 |
| 323 | Ga0495616_0005802 | 3300046513 | Bacteria | 7548 |
| 324 | Ga0495616_0012408 | 3300046513 | Bacteria | 4839 |
| 325 | Ga0495616_0023825 | 3300046513 | Bacteria | 3289 |
| 326 | Ga0495616_0027254 | 3300046513 | Bacteria | 3033 |
| 327 | Ga0495616_0035105 | 3300046513 | Bacteria | 2597 |
| 328 | Ga0495616_0042924 | 3300046513 | Bacteria | 2299 |
| 329 | Ga0495616_0069717 | 3300046513 | Bacteria | 1703 |
| 330 | Ga0495620_0003521 | 3300046515 | Bacteria | 8952 |
| 331 | Ga0495631_0001599 | 3300046518 | Bacteria | 13547 |
| 332 | Ga0495631_0003271 | 3300046518 | Bacteria | 8908 |
| 333 | Ga0495631_0003612 | 3300046518 | Bacteria | 8441 |
| 334 | Ga0495631_0005077 | 3300046518 | Bacteria | 6929 |
| 335 | Ga0495631_0011763 | 3300046518 | Bacteria | 4292 |
| 336 | Ga0495631_0016916 | 3300046518 | Bacteria | 3461 |
| 337 | Ga0495631_0020434 | 3300046518 | Bacteria | 3094 |
| 338 | Ga0495631_0023449 | 3300046518 | Bacteria | 2859 |
| 339 | Ga0495631_0024919 | 3300046518 | Bacteria | 2758 |
| 340 | Ga0495631_0028657 | 3300046518 | Bacteria | 2539 |
| 341 | Ga0495632_0000252 | 3300046519 | Bacteria | 53265 |
| 342 | Ga0495632_0000327 | 3300046519 | Bacteria | 45721 |
| 343 | Ga0495632_0000441 | 3300046519 | Bacteria | 39547 |
| 344 | Ga0495632_0000551 | 3300046519 | Bacteria | 35088 |
| 345 | Ga0495632_0003471 | 3300046519 | Bacteria | 11151 |
| 346 | Ga0495637_0000003 | 3300046520 | Bacteria | 623293 |
| 347 | Ga0495637_0000678 | 3300046520 | Bacteria | 23655 |
| 348 | Ga0495637_0001262 | 3300046520 | Bacteria | 15277 |
| 349 | Ga0495637_0007532 | 3300046520 | Bacteria | 5387 |
| 350 | Ga0495643_0000082 | 3300046522 | Bacteria | 159651 |
| 351 | Ga0495643_0000160 | 3300046522 | Bacteria | 107502 |
| 352 | Ga0495643_0001457 | 3300046522 | Bacteria | 21735 |
| 353 | Ga0495643_0002059 | 3300046522 | Bacteria | 16668 |
| 354 | Ga0495643_0006996 | 3300046522 | Bacteria | 7330 |
| 355 | Ga0495643_0009136 | 3300046522 | Bacteria | 6197 |
| 356 | Ga0495643_0037120 | 3300046522 | Bacteria | 2674 |
| 357 | Ga0495644_0004547 | 3300046523 | Bacteria | 5453 |
| 358 | Ga0495644_0004840 | 3300046523 | Bacteria | 5291 |
| 359 | Ga0495644_0022203 | 3300046523 | Bacteria | 2419 |
| 360 | Ga0495648_0000019 | 3300046524 | Bacteria | 276407 |
| 361 | Ga0495648_0000052 | 3300046524 | Bacteria | 162169 |
| 362 | Ga0495648_0000432 | 3300046524 | Bacteria | 45814 |
| 363 | Ga0495648_0005052 | 3300046524 | Bacteria | 11080 |
| 364 | Ga0495648_0007994 | 3300046524 | Bacteria | 8387 |
| 365 | Ga0495648_0010938 | 3300046524 | Bacteria | 6881 |
| 366 | Ga0495648_0022403 | 3300046524 | Bacteria | 4349 |
| 367 | Ga0495648_0029745 | 3300046524 | Bacteria | 3620 |
| 368 | Ga0495648_0052141 | 3300046524 | Bacteria | 2487 |
| 369 | Ga0495648_0059795 | 3300046524 | Bacteria | 2271 |
| 370 | Ga0495648_0068530 | 3300046524 | Bacteria | 2069 |
| 371 | Ga0495648_0095589 | 3300046524 | Bacteria | 1653 |
| 372 | Ga0495663_0007301 | 3300046525 | Bacteria | 3051 |
| 373 | Ga0495666_0001189 | 3300046526 | Bacteria | 12540 |
| 374 | Ga0495642_0000222 | 3300046528 | Bacteria | 32616 |
| 375 | Ga0495642_0000806 | 3300046528 | Bacteria | 15208 |
| 376 | Ga0495642_0002620 | 3300046528 | Bacteria | 7246 |
| 377 | Ga0495642_0003287 | 3300046528 | Bacteria | 6393 |
| 378 | Ga0495642_0005268 | 3300046528 | Bacteria | 4971 |
| 379 | Ga0495642_0008365 | 3300046528 | Bacteria | 3960 |
| 380 | Ga0495642_0009696 | 3300046528 | Bacteria | 3685 |
| 381 | Ga0495642_0012401 | 3300046528 | Bacteria | 3286 |
| 382 | Ga0495642_0019025 | 3300046528 | Bacteria | 2689 |
| 383 | Ga0495642_0039396 | 3300046528 | Bacteria | 1917 |
| 384 | Ga0495654_0000014 | 3300046530 | Bacteria | 312126 |
| 385 | Ga0495654_0008245 | 3300046530 | Bacteria | 5766 |
| 386 | Ga0495654_0009189 | 3300046530 | Bacteria | 5421 |
| 387 | Ga0495654_0019229 | 3300046530 | Bacteria | 3574 |
| 388 | Ga0495654_0021923 | 3300046530 | Bacteria | 3321 |
| 389 | Ga0495654_0026379 | 3300046530 | Bacteria | 2986 |
| 390 | Ga0495640_0114709 | 3300046533 | Bacteria | 1756 |
| 391 | Ga0495586_0000782 | 3300046535 | Bacteria | 18318 |
| 392 | Ga0495586_0048141 | 3300046535 | Bacteria | 2303 |
| 393 | Ga0495586_0135073 | 3300046535 | Bacteria | 1382 |
| 394 | Ga0495587_0079911 | 3300046536 | Bacteria | 1896 |
| 395 | Ga0495609_0000038 | 3300046538 | Bacteria | 182264 |
| 396 | Ga0495609_0000859 | 3300046538 | Bacteria | 22380 |
| 397 | Ga0495609_0003202 | 3300046538 | Bacteria | 9503 |
| 398 | Ga0495609_0003922 | 3300046538 | Bacteria | 8341 |
| 399 | Ga0495609_0005917 | 3300046538 | Bacteria | 6322 |
| 400 | Ga0495609_0012286 | 3300046538 | Bacteria | 4061 |
| 401 | Ga0495609_0027987 | 3300046538 | Bacteria | 2574 |
| 402 | Ga0495609_0028526 | 3300046538 | Bacteria | 2547 |
| 403 | Ga0495609_0033675 | 3300046538 | Bacteria | 2325 |
| 404 | Ga0495609_0033857 | 3300046538 | Bacteria | 2317 |
| 405 | Ga0495597_0000133 | 3300046542 | Bacteria | 67356 |
| 406 | Ga0495597_0000180 | 3300046542 | Bacteria | 56208 |
| 407 | Ga0495597_0000364 | 3300046542 | Bacteria | 40081 |
| 408 | Ga0495597_0001403 | 3300046542 | Bacteria | 17393 |
| 409 | Ga0495597_0004349 | 3300046542 | Bacteria | 7811 |
| 410 | Ga0495597_0006422 | 3300046542 | Bacteria | 6083 |
| 411 | Ga0495597_0010187 | 3300046542 | Bacteria | 4605 |
| 412 | Ga0495597_0019169 | 3300046542 | Bacteria | 3203 |
| 413 | Ga0495597_0023939 | 3300046542 | Bacteria | 2822 |
| 414 | Ga0495597_0033505 | 3300046542 | Bacteria | 2325 |
| 415 | Ga0495597_0075319 | 3300046542 | Bacteria | 1449 |
| 416 | Ga0495645_0025263 | 3300046543 | Bacteria | 4311 |
| 417 | Ga0495622_0000034 | 3300046557 | Bacteria | 123671 |
| 418 | Ga0495622_0000071 | 3300046557 | Bacteria | 89071 |
| 419 | Ga0495622_0059996 | 3300046557 | Bacteria | 1761 |
| 420 | Ga0495633_0000077 | 3300046558 | Bacteria | 129051 |
| 421 | Ga0495633_0000100 | 3300046558 | Bacteria | 116284 |
| 422 | Ga0495633_0002802 | 3300046558 | Bacteria | 12056 |
| 423 | Ga0495633_0005027 | 3300046558 | Bacteria | 8242 |
| 424 | Ga0495633_0016281 | 3300046558 | Bacteria | 3839 |
| 425 | Ga0495633_0019341 | 3300046558 | Bacteria | 3445 |
| 426 | Ga0495633_0021784 | 3300046558 | Bacteria | 3199 |
| 427 | Ga0495633_0038059 | 3300046558 | Bacteria | 2299 |
| 428 | Ga0495633_0069201 | 3300046558 | Bacteria | 1647 |
| 429 | Ga0495633_0077110 | 3300046558 | Bacteria | 1552 |
| 430 | Ga0495656_0006136 | 3300046615 | Bacteria | 4197 |
| 431 | Ga0495656_0016846 | 3300046615 | Bacteria | 2779 |
| 432 | Ga0495668_0000231 | 3300046616 | Bacteria | 79433 |
| 433 | Ga0495668_0000308 | 3300046616 | Bacteria | 67599 |
| 434 | Ga0495668_0000351 | 3300046616 | Bacteria | 61353 |
| 435 | Ga0495668_0000602 | 3300046616 | Bacteria | 43544 |
| 436 | Ga0495668_0003350 | 3300046616 | Bacteria | 12079 |
| 437 | Ga0495668_0005511 | 3300046616 | Bacteria | 8541 |
| 438 | Ga0495668_0006404 | 3300046616 | Bacteria | 7715 |
| 439 | Ga0495668_0006574 | 3300046616 | Bacteria | 7587 |
| 440 | Ga0495668_0015046 | 3300046616 | Bacteria | 4526 |
| 441 | Ga0495668_0027407 | 3300046616 | Bacteria | 3228 |
| 442 | Ga0495668_0049578 | 3300046616 | Bacteria | 2328 |
| 443 | Ga0495668_0138233 | 3300046616 | Bacteria | 1333 |
| 444 | Ga0495668_0205067 | 3300046616 | Bacteria | 1079 |
| 445 | Ga0495634_0005407 | 3300046642 | Bacteria | 9837 |
| 446 | Ga0495611_0001042 | 3300046648 | Bacteria | 14662 |
| 447 | Ga0495611_0003262 | 3300046648 | Bacteria | 7173 |
| 448 | Ga0495611_0004561 | 3300046648 | Bacteria | 5967 |
| 449 | Ga0495611_0010182 | 3300046648 | Bacteria | 3978 |
| 450 | Ga0495611_0017046 | 3300046648 | Bacteria | 3105 |
| 451 | Ga0495625_0001017 | 3300046660 | Bacteria | 36954 |
| 452 | Ga0495625_0001111 | 3300046660 | Bacteria | 34888 |
| 453 | Ga0495625_0022022 | 3300046660 | Bacteria | 4893 |
| 454 | Ga0495625_0027562 | 3300046660 | Bacteria | 4275 |
| 455 | Ga0495625_0035300 | 3300046660 | Bacteria | 3686 |
| 456 | Ga0495625_0085834 | 3300046660 | Bacteria | 2184 |
| 457 | Ga0495625_0111825 | 3300046660 | Bacteria | 1866 |
| 458 | Ga0495625_0125603 | 3300046660 | Bacteria | 1742 |
| 459 | Ga0495635_0003980 | 3300046663 | Bacteria | 10272 |
| 460 | Ga0495659_0000049 | 3300046664 | Bacteria | 52682 |
| 461 | Ga0495659_0001305 | 3300046664 | Bacteria | 8554 |
| 462 | Ga0495661_0000070 | 3300046665 | Bacteria | 124795 |
| 463 | Ga0495661_0001176 | 3300046665 | Bacteria | 22750 |
| 464 | Ga0495661_0001533 | 3300046665 | Bacteria | 19179 |
| 465 | Ga0495661_0002205 | 3300046665 | Bacteria | 15188 |
| 466 | Ga0495661_0004687 | 3300046665 | Bacteria | 9823 |
| 467 | Ga0495661_0007175 | 3300046665 | Bacteria | 7776 |
| 468 | Ga0495661_0009106 | 3300046665 | Bacteria | 6826 |
| 469 | Ga0495661_0010600 | 3300046665 | Bacteria | 6285 |
| 470 | Ga0495661_0066721 | 3300046665 | Bacteria | 2116 |
| 471 | Ga0495661_0072029 | 3300046665 | Bacteria | 2017 |
| 472 | Ga0495661_0088034 | 3300046665 | Bacteria | 1773 |
| 473 | Ga0495661_0110869 | 3300046665 | Bacteria | 1529 |
| 474 | Ga0495588_0000156 | 3300046674 | Bacteria | 93559 |
| 475 | Ga0495588_0024390 | 3300046674 | Bacteria | 3004 |
| 476 | Ga0495588_0038944 | 3300046674 | Bacteria | 2420 |
| 477 | Ga0495588_0064882 | 3300046674 | Bacteria | 1894 |
| 478 | Ga0495588_0103023 | 3300046674 | Bacteria | 1500 |
| 479 | Ga0495623_0026050 | 3300046679 | Bacteria | 3766 |
| 480 | Ga0495623_0032004 | 3300046679 | Bacteria | 3381 |
| 481 | Ga0495623_0038351 | 3300046679 | Bacteria | 3064 |
| 482 | Ga0495669_0000032 | 3300046684 | Bacteria | 100472 |
| 483 | Ga0495669_0000481 | 3300046684 | Bacteria | 18511 |
| 484 | Ga0495669_0000840 | 3300046684 | Bacteria | 13067 |
| 485 | Ga0495669_0008174 | 3300046684 | Bacteria | 4391 |
| 486 | Ga0495613_0010463 | 3300046689 | Bacteria | 6889 |
| 487 | Ga0495670_0000144 | 3300046691 | Bacteria | 31081 |
| 488 | Ga0495670_0000401 | 3300046691 | Bacteria | 20739 |
| 489 | Ga0495670_0012352 | 3300046691 | Bacteria | 4198 |
| 490 | Ga0495670_0041706 | 3300046691 | Bacteria | 2290 |
| 491 | Ga0495671_0000005 | 3300046692 | Bacteria | 509397 |
| 492 | Ga0495671_0003630 | 3300046692 | Bacteria | 9404 |
| 493 | Ga0495671_0004998 | 3300046692 | Bacteria | 7814 |
| 494 | Ga0495671_0006502 | 3300046692 | Bacteria | 6747 |
| 495 | Ga0495671_0009288 | 3300046692 | Bacteria | 5497 |
| 496 | Ga0495671_0016893 | 3300046692 | Bacteria | 3889 |
| 497 | Ga0495671_0032263 | 3300046692 | Bacteria | 2674 |
| 498 | Ga0495671_0036522 | 3300046692 | Bacteria | 2488 |
| 499 | Ga0495671_0042367 | 3300046692 | Bacteria | 2288 |
| 500 | Ga0495649_0002755 | 3300046694 | Bacteria | 12234 |
| 501 | Ga0495649_0007541 | 3300046694 | Bacteria | 6622 |
| 502 | Ga0495649_0034473 | 3300046694 | Bacteria | 2785 |
| 503 | Ga0495649_0063857 | 3300046694 | Bacteria | 1978 |
| 504 | Ga0495589_0000074 | 3300046794 | Bacteria | 93716 |
| 505 | Ga0495589_0000099 | 3300046794 | Bacteria | 83606 |
| 506 | Ga0495589_0002047 | 3300046794 | Bacteria | 11411 |
| 507 | Ga0495589_0030324 | 3300046794 | Bacteria | 2723 |
| 508 | Ga0495589_0031465 | 3300046794 | Bacteria | 2671 |
| 509 | Ga0495589_0072921 | 3300046794 | Bacteria | 1676 |
| 510 | Ga0495660_0000047 | 3300046810 | Bacteria | 149291 |
| 511 | Ga0495660_0000203 | 3300046810 | Bacteria | 62255 |
| 512 | Ga0495660_0000514 | 3300046810 | Bacteria | 31796 |
| 513 | Ga0495660_0008423 | 3300046810 | Bacteria | 6036 |
| 514 | Ga0495660_0012375 | 3300046810 | Bacteria | 4951 |
| 515 | Ga0495660_0015362 | 3300046810 | Bacteria | 4424 |
| 516 | Ga0495660_0017313 | 3300046810 | Bacteria | 4149 |
| 517 | Ga0495660_0030318 | 3300046810 | Bacteria | 3047 |
| 518 | Ga0495581_0015728 | 3300047315 | Bacteria | 4393 |
| 519 | Ga0495581_0040472 | 3300047315 | Bacteria | 2697 |
| 520 | Ga0495604_0008261 | 3300047317 | Bacteria | 8233 |
| 521 | Ga0495604_0030254 | 3300047317 | Bacteria | 4302 |
| 522 | Ga0495604_0041736 | 3300047317 | Bacteria | 3597 |
| 523 | Ga0495604_0077162 | 3300047317 | Bacteria | 2504 |
| 524 | Ga0495636_0001566 | 3300047318 | Bacteria | 8704 |
| 525 | Ga0495636_0005882 | 3300047318 | Bacteria | 4812 |
| 526 | Ga0495672_0000026 | 3300047320 | Bacteria | 340319 |
| 527 | Ga0495672_0000081 | 3300047320 | Bacteria | 159863 |
| 528 | Ga0495672_0000256 | 3300047320 | Bacteria | 74232 |
| 529 | Ga0495672_0000356 | 3300047320 | Bacteria | 58626 |
| 530 | Ga0495672_0004203 | 3300047320 | Bacteria | 11926 |
| 531 | Ga0495672_0043469 | 3300047320 | Bacteria | 2701 |
| 532 | Ga0495676_0000031 | 3300047321 | Bacteria | 132364 |
| 533 | Ga0495676_0028182 | 3300047321 | Bacteria | 4802 |
| 534 | Ga0495676_0048092 | 3300047321 | Bacteria | 3442 |
| 535 | Ga0495676_0242667 | 3300047321 | Bacteria | 1233 |
| 536 | Ga0495680_0004349 | 3300047322 | Bacteria | 13568 |
| 537 | Ga0495683_0000260 | 3300047323 | Bacteria | 47332 |
| 538 | Ga0495683_0000309 | 3300047323 | Bacteria | 41291 |
| 539 | Ga0495683_0003892 | 3300047323 | Bacteria | 8588 |
| 540 | Ga0495683_0008632 | 3300047323 | Bacteria | 5442 |
| 541 | Ga0495683_0017674 | 3300047323 | Bacteria | 3694 |
| 542 | Ga0495683_0033214 | 3300047323 | Bacteria | 2627 |
| 543 | Ga0495683_0038036 | 3300047323 | Bacteria | 2437 |
| 544 | Ga0495683_0038535 | 3300047323 | Bacteria | 2420 |
| 545 | Ga0495683_0052221 | 3300047323 | Bacteria | 2041 |
| 546 | Ga0495687_000071 | 3300047443 | Bacteria | 159096 |
| 547 | Ga0495687_000238 | 3300047443 | Bacteria | 76186 |
| 548 | Ga0495687_000448 | 3300047443 | Bacteria | 50806 |
| 549 | Ga0495687_001351 | 3300047443 | Bacteria | 22781 |
| 550 | Ga0495687_002105 | 3300047443 | Bacteria | 16691 |
| 551 | Ga0495687_008516 | 3300047443 | Bacteria | 5865 |
| 552 | Ga0495687_013290 | 3300047443 | Bacteria | 4308 |
| 553 | Ga0495675_0006032 | 3300047444 | Bacteria | 7415 |
| 554 | Ga0495675_0018492 | 3300047444 | Bacteria | 4423 |
| 555 | Ga0495677_0000016 | 3300047445 | Bacteria | 126981 |
| 556 | Ga0495677_0000325 | 3300047445 | Bacteria | 20654 |
| 557 | Ga0495677_0000856 | 3300047445 | Bacteria | 12318 |
| 558 | Ga0495677_0006131 | 3300047445 | Bacteria | 4549 |
| 559 | Ga0495677_0009183 | 3300047445 | Bacteria | 3653 |
| 560 | Ga0495677_0011737 | 3300047445 | Bacteria | 3202 |
| 561 | Ga0495677_0021452 | 3300047445 | Bacteria | 2340 |
| 562 | Ga0495677_0024290 | 3300047445 | Bacteria | 2198 |
| 563 | Ga0495677_0031625 | 3300047445 | Bacteria | 1926 |
| 564 | Ga0495677_0035213 | 3300047445 | Bacteria | 1827 |
| 565 | Ga0495677_0037882 | 3300047445 | Bacteria | 1762 |
| 566 | Ga0495679_004505 | 3300047446 | Bacteria | 6393 |
| 567 | Ga0495679_007538 | 3300047446 | Bacteria | 4522 |
| 568 | Ga0495685_001651 | 3300047447 | Bacteria | 6878 |
| 569 | Ga0495685_035787 | 3300047447 | Bacteria | 1705 |
| 570 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 571 | Ga0495673_0000009 | 3300047469 | Bacteria | 731993 |
| 572 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 573 | Ga0495673_0007005 | 3300047469 | Bacteria | 6550 |
| 574 | Ga0495681_0003255 | 3300047470 | Bacteria | 11324 |
| 575 | Ga0495681_0004599 | 3300047470 | Bacteria | 9385 |
| 576 | Ga0495681_0006400 | 3300047470 | Bacteria | 7749 |
| 577 | Ga0495681_0009064 | 3300047470 | Bacteria | 6168 |
| 578 | Ga0495681_0014874 | 3300047470 | Bacteria | 4436 |
| 579 | Ga0495681_0018026 | 3300047470 | Bacteria | 3903 |
| 580 | Ga0495681_0026590 | 3300047470 | Bacteria | 3008 |
| 581 | Ga0495681_0047094 | 3300047470 | Bacteria | 2052 |
| 582 | Ga0495681_0048196 | 3300047470 | Bacteria | 2021 |
| 583 | Ga0495681_0076073 | 3300047470 | Bacteria | 1509 |
| 584 | Ga0495686_0000114 | 3300047472 | Bacteria | 167232 |
| 585 | Ga0495686_0000130 | 3300047472 | Bacteria | 152244 |
| 586 | Ga0495686_0005614 | 3300047472 | Bacteria | 9846 |
| 587 | Ga0495686_0015414 | 3300047472 | Bacteria | 5220 |
| 588 | Ga0495686_0077087 | 3300047472 | Bacteria | 2041 |
| 589 | Ga0495593_0001916 | 3300047673 | Bacteria | 12402 |
| 590 | Ga0495593_0106699 | 3300047673 | Bacteria | 1432 |
| 591 | Ga0495602_0032162 | 3300048088 | Bacteria | 4944 |
| 592 | Ga0495614_0002030 | 3300048089 | Bacteria | 8900 |
| 593 | Ga0495614_0007966 | 3300048089 | Bacteria | 4708 |
| 594 | Ga0495615_0016509 | 3300048090 | Bacteria | 1594 |
| 595 | Ga0495626_0000042 | 3300048091 | Bacteria | 169058 |
| 596 | Ga0495626_0000543 | 3300048091 | Bacteria | 37476 |
| 597 | Ga0495626_0001457 | 3300048091 | Bacteria | 18719 |
| 598 | Ga0495626_0006386 | 3300048091 | Bacteria | 6713 |
| 599 | Ga0495626_0007234 | 3300048091 | Bacteria | 6202 |
| 600 | Ga0495626_0017945 | 3300048091 | Bacteria | 3566 |
| 601 | Ga0495626_0036624 | 3300048091 | Bacteria | 2336 |
| 602 | Ga0496100_0015159 | 3300048903 | Bacteria | 4496 |
| 603 | Ga0496101_0171628 | 3300048904 | Bacteria | 1667 |
| 604 | Ga0496102_0000338 | 3300048905 | Bacteria | 57280 |
| 605 | Ga0496102_0035158 | 3300048905 | Bacteria | 4508 |
| 606 | Ga0496103_0020193 | 3300048906 | Bacteria | 4000 |
| 607 | Ga0496105_0082530 | 3300048908 | Bacteria | 2655 |
| 608 | Ga0496106_0010626 | 3300048909 | Bacteria | 6802 |
| 609 | Ga0496107_0063262 | 3300048910 | Bacteria | 2681 |
| 610 | Ga0496107_0090037 | 3300048910 | Bacteria | 2241 |
| 611 | Ga0496107_0120373 | 3300048910 | Bacteria | 1934 |
| 612 | Ga0496108_0265402 | 3300048911 | Bacteria | 1494 |
| 613 | Ga0496110_0000005 | 3300048913 | Bacteria | 117293 |
| 614 | Ga0496110_0038156 | 3300048913 | Bacteria | 4178 |
| 615 | Ga0496110_0269304 | 3300048913 | Bacteria | 1551 |
| 616 | Ga0496111_0040056 | 3300048914 | Bacteria | 3361 |
| 617 | Ga0496111_0132177 | 3300048914 | Bacteria | 1847 |
| 618 | Ga0496113_0010035 | 3300048916 | Bacteria | 6246 |
| 619 | Ga0496116_0014961 | 3300048919 | Bacteria | 6158 |
| 620 | Ga0496121_0015595 | 3300048924 | Bacteria | 7938 |
| 621 | Ga0496121_0054530 | 3300048924 | Bacteria | 3339 |
| 622 | Ga0496122_0000482 | 3300048925 | Bacteria | 82868 |
| 623 | Ga0496122_0015889 | 3300048925 | Bacteria | 7167 |
| 624 | Ga0496122_0017057 | 3300048925 | Bacteria | 6816 |
| 625 | Ga0496123_0000662 | 3300048926 | Bacteria | 56930 |
| 626 | Ga0496123_0002188 | 3300048926 | Bacteria | 24891 |
| 627 | Ga0496123_0005907 | 3300048926 | Bacteria | 12085 |
| 628 | Ga0496123_0077877 | 3300048926 | Bacteria | 2034 |
| 629 | Ga0496124_0028622 | 3300048927 | Bacteria | 4982 |
| 630 | Ga0496124_0042266 | 3300048927 | Bacteria | 3926 |
| 631 | Ga0496124_0065299 | 3300048927 | Bacteria | 3035 |
| 632 | Ga0496124_0112271 | 3300048927 | Bacteria | 2192 |
| 633 | Ga0496125_0008226 | 3300048928 | Bacteria | 10967 |
| 634 | Ga0496126_0010059 | 3300048929 | Bacteria | 9979 |
| 635 | Ga0495678_000027 | 3300049459 | Bacteria | 222075 |
| 636 | Ga0495678_000074 | 3300049459 | Bacteria | 125964 |
| 637 | Ga0495678_001024 | 3300049459 | Bacteria | 23725 |
| 638 | Ga0495678_004034 | 3300049459 | Bacteria | 8738 |
| 639 | Ga0495678_005941 | 3300049459 | Bacteria | 6598 |
| 640 | Ga0495678_048157 | 3300049459 | Bacteria | 1664 |
| 641 | Ga0495678_063428 | 3300049459 | Bacteria | 1380 |
| 642 | Ga0495682_0000611 | 3300049460 | Bacteria | 24094 |
| 643 | Ga0501230_003092 | 3300049667 | Bacteria | 2180 |
| 644 | Ga0501235_035744 | 3300049669 | Bacteria | 1129 |
| 645 | Ga0501269_000005 | 3300049766 | Bacteria | 77832 |
| 646 | Ga0501279_002472 | 3300049775 | Bacteria | 2424 |
| 647 | Ga0501035_0012712 | 3300049822 | Bacteria | 7779 |
| 648 | Ga0495619_0092193 | 3300053085 | Bacteria | 2052 |
| 649 | Ga0500618_000752 | 3300053125 | Bacteria | 18351 |
| 650 | Ga0500586_000124 | 3300053145 | Bacteria | 13969 |
| 651 | 2548849007 | 2547132512 | Bacteria | 3416496 |
| 652 | 2643800981 | 2643221556 | Bacteria | 7251154 |
| 653 | 2644250496 | 2643221645 | Bacteria | 7207331 |
| 654 | 2644358817 | 2643221664 | Bacteria | 7272945 |
| 655 | 2644471347 | 2643221684 | Bacteria | 7145183 |
| 656 | 2738738727 | 2738541280 | Bacteria | 6630198 |
| 657 | 2738826174 | 2738541297 | Bacteria | 6549566 |
| 658 | 2738842454 | 2738541300 | Bacteria | 6675882 |
| 659 | 2739149971 | 2738541357 | Bacteria | 6549408 |
| 660 | 2739191890 | 2738543003 | Bacteria | 6549560 |
| 661 | 2739273201 | 2738543018 | Bacteria | 6718814 |
| 662 | 2739318367 | 2738543026 | Bacteria | 6549408 |
| 663 | 2739336608 | 2738543029 | Bacteria | 6549249 |
| 664 | 2739342245 | 2738543030 | Bacteria | 6719714 |
| 665 | 2821135021 | 2821131069 | Bacteria | 6108407 |
| 666 | 2842715888 | 2842711865 | Bacteria | 7155354 |
| 667 | 2857558009 | 2857553236 | Bacteria | 6166726 |
| 668 | 2857558726 | 2857558681 | Bacteria | 6617694 |
| 669 | 2857569606 | 2857564685 | Bacteria | 6290584 |
| 670 | 2904428394 | 2904424332 | Bacteria | 7633521 |
| 671 | 2919476386 | 2919476304 | Bacteria | 5888696 |
| 672 | 8047674697 | 8047673197 | Bacteria | 7395230 |
| 673 | rootL2_10002767 | |||
| 674 | JGI25150J39212_1001795 | |||
| 675 | JGI25150J39212_1003691 | |||
| 676 | JGI25159J45721_1006024 | |||
| 677 | rootH1_10044854 | |||
| 678 | rootL2_10028108 | |||
| 679 | Ga0055529_1000015 | |||
| 680 | Ga0055526_1000007 | |||
| 681 | Ga0055526_1000037 | |||
| 682 | Ga0055526_1003417 | |||
| 683 | Ga0055537_1000236 | |||
| 684 | Ga0055524_1000439 | |||
| 685 | Ga0055534_1000544 | |||
| 686 | Ga0055528_1000136 | |||
| 687 | Ga0055543_1001195 | |||
| 688 | Ga0065165_1001295 | |||
| 689 | Ga0070676_10039038 | |||
| 690 | Ga0070676_10068598 | |||
| 691 | Ga0070690_100028400 | |||
| 692 | Ga0070670_100000689 | |||
| 693 | Ga0070670_100013594 | |||
| 694 | Ga0070670_100022939 | |||
| 695 | Ga0070670_100074011 | |||
| 696 | Ga0068869_100029485 | |||
| 697 | Ga0070668_100217061 | |||
| 698 | Ga0070669_100005113 | |||
| 699 | Ga0070675_100003057 | |||
| 700 | Ga0070675_100019380 | |||
| 701 | Ga0070671_100059881 | |||
| 702 | Ga0070671_100065644 | |||
| 703 | Ga0070674_100096447 | |||
| 704 | Ga0070673_100052655 | |||
| 705 | Ga0070673_100191944 | |||
| 706 | Ga0070688_100145446 | |||
| 707 | Ga0070667_100108852 | |||
| 708 | Ga0070667_100131469 | |||
| 709 | Ga0070662_100287400 | |||
| 710 | Ga0068867_100027693 | |||
| 711 | Ga0068867_100052665 | |||
| 712 | Ga0068867_100270360 | |||
| 713 | Ga0070672_100005705 | |||
| 714 | Ga0070672_100012074 | |||
| 715 | Ga0070665_100080218 | |||
| 716 | Ga0070702_100107829 | |||
| 717 | Ga0068864_100000792 | |||
| 718 | Ga0068864_100029176 | |||
| 719 | Ga0068866_10046624 | |||
| 720 | Ga0068861_100010977 | |||
| 721 | Ga0068861_100181652 | |||
| 722 | Ga0068870_10058125 | |||
| 723 | Ga0068863_100013377 | |||
| 724 | Ga0068863_100218272 | |||
| 725 | Ga0068863_100348973 | |||
| 726 | Ga0068860_100107214 | |||
| 727 | Ga0068862_100038883 | |||
| 728 | Ga0097621_100023782 | |||
| 729 | Ga0097621_100126074 | |||
| 730 | Ga0068871_100016954 | |||
| 731 | Ga0068871_100054896 | |||
| 732 | Ga0075428_100143224 | |||
| 733 | Ga0068865_100096255 | |||
| 734 | Ga0079104_1007153 | |||
| 735 | Ga0099826_10000008 | |||
| 736 | Ga0105244_10000395 | |||
| 737 | Ga0105244_10002014 | |||
| 738 | Ga0105244_10051662 | |||
| 739 | Ga0105244_10093950 | |||
| 740 | Ga0105242_10092527 | |||
| 741 | Ga0105242_10187820 | |||
| 742 | Ga0105242_10237946 | |||
| 743 | Ga0105248_10036202 | |||
| 744 | Ga0105248_10071080 | |||
| 745 | Ga0157378_10202122 | |||
| 746 | Ga0157375_10000063 | |||
| 747 | Ga0157375_10375149 | |||
| 748 | Ga0163163_10000086 | |||
| 749 | Ga0163163_10041872 | |||
| 750 | Ga0163163_10074233 | |||
| 751 | Ga0157376_10163738 | |||
| 752 | Ga0182006_1000023 | |||
| 753 | Ga0182005_1000154 | |||
| 754 | Ga0213872_10000024 | |||
| 755 | Ga0213872_10000340 | |||
| 756 | Ga0213872_10046295 | |||
| 757 | Ga0209563_100011 | |||
| 758 | Ga0209437_104169 | |||
| 759 | Ga0207425_1000208 | |||
| 760 | Ga0209646_1000125 | |||
| 761 | Ga0209677_100866 | |||
| 762 | Ga0209148_1000379 | |||
| 763 | Ga0209565_1000082 | |||
| 764 | Ga0209455_1000031 | |||
| 765 | Ga0209673_1000381 | |||
| 766 | Ga0209130_1000016 | |||
| 767 | Ga0209675_1000166 | |||
| 768 | Ga0209564_1000010 | |||
| 769 | Ga0209564_1000042 | |||
| 770 | Ga0209564_1001111 | |||
| 771 | Ga0209758_1001194 | |||
| 772 | Ga0209256_1000018 | |||
| 773 | Ga0209256_1000380 | |||
| 774 | Ga0207655_1005987 | |||
| 775 | Ga0207655_1008368 | |||
| 776 | Ga0207642_10029397 | |||
| 777 | Ga0207645_10056139 | |||
| 778 | Ga0207705_10006415 | |||
| 779 | Ga0207654_10000725 | |||
| 780 | Ga0207681_10007482 | |||
| 781 | Ga0207650_10001128 | |||
| 782 | Ga0207650_10001856 | |||
| 783 | Ga0207650_10021866 | |||
| 784 | Ga0207650_10038736 | |||
| 785 | Ga0207659_10004008 | |||
| 786 | Ga0207659_10013629 | |||
| 787 | Ga0207659_10036761 | |||
| 788 | Ga0207659_10120609 | |||
| 789 | Ga0207644_10008980 | |||
| 790 | Ga0207690_10130721 | |||
| 791 | Ga0207690_10155448 | |||
| 792 | Ga0207709_10011996 | |||
| 793 | Ga0207691_10000768 | |||
| 794 | Ga0207691_10015748 | |||
| 795 | Ga0207711_10048418 | |||
| 796 | Ga0207689_10037375 | |||
| 797 | Ga0207651_10005944 | |||
| 798 | Ga0207651_10158319 | |||
| 799 | Ga0207668_10018766 | |||
| 800 | Ga0207668_10276001 | |||
| 801 | Ga0207658_10033073 | |||
| 802 | Ga0207703_10333475 | |||
| 803 | Ga0207678_10131225 | |||
| 804 | Ga0207648_10023620 | |||
| 805 | Ga0207648_10027645 | |||
| 806 | Ga0207648_10139614 | |||
| 807 | Ga0207676_10001161 | |||
| 808 | Ga0207675_100020796 | |||
| 809 | Ga0207683_10093836 | |||
| 810 | Ga0207683_10095998 | |||
| 811 | Ga0209281_1003620 | |||
| 812 | Ga0209282_1000005 | |||
| 813 | Ga0268266_10086094 | |||
| 814 | Ga0268265_10059990 | |||
| 815 | Ga0268265_10068328 | |||
| 816 | Ga0268264_10062991 | |||
| 817 | Ga0268264_10151451 | |||
| 818 | Ga0265330_10002449 | |||
| 819 | Ga0265332_10000100 | |||
| 820 | Ga0265332_10000293 | |||
| 821 | Ga0265325_10045317 | |||
| 822 | Ga0265329_10002818 | |||
| 823 | Ga0265331_10000348 | |||
| 824 | Ga0265327_10002496 | |||
| 825 | Ga0307408_100000122 | |||
| 826 | Ga0265314_10007313 | |||
| 827 | Ga0265314_10024080 | |||
| 828 | Ga0265342_10012270 | |||
| 829 | Ga0373927_0101267 | |||
| 830 | Ga0395899_0029253 | |||
| 831 | Ga0395899_0066997 | |||
| 832 | Ga0395899_0170583 | |||
| 833 | Ga0395900_0000252 | |||
| 834 | Ga0395900_0000304 | |||
| 835 | Ga0395900_0021601 | |||
| 836 | Ga0395900_0033682 | |||
| 837 | Ga0395900_0033714 | |||
| 838 | Ga0395900_0052740 | |||
| 839 | Ga0395900_0261932 | |||
| 840 | Ga0395900_0270622 | |||
| 841 | Ga0395900_0341259 | |||
| 842 | Ga0395898_0052464 | |||
| 843 | Ga0395898_0059044 | |||
| 844 | Ga0395898_0119082 | |||
| 845 | Ga0395905_0053312 | |||
| 846 | Ga0395905_0106043 | |||
| 847 | Ga0395905_0106655 | |||
| 848 | Ga0395901_0001103 | |||
| 849 | Ga0395901_0154613 | |||
| 850 | Ga0395901_0605340 | |||
| 851 | Ga0436361_0061503 | |||
| 852 | Ga0436361_0224368 | |||
| 853 | Ga0436361_0243744 | |||
| 854 | Ga0436361_0340644 | |||
| 855 | Ga0436361_0811535 | |||
| 856 | Ga0439449_0026963 | |||
| 857 | Ga0439455_0002224 | |||
| 858 | Ga0439455_0021164 | |||
| 859 | Ga0439458_0014779 | |||
| 860 | Ga0451577_0016606 | |||
| 861 | Ga0451577_0142648 | |||
| 862 | Ga0453683_0003664 | |||
| 863 | Ga0466965_0022001 | |||
| 864 | Ga0466965_0037514 | |||
| 865 | Ga0466966_0008272 | |||
| 866 | Ga0466963_0092194 | |||
| 867 | Ga0466964_0000408 | |||
| 868 | Ga0466964_0000677 | |||
| 869 | Ga0453684_0000969 | |||
| 870 | Ga0453684_0035209 | |||
| 871 | Ga0453684_0064348 | |||
| 872 | Ga0453684_0303261 | |||
| 873 | Ga0466968_0001749 | |||
| 874 | Ga0466970_0112372 | |||
| 875 | Ga0466957_0009600 | |||
| 876 | Ga0466957_0012053 | |||
| 877 | Ga0466957_0077579 | |||
| 878 | Ga0466959_0001432 | |||
| 879 | Ga0466959_0029745 | |||
| 880 | Ga0451576_0000119 | |||
| 881 | Ga0451576_0000554 | |||
| 882 | Ga0451576_0002961 | |||
| 883 | Ga0451576_0010602 | |||
| 884 | Ga0451576_0014401 | |||
| 885 | Ga0451576_0015236 | |||
| 886 | Ga0451576_0032109 | |||
| 887 | Ga0451576_0038987 | |||
| 888 | Ga0451576_0152156 | |||
| 889 | Ga0451576_0234518 | |||
| 890 | Ga0466958_0010418 | |||
| 891 | Ga0466958_0023803 | |||
| 892 | Ga0466967_0029579 | |||
| 893 | Ga0466967_0104655 | |||
| 894 | Ga0495617_000020 | |||
| 895 | Ga0495617_000153 | |||
| 896 | Ga0495617_007470 | |||
| 897 | Ga0495617_042010 | |||
| 898 | Ga0495617_062807 | |||
| 899 | Ga0495627_000004 | |||
| 900 | Ga0495627_000170 | |||
| 901 | Ga0495627_008608 | |||
| 902 | Ga0495627_056839 | |||
| 903 | Ga0495603_0019706 | |||
| 904 | Ga0495603_0048585 | |||
| 905 | Ga0495590_0000009 | |||
| 906 | Ga0495590_0000039 | |||
| 907 | Ga0495590_0012321 | |||
| 908 | Ga0495591_000409 | |||
| 909 | Ga0495629_0059906 | |||
| 910 | Ga0495629_0093708 | |||
| 911 | Ga0495638_0000407 | |||
| 912 | Ga0495638_0005864 | |||
| 913 | Ga0495638_0022676 | |||
| 914 | Ga0495638_0028608 | |||
| 915 | Ga0495638_0037141 | |||
| 916 | Ga0495638_0051405 | |||
| 917 | Ga0495653_0000035 | |||
| 918 | Ga0495653_0009175 | |||
| 919 | Ga0495653_0023654 | |||
| 920 | Ga0495653_0114583 | |||
| 921 | Ga0495653_0193349 | |||
| 922 | Ga0495650_0000128 | |||
| 923 | Ga0495650_0000157 | |||
| 924 | Ga0495650_0000261 | |||
| 925 | Ga0495650_0000970 | |||
| 926 | Ga0495650_0028673 | |||
| 927 | Ga0495580_0137983 | |||
| 928 | Ga0495582_0003125 | |||
| 929 | Ga0495582_0005833 | |||
| 930 | Ga0495582_0119184 | |||
| 931 | Ga0495605_0000018 | |||
| 932 | Ga0495605_0000055 | |||
| 933 | Ga0495605_0000208 | |||
| 934 | Ga0495605_0007130 | |||
| 935 | Ga0495605_0014919 | |||
| 936 | Ga0495605_0030381 | |||
| 937 | Ga0495639_0007784 | |||
| 938 | Ga0495584_0000073 | |||
| 939 | Ga0495584_0000498 | |||
| 940 | Ga0495584_0000507 | |||
| 941 | Ga0495584_0000754 | |||
| 942 | Ga0495584_0010266 | |||
| 943 | Ga0495584_0046332 | |||
| 944 | Ga0495585_0000033 | |||
| 945 | Ga0495585_0000042 | |||
| 946 | Ga0495585_0000828 | |||
| 947 | Ga0495585_0001955 | |||
| 948 | Ga0495585_0002326 | |||
| 949 | Ga0495585_0004126 | |||
| 950 | Ga0495585_0038148 | |||
| 951 | Ga0495585_0117115 | |||
| 952 | Ga0495594_0006032 | |||
| 953 | Ga0495594_0019182 | |||
| 954 | Ga0495594_0028860 | |||
| 955 | Ga0495596_0000599 | |||
| 956 | Ga0495596_0001145 | |||
| 957 | Ga0495596_0004087 | |||
| 958 | Ga0495596_0004646 | |||
| 959 | Ga0495596_0018988 | |||
| 960 | Ga0495596_0033489 | |||
| 961 | Ga0495607_0000908 | |||
| 962 | Ga0495607_0001106 | |||
| 963 | Ga0495607_0003657 | |||
| 964 | Ga0495607_0009922 | |||
| 965 | Ga0495607_0011191 | |||
| 966 | Ga0495607_0027705 | |||
| 967 | Ga0495607_0043191 | |||
| 968 | Ga0495583_0000132 | |||
| 969 | Ga0495583_0000981 | |||
| 970 | Ga0495583_0001153 | |||
| 971 | Ga0495583_0007681 | |||
| 972 | Ga0495583_0010627 | |||
| 973 | Ga0495606_0000180 | |||
| 974 | Ga0495606_0000228 | |||
| 975 | Ga0495606_0000512 | |||
| 976 | Ga0495606_0000828 | |||
| 977 | Ga0495606_0000850 | |||
| 978 | Ga0495606_0001374 | |||
| 979 | Ga0495606_0002886 | |||
| 980 | Ga0495606_0004799 | |||
| 981 | Ga0495606_0017477 | |||
| 982 | Ga0495606_0022531 | |||
| 983 | Ga0495606_0049794 | |||
| 984 | Ga0495606_0083150 | |||
| 985 | Ga0495606_0101469 | |||
| 986 | Ga0495606_0120187 | |||
| 987 | Ga0495610_0000014 | |||
| 988 | Ga0495610_0000738 | |||
| 989 | Ga0495610_0009819 | |||
| 990 | Ga0495610_0011744 | |||
| 991 | Ga0495610_0016104 | |||
| 992 | Ga0495616_0000261 | |||
| 993 | Ga0495616_0000679 | |||
| 994 | Ga0495616_0001443 | |||
| 995 | Ga0495616_0005802 | |||
| 996 | Ga0495616_0012408 | |||
| 997 | Ga0495616_0023825 | |||
| 998 | Ga0495616_0027254 | |||
| 999 | Ga0495616_0035105 | |||
| 1000 | Ga0495616_0042924 | |||
| 1001 | Ga0495616_0069717 | |||
| 1002 | Ga0495620_0003521 | |||
| 1003 | Ga0495631_0001599 | |||
| 1004 | Ga0495631_0003271 | |||
| 1005 | Ga0495631_0003612 | |||
| 1006 | Ga0495631_0005077 | |||
| 1007 | Ga0495631_0011763 | |||
| 1008 | Ga0495631_0016916 | |||
| 1009 | Ga0495631_0020434 | |||
| 1010 | Ga0495631_0023449 | |||
| 1011 | Ga0495631_0024919 | |||
| 1012 | Ga0495631_0028657 | |||
| 1013 | Ga0495632_0000252 | |||
| 1014 | Ga0495632_0000327 | |||
| 1015 | Ga0495632_0000441 | |||
| 1016 | Ga0495632_0000551 | |||
| 1017 | Ga0495632_0003471 | |||
| 1018 | Ga0495637_0000003 | |||
| 1019 | Ga0495637_0000678 | |||
| 1020 | Ga0495637_0001262 | |||
| 1021 | Ga0495637_0007532 | |||
| 1022 | Ga0495643_0000082 | |||
| 1023 | Ga0495643_0000160 | |||
| 1024 | Ga0495643_0001457 | |||
| 1025 | Ga0495643_0002059 | |||
| 1026 | Ga0495643_0006996 | |||
| 1027 | Ga0495643_0009136 | |||
| 1028 | Ga0495643_0037120 | |||
| 1029 | Ga0495644_0004547 | |||
| 1030 | Ga0495644_0004840 | |||
| 1031 | Ga0495644_0022203 | |||
| 1032 | Ga0495648_0000019 | |||
| 1033 | Ga0495648_0000052 | |||
| 1034 | Ga0495648_0000432 | |||
| 1035 | Ga0495648_0005052 | |||
| 1036 | Ga0495648_0007994 | |||
| 1037 | Ga0495648_0010938 | |||
| 1038 | Ga0495648_0022403 | |||
| 1039 | Ga0495648_0029745 | |||
| 1040 | Ga0495648_0052141 | |||
| 1041 | Ga0495648_0059795 | |||
| 1042 | Ga0495648_0068530 | |||
| 1043 | Ga0495648_0095589 | |||
| 1044 | Ga0495663_0007301 | |||
| 1045 | Ga0495666_0001189 | |||
| 1046 | Ga0495642_0000222 | |||
| 1047 | Ga0495642_0000806 | |||
| 1048 | Ga0495642_0002620 | |||
| 1049 | Ga0495642_0003287 | |||
| 1050 | Ga0495642_0005268 | |||
| 1051 | Ga0495642_0008365 | |||
| 1052 | Ga0495642_0009696 | |||
| 1053 | Ga0495642_0012401 | |||
| 1054 | Ga0495642_0019025 | |||
| 1055 | Ga0495642_0039396 | |||
| 1056 | Ga0495654_0000014 | |||
| 1057 | Ga0495654_0008245 | |||
| 1058 | Ga0495654_0009189 | |||
| 1059 | Ga0495654_0019229 | |||
| 1060 | Ga0495654_0021923 | |||
| 1061 | Ga0495654_0026379 | |||
| 1062 | Ga0495640_0114709 | |||
| 1063 | Ga0495586_0000782 | |||
| 1064 | Ga0495586_0048141 | |||
| 1065 | Ga0495586_0135073 | |||
| 1066 | Ga0495587_0079911 | |||
| 1067 | Ga0495609_0000038 | |||
| 1068 | Ga0495609_0000859 | |||
| 1069 | Ga0495609_0003202 | |||
| 1070 | Ga0495609_0003922 | |||
| 1071 | Ga0495609_0005917 | |||
| 1072 | Ga0495609_0012286 | |||
| 1073 | Ga0495609_0027987 | |||
| 1074 | Ga0495609_0028526 | |||
| 1075 | Ga0495609_0033675 | |||
| 1076 | Ga0495609_0033857 | |||
| 1077 | Ga0495597_0000133 | |||
| 1078 | Ga0495597_0000180 | |||
| 1079 | Ga0495597_0000364 | |||
| 1080 | Ga0495597_0001403 | |||
| 1081 | Ga0495597_0004349 | |||
| 1082 | Ga0495597_0006422 | |||
| 1083 | Ga0495597_0010187 | |||
| 1084 | Ga0495597_0019169 | |||
| 1085 | Ga0495597_0023939 | |||
| 1086 | Ga0495597_0033505 | |||
| 1087 | Ga0495597_0075319 | |||
| 1088 | Ga0495645_0025263 | |||
| 1089 | Ga0495622_0000034 | |||
| 1090 | Ga0495622_0000071 | |||
| 1091 | Ga0495622_0059996 | |||
| 1092 | Ga0495633_0000077 | |||
| 1093 | Ga0495633_0000100 | |||
| 1094 | Ga0495633_0002802 | |||
| 1095 | Ga0495633_0005027 | |||
| 1096 | Ga0495633_0016281 | |||
| 1097 | Ga0495633_0019341 | |||
| 1098 | Ga0495633_0021784 | |||
| 1099 | Ga0495633_0038059 | |||
| 1100 | Ga0495633_0069201 | |||
| 1101 | Ga0495633_0077110 | |||
| 1102 | Ga0495656_0006136 | |||
| 1103 | Ga0495656_0016846 | |||
| 1104 | Ga0495668_0000231 | |||
| 1105 | Ga0495668_0000308 | |||
| 1106 | Ga0495668_0000351 | |||
| 1107 | Ga0495668_0000602 | |||
| 1108 | Ga0495668_0003350 | |||
| 1109 | Ga0495668_0005511 | |||
| 1110 | Ga0495668_0006404 | |||
| 1111 | Ga0495668_0006574 | |||
| 1112 | Ga0495668_0015046 | |||
| 1113 | Ga0495668_0027407 | |||
| 1114 | Ga0495668_0049578 | |||
| 1115 | Ga0495668_0138233 | |||
| 1116 | Ga0495668_0205067 | |||
| 1117 | Ga0495634_0005407 | |||
| 1118 | Ga0495611_0001042 | |||
| 1119 | Ga0495611_0003262 | |||
| 1120 | Ga0495611_0004561 | |||
| 1121 | Ga0495611_0010182 | |||
| 1122 | Ga0495611_0017046 | |||
| 1123 | Ga0495625_0001017 | |||
| 1124 | Ga0495625_0001111 | |||
| 1125 | Ga0495625_0022022 | |||
| 1126 | Ga0495625_0027562 | |||
| 1127 | Ga0495625_0035300 | |||
| 1128 | Ga0495625_0085834 | |||
| 1129 | Ga0495625_0111825 | |||
| 1130 | Ga0495625_0125603 | |||
| 1131 | Ga0495635_0003980 | |||
| 1132 | Ga0495659_0000049 | |||
| 1133 | Ga0495659_0001305 | |||
| 1134 | Ga0495661_0000070 | |||
| 1135 | Ga0495661_0001176 | |||
| 1136 | Ga0495661_0001533 | |||
| 1137 | Ga0495661_0002205 | |||
| 1138 | Ga0495661_0004687 | |||
| 1139 | Ga0495661_0007175 | |||
| 1140 | Ga0495661_0009106 | |||
| 1141 | Ga0495661_0010600 | |||
| 1142 | Ga0495661_0066721 | |||
| 1143 | Ga0495661_0072029 | |||
| 1144 | Ga0495661_0088034 | |||
| 1145 | Ga0495661_0110869 | |||
| 1146 | Ga0495588_0000156 | |||
| 1147 | Ga0495588_0024390 | |||
| 1148 | Ga0495588_0038944 | |||
| 1149 | Ga0495588_0064882 | |||
| 1150 | Ga0495588_0103023 | |||
| 1151 | Ga0495623_0026050 | |||
| 1152 | Ga0495623_0032004 | |||
| 1153 | Ga0495623_0038351 | |||
| 1154 | Ga0495669_0000032 | |||
| 1155 | Ga0495669_0000481 | |||
| 1156 | Ga0495669_0000840 | |||
| 1157 | Ga0495669_0008174 | |||
| 1158 | Ga0495613_0010463 | |||
| 1159 | Ga0495670_0000144 | |||
| 1160 | Ga0495670_0000401 | |||
| 1161 | Ga0495670_0012352 | |||
| 1162 | Ga0495670_0041706 | |||
| 1163 | Ga0495671_0000005 | |||
| 1164 | Ga0495671_0003630 | |||
| 1165 | Ga0495671_0004998 | |||
| 1166 | Ga0495671_0006502 | |||
| 1167 | Ga0495671_0009288 | |||
| 1168 | Ga0495671_0016893 | |||
| 1169 | Ga0495671_0032263 | |||
| 1170 | Ga0495671_0036522 | |||
| 1171 | Ga0495671_0042367 | |||
| 1172 | Ga0495649_0002755 | |||
| 1173 | Ga0495649_0007541 | |||
| 1174 | Ga0495649_0034473 | |||
| 1175 | Ga0495649_0063857 | |||
| 1176 | Ga0495589_0000074 | |||
| 1177 | Ga0495589_0000099 | |||
| 1178 | Ga0495589_0002047 | |||
| 1179 | Ga0495589_0030324 | |||
| 1180 | Ga0495589_0031465 | |||
| 1181 | Ga0495589_0072921 | |||
| 1182 | Ga0495660_0000047 | |||
| 1183 | Ga0495660_0000203 | |||
| 1184 | Ga0495660_0000514 | |||
| 1185 | Ga0495660_0008423 | |||
| 1186 | Ga0495660_0012375 | |||
| 1187 | Ga0495660_0015362 | |||
| 1188 | Ga0495660_0017313 | |||
| 1189 | Ga0495660_0030318 | |||
| 1190 | Ga0495581_0015728 | |||
| 1191 | Ga0495581_0040472 | |||
| 1192 | Ga0495604_0008261 | |||
| 1193 | Ga0495604_0030254 | |||
| 1194 | Ga0495604_0041736 | |||
| 1195 | Ga0495604_0077162 | |||
| 1196 | Ga0495636_0001566 | |||
| 1197 | Ga0495636_0005882 | |||
| 1198 | Ga0495672_0000026 | |||
| 1199 | Ga0495672_0000081 | |||
| 1200 | Ga0495672_0000256 | |||
| 1201 | Ga0495672_0000356 | |||
| 1202 | Ga0495672_0004203 | |||
| 1203 | Ga0495672_0043469 | |||
| 1204 | Ga0495676_0000031 | |||
| 1205 | Ga0495676_0028182 | |||
| 1206 | Ga0495676_0048092 | |||
| 1207 | Ga0495676_0242667 | |||
| 1208 | Ga0495680_0004349 | |||
| 1209 | Ga0495683_0000260 | |||
| 1210 | Ga0495683_0000309 | |||
| 1211 | Ga0495683_0003892 | |||
| 1212 | Ga0495683_0008632 | |||
| 1213 | Ga0495683_0017674 | |||
| 1214 | Ga0495683_0033214 | |||
| 1215 | Ga0495683_0038036 | |||
| 1216 | Ga0495683_0038535 | |||
| 1217 | Ga0495683_0052221 | |||
| 1218 | Ga0495687_000071 | |||
| 1219 | Ga0495687_000238 | |||
| 1220 | Ga0495687_000448 | |||
| 1221 | Ga0495687_001351 | |||
| 1222 | Ga0495687_002105 | |||
| 1223 | Ga0495687_008516 | |||
| 1224 | Ga0495687_013290 | |||
| 1225 | Ga0495675_0006032 | |||
| 1226 | Ga0495675_0018492 | |||
| 1227 | Ga0495677_0000016 | |||
| 1228 | Ga0495677_0000325 | |||
| 1229 | Ga0495677_0000856 | |||
| 1230 | Ga0495677_0006131 | |||
| 1231 | Ga0495677_0009183 | |||
| 1232 | Ga0495677_0011737 | |||
| 1233 | Ga0495677_0021452 | |||
| 1234 | Ga0495677_0024290 | |||
| 1235 | Ga0495677_0031625 | |||
| 1236 | Ga0495677_0035213 | |||
| 1237 | Ga0495677_0037882 | |||
| 1238 | Ga0495679_004505 | |||
| 1239 | Ga0495679_007538 | |||
| 1240 | Ga0495685_001651 | |||
| 1241 | Ga0495685_035787 | |||
| 1242 | Ga0495673_0000008 | |||
| 1243 | Ga0495673_0000009 | |||
| 1244 | Ga0495673_0000012 | |||
| 1245 | Ga0495673_0007005 | |||
| 1246 | Ga0495681_0003255 | |||
| 1247 | Ga0495681_0004599 | |||
| 1248 | Ga0495681_0006400 | |||
| 1249 | Ga0495681_0009064 | |||
| 1250 | Ga0495681_0014874 | |||
| 1251 | Ga0495681_0018026 | |||
| 1252 | Ga0495681_0026590 | |||
| 1253 | Ga0495681_0047094 | |||
| 1254 | Ga0495681_0048196 | |||
| 1255 | Ga0495681_0076073 | |||
| 1256 | Ga0495686_0000114 | |||
| 1257 | Ga0495686_0000130 | |||
| 1258 | Ga0495686_0005614 | |||
| 1259 | Ga0495686_0015414 | |||
| 1260 | Ga0495686_0077087 | |||
| 1261 | Ga0495593_0001916 | |||
| 1262 | Ga0495593_0106699 | |||
| 1263 | Ga0495602_0032162 | |||
| 1264 | Ga0495614_0002030 | |||
| 1265 | Ga0495614_0007966 | |||
| 1266 | Ga0495615_0016509 | |||
| 1267 | Ga0495626_0000042 | |||
| 1268 | Ga0495626_0000543 | |||
| 1269 | Ga0495626_0001457 | |||
| 1270 | Ga0495626_0006386 | |||
| 1271 | Ga0495626_0007234 | |||
| 1272 | Ga0495626_0017945 | |||
| 1273 | Ga0495626_0036624 | |||
| 1274 | Ga0496100_0015159 | |||
| 1275 | Ga0496101_0171628 | |||
| 1276 | Ga0496102_0000338 | |||
| 1277 | Ga0496102_0035158 | |||
| 1278 | Ga0496103_0020193 | |||
| 1279 | Ga0496105_0082530 | |||
| 1280 | Ga0496106_0010626 | |||
| 1281 | Ga0496107_0063262 | |||
| 1282 | Ga0496107_0090037 | |||
| 1283 | Ga0496107_0120373 | |||
| 1284 | Ga0496108_0265402 | |||
| 1285 | Ga0496110_0000005 | |||
| 1286 | Ga0496110_0038156 | |||
| 1287 | Ga0496110_0269304 | |||
| 1288 | Ga0496111_0040056 | |||
| 1289 | Ga0496111_0132177 | |||
| 1290 | Ga0496113_0010035 | |||
| 1291 | Ga0496116_0014961 | |||
| 1292 | Ga0496121_0015595 | |||
| 1293 | Ga0496121_0054530 | |||
| 1294 | Ga0496122_0000482 | |||
| 1295 | Ga0496122_0015889 | |||
| 1296 | Ga0496122_0017057 | |||
| 1297 | Ga0496123_0000662 | |||
| 1298 | Ga0496123_0002188 | |||
| 1299 | Ga0496123_0005907 | |||
| 1300 | Ga0496123_0077877 | |||
| 1301 | Ga0496124_0028622 | |||
| 1302 | Ga0496124_0042266 | |||
| 1303 | Ga0496124_0065299 | |||
| 1304 | Ga0496124_0112271 | |||
| 1305 | Ga0496125_0008226 | |||
| 1306 | Ga0496126_0010059 | |||
| 1307 | Ga0495678_000027 | |||
| 1308 | Ga0495678_000074 | |||
| 1309 | Ga0495678_001024 | |||
| 1310 | Ga0495678_004034 | |||
| 1311 | Ga0495678_005941 | |||
| 1312 | Ga0495678_048157 | |||
| 1313 | Ga0495678_063428 | |||
| 1314 | Ga0495682_0000611 | |||
| 1315 | Ga0501230_003092 | |||
| 1316 | Ga0501235_035744 | |||
| 1317 | Ga0501269_000005 | |||
| 1318 | Ga0501279_002472 | |||
| 1319 | Ga0501035_0012712 | |||
| 1320 | Ga0495619_0092193 | |||
| 1321 | Ga0500618_000752 | |||
| 1322 | Ga0500586_000124 | |||
| 1323 | 2548849007 | |||
| 1324 | 2643800981 | |||
| 1325 | 2644250496 | |||
| 1326 | 2644358817 | |||
| 1327 | 2644471347 | |||
| 1328 | 2738738727 | |||
| 1329 | 2738826174 | |||
| 1330 | 2738842454 | |||
| 1331 | 2739149971 | |||
| 1332 | 2739191890 | |||
| 1333 | 2739273201 | |||
| 1334 | 2739318367 | |||
| 1335 | 2739336608 | |||
| 1336 | 2739342245 | |||
| 1337 | 2821135021 | |||
| 1338 | 2842715888 | |||
| 1339 | 2857558009 | |||
| 1340 | 2857558726 | |||
| 1341 | 2857569606 | |||
| 1342 | 2904428394 | |||
| 1343 | 2919476386 | |||
| 1344 | 8047674697 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nb6-assembly1.cif.gz_A | structure of the autoinducer-2 exporter tqsa from e. coli | 0.6925 | 13 | 356 |
| 7nb6-assembly1.cif.gz_A | structure of the autoinducer-2 exporter tqsa from e. coli | 0.6576 | 13 | 356 |
| 7dfe-assembly1.cif.gz_B | nmr structure of tusp2-rp | 0.3144 | 188 | 308 |
| 7dfe-assembly1.cif.gz_B | nmr structure of tusp2-rp | 0.2799 | 188 | 308 |
| 7z14-assembly1.cif.gz_A | cryo-em structure of torpedo nicotinic acetylcholine receptor in complex with a short-chain neurotoxin. | 0.2665 | 211 | 349 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0C3_21_158_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.5846 | 212 | 318 | 1.10.1760.20 |
| af_Q2G0C3_21_158_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.4578 | 212 | 318 | 1.10.1760.20 |
| af_A0A0B4LG94_465_794_1.20.1110.10 | Mainly Alpha;Up-down Bundle;Calcium-transporting ATPase, transmembrane domain;Calcium-transporting ATPase, transmembrane domain | 0.3175 | 238 | 356 | 1.20.1110.10 |
| af_Q10E40_4_147_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.2945 | 207 | 304 | 1.20.120.550 |
| af_Q4CLS6_2_157_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.2726 | 217 | 355 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A238Y2M7-F1-model_v4 | Predicted PurR-regulated permease PerM | 0.8291 | 11 | 375 |
GO:0016020
|
| AF-A0A1A9T1I6-F1-model_v4 | AI-2E family transporter | 0.8261 | 11 | 373 |
GO:0016020
|
| AF-A0A1A8Y126-F1-model_v4 | Putative permease | 0.8148 | 5 | 375 |
GO:0005886
|
| AF-A0A2N9NWC5-F1-model_v4 | AI-2E family transporter | 0.8115 | 13 | 371 |
GO:0016020
|
| AF-A0A4Q2J6Y1-F1-model_v4 | AI-2E family transporter | 0.8093 | 1 | 373 |
GO:0016020
|