F474223
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 672 | 308 | 1344 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300006847|Ga0075431_100665265|Ga0075431_1006652651 |
| Length | 307 |
| Sequence | MPTTHGVCGDRNAPSFSTSAWPGWRRFGRDRCHTAAALLDLQSHSIYSDGELTPAGVVAAAADAGVTTLALTDHDAVTGIEEAAYAAEQHGLTLVPAAEISCVHDQLDDLHMLGYWIDPKALAPACERAQQERVTRAEEIVGKLNSLGVEVSFEDAIAQAGDASSVGRPHIAKAAGTKPEQMSAFFEEYLVPGAKAFVSRRWPTAAEAIDLIRGAGGVPVLAHPFWDLDDPKAVAALIDDLAIDGVEVFYPAHDHDQTKFLVDLCAERGLTATGSSDFHGPNHKQFNRFGSYPTYDFGEPELPRKPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 165 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 171 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 175 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 176 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 177 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 178 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 181 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 184 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 185 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 186 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 249 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 250 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 251 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 252 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 255 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 256 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 290 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 304 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 305 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 306 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 307 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.02 |
| Nodule | 0 |
| Rhizoplane | 9.52 |
| Rhizosphere | 84.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075431_100665265 | 3300006847 | Bacteria | 1021 |
| 2 | JGI24746J21847_1000617 | 3300001977 | Bacteria | 5421 |
| 3 | JGI24740J21852_10005220 | 3300001979 | Bacteria | 5515 |
| 4 | JGI24735J21928_10042010 | 3300002067 | Bacteria | 1332 |
| 5 | JGI24748J21848_1000223 | 3300002074 | Bacteria | 6959 |
| 6 | JGI24742J22300_10001281 | 3300002244 | Bacteria | 3946 |
| 7 | JGI25404J52841_10000203 | 3300003659 | Bacteria | 7129 |
| 8 | Ga0070658_10071798 | 3300005327 | Bacteria | 2836 |
| 9 | Ga0070683_100000481 | 3300005329 | Bacteria | 28092 |
| 10 | Ga0070683_100001210 | 3300005329 | Bacteria | 19627 |
| 11 | Ga0070683_100011934 | 3300005329 | Bacteria | 7534 |
| 12 | Ga0070683_100036323 | 3300005329 | Bacteria | 4508 |
| 13 | Ga0070683_100139733 | 3300005329 | Bacteria | 2294 |
| 14 | Ga0070670_100049915 | 3300005331 | Bacteria | 3597 |
| 15 | Ga0070670_100079304 | 3300005331 | Bacteria | 2822 |
| 16 | Ga0070677_10000396 | 3300005333 | Bacteria | 15177 |
| 17 | Ga0070666_10088224 | 3300005335 | Bacteria | 2128 |
| 18 | Ga0070680_100144869 | 3300005336 | Bacteria | 1993 |
| 19 | Ga0070682_100000057 | 3300005337 | Bacteria | 108832 |
| 20 | Ga0070682_100000629 | 3300005337 | Bacteria | 21403 |
| 21 | Ga0070682_100004924 | 3300005337 | Bacteria | 7414 |
| 22 | Ga0070682_100049978 | 3300005337 | Bacteria | 2609 |
| 23 | Ga0068868_100000008 | 3300005338 | Bacteria | 121926 |
| 24 | Ga0068868_100083335 | 3300005338 | Bacteria | 2567 |
| 25 | Ga0070689_100084749 | 3300005340 | Bacteria | 2491 |
| 26 | Ga0070691_10000010 | 3300005341 | Bacteria | 58327 |
| 27 | Ga0070691_10000175 | 3300005341 | Bacteria | 20958 |
| 28 | Ga0070691_10115987 | 3300005341 | Bacteria | 1344 |
| 29 | Ga0070661_100000365 | 3300005344 | Bacteria | 35698 |
| 30 | Ga0070661_100041945 | 3300005344 | Bacteria | 3339 |
| 31 | Ga0070661_100371855 | 3300005344 | Unclassified | 1125 |
| 32 | Ga0070692_10049295 | 3300005345 | Bacteria | 2184 |
| 33 | Ga0070668_100006745 | 3300005347 | Bacteria | 8507 |
| 34 | Ga0070668_100048845 | 3300005347 | Bacteria | 3255 |
| 35 | Ga0070668_100366971 | 3300005347 | Bacteria | 1222 |
| 36 | Ga0070675_100002793 | 3300005354 | Bacteria | 13150 |
| 37 | Ga0070675_100315950 | 3300005354 | Bacteria | 1379 |
| 38 | Ga0070674_100000003 | 3300005356 | Bacteria | 258221 |
| 39 | Ga0070674_100000016 | 3300005356 | Bacteria | 91058 |
| 40 | Ga0070674_100047945 | 3300005356 | Bacteria | 2930 |
| 41 | Ga0070674_100054728 | 3300005356 | Bacteria | 2761 |
| 42 | Ga0070674_100176930 | 3300005356 | Bacteria | 1631 |
| 43 | Ga0070673_100068006 | 3300005364 | Bacteria | 2851 |
| 44 | Ga0070688_100001580 | 3300005365 | Bacteria | 11373 |
| 45 | Ga0070688_100009726 | 3300005365 | Bacteria | 5277 |
| 46 | Ga0070688_100016010 | 3300005365 | Bacteria | 4278 |
| 47 | Ga0070688_100018164 | 3300005365 | Bacteria | 4053 |
| 48 | Ga0070659_100008696 | 3300005366 | Bacteria | 7426 |
| 49 | Ga0070659_100014138 | 3300005366 | Bacteria | 5956 |
| 50 | Ga0070659_100019608 | 3300005366 | Bacteria | 5129 |
| 51 | Ga0070667_100002889 | 3300005367 | Bacteria | 14766 |
| 52 | Ga0070667_100229586 | 3300005367 | Bacteria | 1654 |
| 53 | Ga0070714_100031777 | 3300005435 | Bacteria | 4407 |
| 54 | Ga0070713_100000055 | 3300005436 | Bacteria | 70759 |
| 55 | Ga0070710_10047102 | 3300005437 | Bacteria | 2404 |
| 56 | Ga0070710_10211997 | 3300005437 | Unclassified | 1228 |
| 57 | Ga0070711_100004268 | 3300005439 | Bacteria | 8407 |
| 58 | Ga0070700_100019287 | 3300005441 | Bacteria | 3933 |
| 59 | Ga0070700_100099501 | 3300005441 | Bacteria | 1913 |
| 60 | Ga0070663_100001559 | 3300005455 | Bacteria | 12623 |
| 61 | Ga0070663_100002524 | 3300005455 | Bacteria | 10336 |
| 62 | Ga0070678_100021199 | 3300005456 | Bacteria | 4280 |
| 63 | Ga0070662_100000039 | 3300005457 | Bacteria | 74491 |
| 64 | Ga0070662_100036309 | 3300005457 | Bacteria | 3485 |
| 65 | Ga0070681_10008875 | 3300005458 | Bacteria | 9879 |
| 66 | Ga0070681_10268959 | 3300005458 | Bacteria | 1616 |
| 67 | Ga0068867_100027246 | 3300005459 | Bacteria | 4106 |
| 68 | Ga0068867_100027776 | 3300005459 | Bacteria | 4070 |
| 69 | Ga0070685_10000545 | 3300005466 | Bacteria | 21142 |
| 70 | Ga0070685_10006443 | 3300005466 | Bacteria | 5987 |
| 71 | Ga0070685_10062191 | 3300005466 | Bacteria | 2189 |
| 72 | Ga0070679_100004239 | 3300005530 | Bacteria | 13233 |
| 73 | Ga0070679_100007525 | 3300005530 | Bacteria | 10187 |
| 74 | Ga0070684_100020721 | 3300005535 | Bacteria | 5454 |
| 75 | Ga0070684_100023080 | 3300005535 | Bacteria | 5196 |
| 76 | Ga0070684_100027962 | 3300005535 | Bacteria | 4766 |
| 77 | Ga0070684_100079875 | 3300005535 | Bacteria | 2893 |
| 78 | Ga0070684_100085793 | 3300005535 | Bacteria | 2792 |
| 79 | Ga0068853_100045486 | 3300005539 | Bacteria | 3760 |
| 80 | Ga0068853_100081011 | 3300005539 | Bacteria | 2842 |
| 81 | Ga0068853_100198726 | 3300005539 | Bacteria | 1824 |
| 82 | Ga0070672_100000057 | 3300005543 | Bacteria | 50189 |
| 83 | Ga0070672_100005836 | 3300005543 | Bacteria | 8213 |
| 84 | Ga0070686_100044154 | 3300005544 | Bacteria | 2799 |
| 85 | Ga0070686_100107235 | 3300005544 | Bacteria | 1897 |
| 86 | Ga0070693_100001114 | 3300005547 | Bacteria | 12060 |
| 87 | Ga0070693_100203879 | 3300005547 | Bacteria | 1286 |
| 88 | Ga0070665_100000128 | 3300005548 | Bacteria | 142568 |
| 89 | Ga0070665_100019618 | 3300005548 | Bacteria | 6787 |
| 90 | Ga0070665_100049511 | 3300005548 | Bacteria | 4215 |
| 91 | Ga0070665_100160313 | 3300005548 | Bacteria | 2251 |
| 92 | Ga0070704_100280022 | 3300005549 | Bacteria | 1381 |
| 93 | Ga0068855_100170569 | 3300005563 | Bacteria | 2465 |
| 94 | Ga0070664_100016179 | 3300005564 | Bacteria | 6112 |
| 95 | Ga0070664_100022744 | 3300005564 | Bacteria | 5170 |
| 96 | Ga0068857_100264891 | 3300005577 | Bacteria | 1578 |
| 97 | Ga0068857_100676254 | 3300005577 | Bacteria | 979 |
| 98 | Ga0068854_100000525 | 3300005578 | Bacteria | 23234 |
| 99 | Ga0068856_100000057 | 3300005614 | Bacteria | 102045 |
| 100 | Ga0068856_100006604 | 3300005614 | Bacteria | 11368 |
| 101 | Ga0068856_100016805 | 3300005614 | Bacteria | 7090 |
| 102 | Ga0068856_100265616 | 3300005614 | Bacteria | 1732 |
| 103 | Ga0070702_100037764 | 3300005615 | Bacteria | 2684 |
| 104 | Ga0068852_100000007 | 3300005616 | Bacteria | 158670 |
| 105 | Ga0068852_100023801 | 3300005616 | Bacteria | 4937 |
| 106 | Ga0068859_100036381 | 3300005617 | Bacteria | 4943 |
| 107 | Ga0068864_100000035 | 3300005618 | Bacteria | 195218 |
| 108 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 109 | Ga0068866_10000148 | 3300005718 | Bacteria | 31770 |
| 110 | Ga0068866_10021772 | 3300005718 | Bacteria | 2957 |
| 111 | Ga0068861_100082457 | 3300005719 | Bacteria | 2520 |
| 112 | Ga0068851_10003763 | 3300005834 | Bacteria | 6784 |
| 113 | Ga0068851_10020414 | 3300005834 | Bacteria | 3209 |
| 114 | Ga0068851_10024605 | 3300005834 | Bacteria | 2949 |
| 115 | Ga0068863_100000415 | 3300005841 | Bacteria | 43505 |
| 116 | Ga0068863_100002803 | 3300005841 | Bacteria | 17275 |
| 117 | Ga0068863_100190462 | 3300005841 | Bacteria | 1971 |
| 118 | Ga0068858_100000218 | 3300005842 | Bacteria | 61860 |
| 119 | Ga0068858_100001041 | 3300005842 | Bacteria | 28635 |
| 120 | Ga0068858_100158049 | 3300005842 | Bacteria | 2134 |
| 121 | Ga0068858_100160275 | 3300005842 | Bacteria | 2118 |
| 122 | Ga0068858_100219619 | 3300005842 | Bacteria | 1800 |
| 123 | Ga0068860_100009932 | 3300005843 | Bacteria | 9432 |
| 124 | Ga0068860_100101220 | 3300005843 | Bacteria | 2749 |
| 125 | Ga0068862_100000391 | 3300005844 | Bacteria | 47191 |
| 126 | Ga0081455_10013769 | 3300005937 | Bacteria | 7960 |
| 127 | Ga0081455_10018091 | 3300005937 | Bacteria | 6728 |
| 128 | Ga0081455_10057768 | 3300005937 | Bacteria | 3287 |
| 129 | Ga0081455_10156075 | 3300005937 | Bacteria | 1754 |
| 130 | Ga0081455_10211351 | 3300005937 | Bacteria | 1445 |
| 131 | Ga0081538_10000296 | 3300005981 | Bacteria | 57287 |
| 132 | Ga0081538_10012468 | 3300005981 | Bacteria | 6812 |
| 133 | Ga0081538_10018156 | 3300005981 | Bacteria | 5300 |
| 134 | Ga0081540_1005483 | 3300005983 | Bacteria | 9466 |
| 135 | Ga0081539_10002725 | 3300005985 | Bacteria | 23894 |
| 136 | Ga0081539_10016707 | 3300005985 | Bacteria | 5214 |
| 137 | Ga0075365_10002481 | 3300006038 | Bacteria | 9066 |
| 138 | Ga0075365_10003158 | 3300006038 | Bacteria | 8407 |
| 139 | Ga0075365_10035347 | 3300006038 | Bacteria | 3232 |
| 140 | Ga0075365_10046303 | 3300006038 | Bacteria | 2856 |
| 141 | Ga0075365_10203771 | 3300006038 | Bacteria | 1386 |
| 142 | Ga0075365_10360597 | 3300006038 | Bacteria | 1025 |
| 143 | Ga0075368_10041580 | 3300006042 | Bacteria | 1806 |
| 144 | Ga0075363_100026884 | 3300006048 | Bacteria | 2947 |
| 145 | Ga0075363_100053188 | 3300006048 | Bacteria | 2163 |
| 146 | Ga0075364_10017607 | 3300006051 | Bacteria | 4468 |
| 147 | Ga0075364_10141275 | 3300006051 | Bacteria | 1620 |
| 148 | Ga0075364_10240656 | 3300006051 | Bacteria | 1229 |
| 149 | Ga0070715_10000003 | 3300006163 | Bacteria | 345282 |
| 150 | Ga0070715_10033497 | 3300006163 | Bacteria | 2100 |
| 151 | Ga0070712_100002058 | 3300006175 | Bacteria | 12320 |
| 152 | Ga0070712_100009870 | 3300006175 | Bacteria | 6017 |
| 153 | Ga0097621_100550548 | 3300006237 | Bacteria | 1050 |
| 154 | Ga0075428_100294506 | 3300006844 | Bacteria | 1745 |
| 155 | Ga0075430_100038867 | 3300006846 | Bacteria | 4030 |
| 156 | Ga0075431_100031537 | 3300006847 | Bacteria | 5459 |
| 157 | Ga0075431_100073391 | 3300006847 | Bacteria | 3530 |
| 158 | Ga0075433_10001496 | 3300006852 | Bacteria | 17263 |
| 159 | Ga0075433_10002936 | 3300006852 | Bacteria | 13084 |
| 160 | Ga0075434_100010015 | 3300006871 | Bacteria | 8872 |
| 161 | Ga0075434_100164213 | 3300006871 | Bacteria | 2240 |
| 162 | Ga0075434_100404488 | 3300006871 | Bacteria | 1386 |
| 163 | Ga0068865_100000009 | 3300006881 | Bacteria | 168291 |
| 164 | Ga0068865_100061472 | 3300006881 | Bacteria | 2633 |
| 165 | Ga0097620_100036381 | 3300006931 | Bacteria | 4943 |
| 166 | Ga0111539_10004463 | 3300009094 | Bacteria | 18297 |
| 167 | Ga0111539_10333572 | 3300009094 | Bacteria | 1765 |
| 168 | Ga0105245_10000012 | 3300009098 | Bacteria | 267151 |
| 169 | Ga0105245_10000077 | 3300009098 | Bacteria | 101470 |
| 170 | Ga0105245_10001697 | 3300009098 | Bacteria | 20040 |
| 171 | Ga0105245_10004922 | 3300009098 | Bacteria | 11751 |
| 172 | Ga0105245_10004991 | 3300009098 | Bacteria | 11664 |
| 173 | Ga0105245_10010946 | 3300009098 | Bacteria | 7892 |
| 174 | Ga0105245_10369980 | 3300009098 | Bacteria | 1425 |
| 175 | Ga0105245_10478094 | 3300009098 | Bacteria | 1259 |
| 176 | Ga0105247_10000208 | 3300009101 | Bacteria | 56889 |
| 177 | Ga0105247_10178977 | 3300009101 | Bacteria | 1414 |
| 178 | Ga0114129_10074895 | 3300009147 | Bacteria | 4714 |
| 179 | Ga0114129_10077098 | 3300009147 | Bacteria | 4638 |
| 180 | Ga0114129_10111505 | 3300009147 | Bacteria | 3774 |
| 181 | Ga0114129_10133836 | 3300009147 | Bacteria | 3403 |
| 182 | Ga0114129_10402259 | 3300009147 | Bacteria | 1804 |
| 183 | Ga0105243_10014256 | 3300009148 | Bacteria | 6014 |
| 184 | Ga0105243_10256466 | 3300009148 | Bacteria | 1564 |
| 185 | Ga0105243_10261873 | 3300009148 | Bacteria | 1549 |
| 186 | Ga0105243_10350897 | 3300009148 | Bacteria | 1355 |
| 187 | Ga0105241_10324451 | 3300009174 | Bacteria | 1329 |
| 188 | Ga0105242_10000010 | 3300009176 | Bacteria | 151649 |
| 189 | Ga0105242_10001414 | 3300009176 | Bacteria | 18911 |
| 190 | Ga0105242_10058034 | 3300009176 | Bacteria | 3171 |
| 191 | Ga0105242_10059547 | 3300009176 | Bacteria | 3133 |
| 192 | Ga0105242_10075784 | 3300009176 | Bacteria | 2802 |
| 193 | Ga0105242_10095441 | 3300009176 | Bacteria | 2510 |
| 194 | Ga0105248_10000022 | 3300009177 | Bacteria | 275935 |
| 195 | Ga0105248_10087690 | 3300009177 | Bacteria | 3502 |
| 196 | Ga0105248_10687813 | 3300009177 | Bacteria | 1154 |
| 197 | Ga0105237_10052868 | 3300009545 | Bacteria | 4076 |
| 198 | Ga0105238_10000321 | 3300009551 | Bacteria | 52176 |
| 199 | Ga0105238_10213592 | 3300009551 | Bacteria | 1906 |
| 200 | Ga0105249_10000192 | 3300009553 | Bacteria | 69997 |
| 201 | Ga0105249_10013993 | 3300009553 | Bacteria | 7092 |
| 202 | Ga0105249_10028741 | 3300009553 | Bacteria | 5018 |
| 203 | Ga0105249_10135836 | 3300009553 | Bacteria | 2353 |
| 204 | Ga0105239_10060776 | 3300010375 | Bacteria | 4147 |
| 205 | Ga0105239_10099990 | 3300010375 | Bacteria | 3207 |
| 206 | Ga0105239_10172723 | 3300010375 | Bacteria | 2417 |
| 207 | Ga0105246_10026116 | 3300011119 | Bacteria | 3811 |
| 208 | Ga0105246_10203728 | 3300011119 | Bacteria | 1540 |
| 209 | Ga0157371_10006260 | 3300013102 | Bacteria | 9857 |
| 210 | Ga0157370_10067067 | 3300013104 | Bacteria | 3392 |
| 211 | Ga0157370_10110965 | 3300013104 | Bacteria | 2564 |
| 212 | Ga0157370_10130342 | 3300013104 | Bacteria | 2346 |
| 213 | Ga0157369_10000118 | 3300013105 | Bacteria | 111618 |
| 214 | Ga0157374_10005906 | 3300013296 | Bacteria | 10339 |
| 215 | Ga0157374_10095055 | 3300013296 | Bacteria | 2849 |
| 216 | Ga0157378_10011673 | 3300013297 | Bacteria | 7688 |
| 217 | Ga0157378_10017504 | 3300013297 | Bacteria | 6291 |
| 218 | Ga0157378_10050602 | 3300013297 | Bacteria | 3697 |
| 219 | Ga0163162_10239225 | 3300013306 | Bacteria | 1946 |
| 220 | Ga0157372_10038776 | 3300013307 | Bacteria | 5258 |
| 221 | Ga0157375_10001092 | 3300013308 | Bacteria | 23513 |
| 222 | Ga0157375_10006876 | 3300013308 | Bacteria | 9922 |
| 223 | Ga0157375_10049665 | 3300013308 | Bacteria | 4112 |
| 224 | Ga0157375_10131926 | 3300013308 | Bacteria | 2618 |
| 225 | Ga0157375_10307148 | 3300013308 | Bacteria | 1750 |
| 226 | Ga0157375_10466337 | 3300013308 | Bacteria | 1428 |
| 227 | Ga0163163_10467912 | 3300014325 | Unclassified | 1321 |
| 228 | Ga0157380_10000249 | 3300014326 | Bacteria | 32409 |
| 229 | Ga0157380_10005261 | 3300014326 | Bacteria | 9044 |
| 230 | Ga0157380_10173269 | 3300014326 | Bacteria | 1888 |
| 231 | Ga0157380_10451726 | 3300014326 | Bacteria | 1234 |
| 232 | Ga0157379_10044400 | 3300014968 | Bacteria | 3967 |
| 233 | Ga0157379_10051072 | 3300014968 | Bacteria | 3693 |
| 234 | Ga0157379_10111567 | 3300014968 | Bacteria | 2456 |
| 235 | Ga0157379_10156977 | 3300014968 | Bacteria | 2053 |
| 236 | Ga0157379_10490546 | 3300014968 | Bacteria | 1138 |
| 237 | Ga0157376_10385504 | 3300014969 | Bacteria | 1351 |
| 238 | Ga0157376_10581355 | 3300014969 | Bacteria | 1112 |
| 239 | Ga0163161_10004856 | 3300017792 | Bacteria | 9358 |
| 240 | Ga0163161_10141320 | 3300017792 | Bacteria | 1823 |
| 241 | Ga0207656_10002454 | 3300025321 | Bacteria | 6253 |
| 242 | Ga0207656_10010149 | 3300025321 | Bacteria | 3516 |
| 243 | Ga0207656_10012896 | 3300025321 | Bacteria | 3184 |
| 244 | Ga0207682_10000380 | 3300025893 | Bacteria | 20492 |
| 245 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 246 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 247 | Ga0207642_10000004 | 3300025899 | Bacteria | 407822 |
| 248 | Ga0207642_10000051 | 3300025899 | Bacteria | 34399 |
| 249 | Ga0207642_10013216 | 3300025899 | Bacteria | 3007 |
| 250 | Ga0207710_10059721 | 3300025900 | Bacteria | 1727 |
| 251 | Ga0207688_10004076 | 3300025901 | Bacteria | 7960 |
| 252 | Ga0207685_10000003 | 3300025905 | Bacteria | 344527 |
| 253 | Ga0207685_10133521 | 3300025905 | Bacteria | 1104 |
| 254 | Ga0207705_10029153 | 3300025909 | Bacteria | 3934 |
| 255 | Ga0207707_10011056 | 3300025912 | Bacteria | 7850 |
| 256 | Ga0207707_10381322 | 3300025912 | Bacteria | 1212 |
| 257 | Ga0207693_10003350 | 3300025915 | Bacteria | 13697 |
| 258 | Ga0207693_10043150 | 3300025915 | Bacteria | 3550 |
| 259 | Ga0207663_10002464 | 3300025916 | Bacteria | 8911 |
| 260 | Ga0207660_10139153 | 3300025917 | Bacteria | 1855 |
| 261 | Ga0207649_10000024 | 3300025920 | Bacteria | 183104 |
| 262 | Ga0207649_10011147 | 3300025920 | Bacteria | 4948 |
| 263 | Ga0207652_10001557 | 3300025921 | Bacteria | 20163 |
| 264 | Ga0207652_10006321 | 3300025921 | Bacteria | 9566 |
| 265 | Ga0207652_10569020 | 3300025921 | Bacteria | 1018 |
| 266 | Ga0207694_10000008 | 3300025924 | Bacteria | 484902 |
| 267 | Ga0207694_10026190 | 3300025924 | Bacteria | 4434 |
| 268 | Ga0207650_10022678 | 3300025925 | Bacteria | 4447 |
| 269 | Ga0207659_10000062 | 3300025926 | Bacteria | 67607 |
| 270 | Ga0207659_10225173 | 3300025926 | Bacteria | 1510 |
| 271 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 272 | Ga0207687_10000012 | 3300025927 | Bacteria | 370729 |
| 273 | Ga0207687_10001579 | 3300025927 | Bacteria | 15685 |
| 274 | Ga0207687_10002910 | 3300025927 | Bacteria | 11615 |
| 275 | Ga0207687_10046298 | 3300025927 | Bacteria | 3011 |
| 276 | Ga0207700_10000009 | 3300025928 | Bacteria | 314953 |
| 277 | Ga0207664_10076341 | 3300025929 | Bacteria | 2712 |
| 278 | Ga0207644_10047351 | 3300025931 | Bacteria | 3068 |
| 279 | Ga0207690_10013252 | 3300025932 | Bacteria | 4950 |
| 280 | Ga0207706_10000026 | 3300025933 | Bacteria | 149379 |
| 281 | Ga0207686_10000271 | 3300025934 | Bacteria | 38452 |
| 282 | Ga0207686_10001505 | 3300025934 | Bacteria | 13123 |
| 283 | Ga0207686_10041038 | 3300025934 | Bacteria | 2819 |
| 284 | Ga0207686_10147082 | 3300025934 | Bacteria | 1636 |
| 285 | Ga0207709_10008821 | 3300025935 | Bacteria | 5561 |
| 286 | Ga0207709_10160164 | 3300025935 | Bacteria | 1569 |
| 287 | Ga0207709_10225073 | 3300025935 | Bacteria | 1355 |
| 288 | Ga0207669_10000023 | 3300025937 | Bacteria | 96638 |
| 289 | Ga0207669_10000064 | 3300025937 | Bacteria | 52977 |
| 290 | Ga0207669_10014220 | 3300025937 | Bacteria | 3984 |
| 291 | Ga0207669_10049282 | 3300025937 | Bacteria | 2509 |
| 292 | Ga0207669_10081452 | 3300025937 | Bacteria | 2074 |
| 293 | Ga0207704_10000004 | 3300025938 | Bacteria | 239295 |
| 294 | Ga0207704_10280715 | 3300025938 | Unclassified | 1266 |
| 295 | Ga0207691_10000642 | 3300025940 | Bacteria | 34532 |
| 296 | Ga0207691_10003031 | 3300025940 | Bacteria | 16392 |
| 297 | Ga0207711_10000019 | 3300025941 | Bacteria | 412779 |
| 298 | Ga0207711_10180171 | 3300025941 | Bacteria | 1921 |
| 299 | Ga0207661_10000166 | 3300025944 | Bacteria | 42698 |
| 300 | Ga0207661_10006101 | 3300025944 | Bacteria | 8513 |
| 301 | Ga0207661_10008277 | 3300025944 | Bacteria | 7430 |
| 302 | Ga0207661_10036097 | 3300025944 | Bacteria | 3856 |
| 303 | Ga0207661_10390934 | 3300025944 | Bacteria | 1260 |
| 304 | Ga0207661_10716266 | 3300025944 | Unclassified | 921 |
| 305 | Ga0207679_10013404 | 3300025945 | Bacteria | 5375 |
| 306 | Ga0207679_10079809 | 3300025945 | Bacteria | 2497 |
| 307 | Ga0207667_10045130 | 3300025949 | Bacteria | 4668 |
| 308 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 309 | Ga0207712_10004857 | 3300025961 | Bacteria | 8497 |
| 310 | Ga0207712_10046712 | 3300025961 | Bacteria | 3003 |
| 311 | Ga0207668_10223300 | 3300025972 | Bacteria | 1514 |
| 312 | Ga0207640_10000059 | 3300025981 | Bacteria | 90901 |
| 313 | Ga0207640_10012280 | 3300025981 | Bacteria | 4874 |
| 314 | Ga0207658_10001012 | 3300025986 | Bacteria | 22933 |
| 315 | Ga0207658_10052890 | 3300025986 | Bacteria | 2998 |
| 316 | Ga0207658_10306500 | 3300025986 | Bacteria | 1370 |
| 317 | Ga0207677_10000142 | 3300026023 | Bacteria | 58625 |
| 318 | Ga0207703_10000028 | 3300026035 | Bacteria | 208682 |
| 319 | Ga0207703_10000153 | 3300026035 | Bacteria | 79352 |
| 320 | Ga0207703_10104092 | 3300026035 | Bacteria | 2411 |
| 321 | Ga0207639_10000298 | 3300026041 | Bacteria | 35257 |
| 322 | Ga0207639_10023840 | 3300026041 | Bacteria | 4422 |
| 323 | Ga0207639_10182319 | 3300026041 | Bacteria | 1787 |
| 324 | Ga0207678_10000683 | 3300026067 | Bacteria | 31055 |
| 325 | Ga0207678_10001490 | 3300026067 | Bacteria | 21462 |
| 326 | Ga0207708_10051241 | 3300026075 | Bacteria | 3142 |
| 327 | Ga0207708_10131430 | 3300026075 | Bacteria | 1957 |
| 328 | Ga0207702_10000027 | 3300026078 | Bacteria | 183792 |
| 329 | Ga0207702_10010473 | 3300026078 | Bacteria | 7755 |
| 330 | Ga0207702_10016462 | 3300026078 | Bacteria | 6120 |
| 331 | Ga0207702_10511061 | 3300026078 | Bacteria | 1172 |
| 332 | Ga0207641_10000072 | 3300026088 | Bacteria | 151067 |
| 333 | Ga0207641_10004111 | 3300026088 | Bacteria | 12684 |
| 334 | Ga0207641_10601707 | 3300026088 | Bacteria | 1076 |
| 335 | Ga0207648_10030144 | 3300026089 | Bacteria | 4808 |
| 336 | Ga0207648_10045418 | 3300026089 | Bacteria | 3853 |
| 337 | Ga0207676_10000026 | 3300026095 | Bacteria | 248593 |
| 338 | Ga0207674_10167069 | 3300026116 | Bacteria | 2154 |
| 339 | Ga0207674_10865770 | 3300026116 | Bacteria | 871 |
| 340 | Ga0207675_100116954 | 3300026118 | Bacteria | 2520 |
| 341 | Ga0207683_10033093 | 3300026121 | Bacteria | 4490 |
| 342 | Ga0207698_10000002 | 3300026142 | Bacteria | 404991 |
| 343 | Ga0207698_10032602 | 3300026142 | Bacteria | 3776 |
| 344 | Ga0207428_10127293 | 3300027907 | Bacteria | 1950 |
| 345 | Ga0207428_10151168 | 3300027907 | Bacteria | 1767 |
| 346 | Ga0268266_10000503 | 3300028379 | Bacteria | 55789 |
| 347 | Ga0268266_10002461 | 3300028379 | Bacteria | 19801 |
| 348 | Ga0268266_10089007 | 3300028379 | Bacteria | 2702 |
| 349 | Ga0268266_10134732 | 3300028379 | Bacteria | 2211 |
| 350 | Ga0268265_10000440 | 3300028380 | Bacteria | 43839 |
| 351 | Ga0268264_10006776 | 3300028381 | Bacteria | 9622 |
| 352 | Ga0268264_10096040 | 3300028381 | Bacteria | 2566 |
| 353 | Ga0268264_10201875 | 3300028381 | Bacteria | 1819 |
| 354 | Ga0265337_1000025 | 3300028556 | Bacteria | 70787 |
| 355 | Ga0265326_10000015 | 3300028558 | Bacteria | 159279 |
| 356 | Ga0265319_1000244 | 3300028563 | Bacteria | 40899 |
| 357 | Ga0265322_10000003 | 3300028654 | Bacteria | 468671 |
| 358 | Ga0265338_10000047 | 3300028800 | Bacteria | 220905 |
| 359 | Ga0265324_10000074 | 3300029957 | Bacteria | 78102 |
| 360 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 361 | Ga0265325_10023820 | 3300031241 | Bacteria | 3336 |
| 362 | Ga0265329_10047170 | 3300031242 | Bacteria | 1375 |
| 363 | Ga0265331_10000665 | 3300031250 | Bacteria | 29661 |
| 364 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 365 | Ga0265316_10017500 | 3300031344 | Bacteria | 6190 |
| 366 | Ga0265314_10000222 | 3300031711 | Bacteria | 84593 |
| 367 | Ga0316576_10005303 | 3300031727 | Bacteria | 7853 |
| 368 | Ga0316578_10177916 | 3300031728 | Bacteria | 1282 |
| 369 | Ga0307406_10179138 | 3300031901 | Bacteria | 1541 |
| 370 | Ga0373937_0052396 | 3300036401 | Bacteria | 3741 |
| 371 | Ga0316582_0246926 | 3300036647 | Bacteria | 1223 |
| 372 | Ga0316582_0323740 | 3300036647 | Bacteria | 1060 |
| 373 | Ga0316584_0000455 | 3300036712 | Bacteria | 21270 |
| 374 | Ga0316584_0058646 | 3300036712 | Bacteria | 2882 |
| 375 | Ga0316584_0249667 | 3300036712 | Bacteria | 1296 |
| 376 | Ga0395899_0125736 | 3300037312 | Bacteria | 1834 |
| 377 | Ga0395900_0025358 | 3300037418 | Bacteria | 6070 |
| 378 | Ga0395898_0006261 | 3300037466 | Bacteria | 12731 |
| 379 | Ga0395898_0098328 | 3300037466 | Bacteria | 2810 |
| 380 | Ga0395898_0438953 | 3300037466 | Unclassified | 1244 |
| 381 | Ga0395905_0014463 | 3300037471 | Bacteria | 7533 |
| 382 | Ga0395905_0301860 | 3300037471 | Bacteria | 1489 |
| 383 | Ga0395901_0005346 | 3300038443 | Bacteria | 12975 |
| 384 | Ga0395901_0016362 | 3300038443 | Bacteria | 7551 |
| 385 | Ga0395901_0155151 | 3300038443 | Bacteria | 2405 |
| 386 | Ga0451853_2126818 | 3300041512 | Bacteria | 2064 |
| 387 | Ga0466963_0159606 | 3300044694 | Unclassified | 1569 |
| 388 | Ga0466963_0177788 | 3300044694 | Bacteria | 1485 |
| 389 | Ga0466957_0003873 | 3300044842 | Bacteria | 8269 |
| 390 | Ga0466958_0268819 | 3300045836 | Unclassified | 1092 |
| 391 | Ga0466967_0000008 | 3300045976 | Bacteria | 127135 |
| 392 | Ga0466967_0098304 | 3300045976 | Bacteria | 2672 |
| 393 | Ga0495592_0000497 | 3300046454 | Bacteria | 28666 |
| 394 | Ga0495603_0000044 | 3300046455 | Bacteria | 53548 |
| 395 | Ga0495603_0001036 | 3300046455 | Bacteria | 16063 |
| 396 | Ga0495603_0005586 | 3300046455 | Bacteria | 7510 |
| 397 | Ga0495629_0001573 | 3300046459 | Bacteria | 17953 |
| 398 | Ga0495629_0071080 | 3300046459 | Bacteria | 2429 |
| 399 | Ga0495629_0100485 | 3300046459 | Bacteria | 2018 |
| 400 | Ga0495629_0105299 | 3300046459 | Bacteria | 1967 |
| 401 | Ga0495629_0327975 | 3300046459 | Bacteria | 1046 |
| 402 | Ga0495641_0000012 | 3300046461 | Bacteria | 144818 |
| 403 | Ga0495641_0005689 | 3300046461 | Bacteria | 8305 |
| 404 | Ga0495641_0029378 | 3300046461 | Bacteria | 2649 |
| 405 | Ga0495651_0161981 | 3300046462 | Bacteria | 1602 |
| 406 | Ga0495582_0000307 | 3300046473 | Bacteria | 27037 |
| 407 | Ga0495662_0000006 | 3300046476 | Bacteria | 79206 |
| 408 | Ga0495662_0025102 | 3300046476 | Bacteria | 2877 |
| 409 | Ga0495594_0000021 | 3300046499 | Bacteria | 74679 |
| 410 | Ga0495606_0000219 | 3300046507 | Bacteria | 101614 |
| 411 | Ga0495608_0000001 | 3300046511 | Bacteria | 411278 |
| 412 | Ga0495608_0000353 | 3300046511 | Bacteria | 32170 |
| 413 | Ga0495618_0000003 | 3300046514 | Bacteria | 256269 |
| 414 | Ga0495620_0000060 | 3300046515 | Bacteria | 95642 |
| 415 | Ga0495628_0001751 | 3300046516 | Bacteria | 19729 |
| 416 | Ga0495628_0010777 | 3300046516 | Bacteria | 7741 |
| 417 | Ga0495628_0041635 | 3300046516 | Bacteria | 3667 |
| 418 | Ga0495630_0000227 | 3300046517 | Bacteria | 44643 |
| 419 | Ga0495630_0011354 | 3300046517 | Bacteria | 6447 |
| 420 | Ga0495630_0073551 | 3300046517 | Bacteria | 2574 |
| 421 | Ga0495637_0105238 | 3300046520 | Bacteria | 1099 |
| 422 | Ga0495644_0054959 | 3300046523 | Unclassified | 1495 |
| 423 | Ga0495652_0000086 | 3300046529 | Bacteria | 99373 |
| 424 | Ga0495652_0009255 | 3300046529 | Bacteria | 8955 |
| 425 | Ga0495652_0058595 | 3300046529 | Bacteria | 3260 |
| 426 | Ga0495640_0009944 | 3300046533 | Bacteria | 7376 |
| 427 | Ga0495640_0024171 | 3300046533 | Bacteria | 4421 |
| 428 | Ga0495640_0153274 | 3300046533 | Bacteria | 1480 |
| 429 | Ga0495586_0012295 | 3300046535 | Bacteria | 4543 |
| 430 | Ga0495587_0031291 | 3300046536 | Bacteria | 3223 |
| 431 | Ga0495587_0044578 | 3300046536 | Bacteria | 2638 |
| 432 | Ga0495587_0213091 | 3300046536 | Bacteria | 1090 |
| 433 | Ga0495645_0002782 | 3300046543 | Bacteria | 11864 |
| 434 | Ga0495622_0004723 | 3300046557 | Bacteria | 6311 |
| 435 | Ga0495667_0000327 | 3300046559 | Bacteria | 30003 |
| 436 | Ga0495667_0083518 | 3300046559 | Bacteria | 2074 |
| 437 | Ga0495656_0003147 | 3300046615 | Bacteria | 5554 |
| 438 | Ga0495634_0000030 | 3300046642 | Bacteria | 110741 |
| 439 | Ga0495634_0000379 | 3300046642 | Bacteria | 43465 |
| 440 | Ga0495634_0026067 | 3300046642 | Bacteria | 4082 |
| 441 | Ga0495634_0033763 | 3300046642 | Bacteria | 3514 |
| 442 | Ga0495625_0000960 | 3300046660 | Bacteria | 38405 |
| 443 | Ga0495635_0000009 | 3300046663 | Bacteria | 259024 |
| 444 | Ga0495635_0196177 | 3300046663 | Bacteria | 1370 |
| 445 | Ga0495588_0000179 | 3300046674 | Bacteria | 77030 |
| 446 | Ga0495657_0000002 | 3300046675 | Bacteria | 411958 |
| 447 | Ga0495657_0040414 | 3300046675 | Bacteria | 3199 |
| 448 | Ga0495599_0341949 | 3300046678 | Bacteria | 898 |
| 449 | Ga0495647_0000006 | 3300046681 | Bacteria | 105867 |
| 450 | Ga0495647_0000053 | 3300046681 | Bacteria | 31238 |
| 451 | Ga0495647_0141511 | 3300046681 | Bacteria | 1026 |
| 452 | Ga0495658_0000190 | 3300046683 | Bacteria | 35518 |
| 453 | Ga0495658_0002094 | 3300046683 | Bacteria | 10124 |
| 454 | Ga0495669_0001855 | 3300046684 | Bacteria | 8664 |
| 455 | Ga0495613_0000003 | 3300046689 | Bacteria | 248826 |
| 456 | Ga0495613_0000242 | 3300046689 | Bacteria | 51661 |
| 457 | Ga0495624_0000002 | 3300046690 | Bacteria | 189957 |
| 458 | Ga0495624_0199373 | 3300046690 | Unclassified | 1216 |
| 459 | Ga0495649_0199798 | 3300046694 | Bacteria | 1038 |
| 460 | Ga0495600_0000467 | 3300046809 | Bacteria | 20995 |
| 461 | Ga0495600_0010012 | 3300046809 | Bacteria | 5876 |
| 462 | Ga0495604_0000033 | 3300047317 | Bacteria | 134810 |
| 463 | Ga0495604_0001604 | 3300047317 | Bacteria | 18634 |
| 464 | Ga0495604_0063165 | 3300047317 | Bacteria | 2825 |
| 465 | Ga0495674_0000007 | 3300047319 | Bacteria | 336257 |
| 466 | Ga0495676_0001744 | 3300047321 | Bacteria | 19010 |
| 467 | Ga0495676_0006848 | 3300047321 | Bacteria | 10474 |
| 468 | Ga0495676_0193041 | 3300047321 | Bacteria | 1419 |
| 469 | Ga0495680_0000272 | 3300047322 | Bacteria | 57553 |
| 470 | Ga0495680_0001303 | 3300047322 | Bacteria | 27171 |
| 471 | Ga0495680_0005371 | 3300047322 | Bacteria | 12082 |
| 472 | Ga0495680_0241414 | 3300047322 | Unclassified | 1283 |
| 473 | Ga0495675_0000162 | 3300047444 | Bacteria | 47605 |
| 474 | Ga0495675_0066227 | 3300047444 | Bacteria | 2283 |
| 475 | Ga0495684_0270347 | 3300047471 | Bacteria | 1230 |
| 476 | Ga0495686_0080264 | 3300047472 | Bacteria | 1994 |
| 477 | Ga0495593_0052051 | 3300047673 | Bacteria | 2165 |
| 478 | Ga0495593_0114588 | 3300047673 | Bacteria | 1375 |
| 479 | Ga0495602_0000063 | 3300048088 | Bacteria | 104915 |
| 480 | Ga0495602_0000188 | 3300048088 | Bacteria | 58305 |
| 481 | Ga0495602_0056594 | 3300048088 | Bacteria | 3447 |
| 482 | Ga0496100_0000004 | 3300048903 | Bacteria | 321778 |
| 483 | Ga0496100_0000046 | 3300048903 | Bacteria | 77660 |
| 484 | Ga0496101_0000007 | 3300048904 | Bacteria | 321778 |
| 485 | Ga0496101_0000124 | 3300048904 | Bacteria | 75495 |
| 486 | Ga0496102_0000404 | 3300048905 | Bacteria | 50274 |
| 487 | Ga0496102_0013913 | 3300048905 | Bacteria | 6982 |
| 488 | Ga0496102_0126421 | 3300048905 | Bacteria | 2390 |
| 489 | Ga0496102_0240311 | 3300048905 | Bacteria | 1708 |
| 490 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 491 | Ga0496103_0011805 | 3300048906 | Bacteria | 5183 |
| 492 | Ga0496103_0015494 | 3300048906 | Bacteria | 4537 |
| 493 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 494 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 495 | Ga0496104_0000139 | 3300048907 | Bacteria | 67432 |
| 496 | Ga0496104_0003874 | 3300048907 | Bacteria | 12944 |
| 497 | Ga0496104_0055019 | 3300048907 | Bacteria | 3762 |
| 498 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 499 | Ga0496105_0000008 | 3300048908 | Bacteria | 335652 |
| 500 | Ga0496105_0000054 | 3300048908 | Bacteria | 89081 |
| 501 | Ga0496105_0043820 | 3300048908 | Bacteria | 3690 |
| 502 | Ga0496105_0077590 | 3300048908 | Bacteria | 2743 |
| 503 | Ga0496106_0000004 | 3300048909 | Bacteria | 279896 |
| 504 | Ga0496106_0000059 | 3300048909 | Bacteria | 87781 |
| 505 | Ga0496106_0000239 | 3300048909 | Bacteria | 38253 |
| 506 | Ga0496106_0013880 | 3300048909 | Bacteria | 5953 |
| 507 | Ga0496106_0082773 | 3300048909 | Bacteria | 2467 |
| 508 | Ga0496107_0000001 | 3300048910 | Bacteria | 321778 |
| 509 | Ga0496107_0000018 | 3300048910 | Bacteria | 158433 |
| 510 | Ga0496107_0013156 | 3300048910 | Bacteria | 5780 |
| 511 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 512 | Ga0496108_0000012 | 3300048911 | Bacteria | 258433 |
| 513 | Ga0496108_0002243 | 3300048911 | Bacteria | 15470 |
| 514 | Ga0496108_0005210 | 3300048911 | Bacteria | 10508 |
| 515 | Ga0496108_0015619 | 3300048911 | Bacteria | 6193 |
| 516 | Ga0496108_0155722 | 3300048911 | Bacteria | 1973 |
| 517 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 518 | Ga0496109_0000035 | 3300048912 | Bacteria | 159744 |
| 519 | Ga0496109_0000246 | 3300048912 | Bacteria | 52127 |
| 520 | Ga0496109_0000291 | 3300048912 | Bacteria | 47681 |
| 521 | Ga0496109_0175693 | 3300048912 | Bacteria | 2010 |
| 522 | Ga0496109_0720916 | 3300048912 | Bacteria | 935 |
| 523 | Ga0496110_0000476 | 3300048913 | Bacteria | 27211 |
| 524 | Ga0496110_0035346 | 3300048913 | Bacteria | 4335 |
| 525 | Ga0496110_0095687 | 3300048913 | Bacteria | 2660 |
| 526 | Ga0496110_0100291 | 3300048913 | Bacteria | 2595 |
| 527 | Ga0496111_0000354 | 3300048914 | Bacteria | 22721 |
| 528 | Ga0496111_0000772 | 3300048914 | Bacteria | 17077 |
| 529 | Ga0496111_0111137 | 3300048914 | Bacteria | 2018 |
| 530 | Ga0496111_0244594 | 3300048914 | Bacteria | 1332 |
| 531 | Ga0496111_0441453 | 3300048914 | Bacteria | 961 |
| 532 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 533 | Ga0496112_0240676 | 3300048915 | Bacteria | 1762 |
| 534 | Ga0496113_0000010 | 3300048916 | Bacteria | 86561 |
| 535 | Ga0496113_0005366 | 3300048916 | Bacteria | 7991 |
| 536 | Ga0496113_0006303 | 3300048916 | Bacteria | 7503 |
| 537 | Ga0496113_0018186 | 3300048916 | Bacteria | 4893 |
| 538 | Ga0496113_0303940 | 3300048916 | Bacteria | 1277 |
| 539 | Ga0496114_0000043 | 3300048917 | Bacteria | 131720 |
| 540 | Ga0496114_0005502 | 3300048917 | Bacteria | 9916 |
| 541 | Ga0496114_0019454 | 3300048917 | Bacteria | 5501 |
| 542 | Ga0496115_0000004 | 3300048918 | Bacteria | 319734 |
| 543 | Ga0496115_0000211 | 3300048918 | Bacteria | 54033 |
| 544 | Ga0496115_0050523 | 3300048918 | Bacteria | 3331 |
| 545 | Ga0496115_0088199 | 3300048918 | Bacteria | 2532 |
| 546 | Ga0496116_0000229 | 3300048919 | Bacteria | 104677 |
| 547 | Ga0496117_0005642 | 3300048920 | Bacteria | 13060 |
| 548 | Ga0496118_0002667 | 3300048921 | Bacteria | 23593 |
| 549 | Ga0496118_0067099 | 3300048921 | Bacteria | 2615 |
| 550 | Ga0496119_0006136 | 3300048922 | Bacteria | 11250 |
| 551 | Ga0496119_0019921 | 3300048922 | Bacteria | 4915 |
| 552 | Ga0496119_0031215 | 3300048922 | Bacteria | 3578 |
| 553 | Ga0496120_0011767 | 3300048923 | Bacteria | 5992 |
| 554 | Ga0496120_0039736 | 3300048923 | Bacteria | 2772 |
| 555 | Ga0496121_0251465 | 3300048924 | Bacteria | 1225 |
| 556 | Ga0496124_0132393 | 3300048927 | Bacteria | 1979 |
| 557 | Ga0496126_0078174 | 3300048929 | Bacteria | 2932 |
| 558 | Ga0501031_0009627 | 3300049568 | Bacteria | 6290 |
| 559 | Ga0501032_0003351 | 3300049569 | Bacteria | 12294 |
| 560 | Ga0501033_0003740 | 3300049570 | Bacteria | 12374 |
| 561 | Ga0501034_0000725 | 3300049571 | Bacteria | 49918 |
| 562 | Ga0501034_0028502 | 3300049571 | Bacteria | 5683 |
| 563 | Ga0501036_0003647 | 3300049572 | Bacteria | 12312 |
| 564 | Ga0501036_0259512 | 3300049572 | Bacteria | 1456 |
| 565 | Ga0501037_0002974 | 3300049573 | Bacteria | 12302 |
| 566 | Ga0501038_0000228 | 3300049574 | Bacteria | 47686 |
| 567 | Ga0501039_0053926 | 3300049575 | Bacteria | 3112 |
| 568 | Ga0501039_0059864 | 3300049575 | Bacteria | 2949 |
| 569 | Ga0501039_0285246 | 3300049575 | Bacteria | 1298 |
| 570 | Ga0501039_0424972 | 3300049575 | Unclassified | 1044 |
| 571 | Ga0501040_0061447 | 3300049576 | Bacteria | 2584 |
| 572 | Ga0501040_0080845 | 3300049576 | Bacteria | 2252 |
| 573 | Ga0501041_0310815 | 3300049577 | Bacteria | 994 |
| 574 | Ga0501042_0011450 | 3300049578 | Bacteria | 5986 |
| 575 | Ga0501042_0030342 | 3300049578 | Bacteria | 3817 |
| 576 | Ga0501043_0003860 | 3300049579 | Bacteria | 12317 |
| 577 | Ga0501046_0001430 | 3300049580 | Bacteria | 22944 |
| 578 | Ga0501047_0000413 | 3300049581 | Bacteria | 47712 |
| 579 | Ga0501047_0004433 | 3300049581 | Bacteria | 13217 |
| 580 | Ga0501048_0000807 | 3300049582 | Bacteria | 22984 |
| 581 | Ga0501067_0202836 | 3300049583 | Bacteria | 1104 |
| 582 | Ga0501068_0071189 | 3300049584 | Bacteria | 2122 |
| 583 | Ga0501068_0187768 | 3300049584 | Bacteria | 1308 |
| 584 | Ga0501069_0004856 | 3300049585 | Bacteria | 6962 |
| 585 | Ga0501069_0067442 | 3300049585 | Bacteria | 2001 |
| 586 | Ga0501070_0004278 | 3300049586 | Bacteria | 12279 |
| 587 | Ga0501070_0007739 | 3300049586 | Bacteria | 9107 |
| 588 | Ga0501070_0176174 | 3300049586 | Bacteria | 1760 |
| 589 | Ga0501070_0357719 | 3300049586 | Bacteria | 1184 |
| 590 | Ga0501071_0325491 | 3300049587 | Bacteria | 1167 |
| 591 | Ga0501072_0018835 | 3300049588 | Bacteria | 5325 |
| 592 | Ga0501072_0158735 | 3300049588 | Bacteria | 1804 |
| 593 | Ga0501072_0186126 | 3300049588 | Bacteria | 1656 |
| 594 | Ga0501072_0280712 | 3300049588 | Bacteria | 1325 |
| 595 | Ga0501073_0137619 | 3300049589 | Bacteria | 1692 |
| 596 | Ga0501074_0145747 | 3300049590 | Bacteria | 1693 |
| 597 | Ga0501075_0006466 | 3300049591 | Bacteria | 8064 |
| 598 | Ga0501075_0445053 | 3300049591 | Bacteria | 988 |
| 599 | Ga0501076_0005956 | 3300049592 | Bacteria | 8803 |
| 600 | Ga0501076_0070967 | 3300049592 | Bacteria | 2786 |
| 601 | Ga0501076_0628049 | 3300049592 | Bacteria | 886 |
| 602 | Ga0501077_0100170 | 3300049593 | Bacteria | 1836 |
| 603 | Ga0501079_0129621 | 3300049741 | Bacteria | 1962 |
| 604 | Ga0501079_0339868 | 3300049741 | Unclassified | 1176 |
| 605 | Ga0501079_0410655 | 3300049741 | Bacteria | 1062 |
| 606 | Ga0501080_0022082 | 3300049742 | Bacteria | 5896 |
| 607 | Ga0501080_0299639 | 3300049742 | Bacteria | 1458 |
| 608 | Ga0501080_0450406 | 3300049742 | Bacteria | 1154 |
| 609 | Ga0501081_0464170 | 3300049743 | Bacteria | 941 |
| 610 | Ga0501083_0002732 | 3300049744 | Bacteria | 12183 |
| 611 | Ga0501083_0247137 | 3300049744 | Bacteria | 1161 |
| 612 | Ga0501035_0000421 | 3300049822 | Bacteria | 47742 |
| 613 | Ga0501035_0194986 | 3300049822 | Bacteria | 1740 |
| 614 | Ga0501044_0000270 | 3300049823 | Bacteria | 65798 |
| 615 | Ga0501044_0208517 | 3300049823 | Bacteria | 1909 |
| 616 | Ga0501044_0498532 | 3300049823 | Bacteria | 1119 |
| 617 | Ga0501045_0002713 | 3300049824 | Bacteria | 12086 |
| 618 | nmdc:mga03n38_186692_c1 | 3300050490 | Unclassified | 1065 |
| 619 | nmdc:mga03n38_262787_c1 | 3300050490 | Bacteria | 915 |
| 620 | nmdc:mga03n38_42069_c1 | 3300050490 | Bacteria | 1995 |
| 621 | nmdc:mga00v17_13597_c1 | 3300050491 | Bacteria | 4522 |
| 622 | nmdc:mga00v17_50406_c1 | 3300050491 | Bacteria | 2529 |
| 623 | nmdc:mga00v17_67807_c1 | 3300050491 | Bacteria | 2205 |
| 624 | nmdc:mga0yw44_139281_c1 | 3300050492 | Bacteria | 1576 |
| 625 | nmdc:mga0yw44_308154_c1 | 3300050492 | Bacteria | 1062 |
| 626 | nmdc:mga0yw44_39956_c1 | 3300050492 | Bacteria | 2784 |
| 627 | nmdc:mga0yw44_50750_c1 | 3300050492 | Bacteria | 2510 |
| 628 | nmdc:mga0yw44_5084_c1 | 3300050492 | Bacteria | 6149 |
| 629 | nmdc:mga05p37_106394_c1 | 3300050507 | Bacteria | 3451 |
| 630 | nmdc:mga05p37_60498_c1 | 3300050507 | Bacteria | 4663 |
| 631 | nmdc:mga06r32_166059_c1 | 3300050510 | Bacteria | 2190 |
| 632 | nmdc:mga06r32_17794_c1 | 3300050510 | Bacteria | 6494 |
| 633 | nmdc:mga06r32_674875_c1 | 3300050510 | Bacteria | 1000 |
| 634 | nmdc:mga08y16_11543_c1 | 3300050511 | Bacteria | 9284 |
| 635 | nmdc:mga08y16_152376_c1 | 3300050511 | Bacteria | 2403 |
| 636 | nmdc:mga08y16_287862_c1 | 3300050511 | Bacteria | 1694 |
| 637 | nmdc:mga0n895_18785_c1 | 3300050512 | Bacteria | 6405 |
| 638 | nmdc:mga0n895_487575_c1 | 3300050512 | Bacteria | 1243 |
| 639 | nmdc:mga0rr50_46027_c1 | 3300050513 | Bacteria | 3210 |
| 640 | nmdc:mga0a205_1968_c1 | 3300050515 | Bacteria | 17890 |
| 641 | nmdc:mga0a205_1_c1 | 3300050515 | Bacteria | 62269 |
| 642 | nmdc:mga0a205_59419_c1 | 3300050515 | Bacteria | 3692 |
| 643 | Ga0495601_0000012 | 3300053077 | Bacteria | 227853 |
| 644 | Ga0495601_0000271 | 3300053077 | Bacteria | 28102 |
| 645 | Ga0495601_0038157 | 3300053077 | Bacteria | 3003 |
| 646 | Ga0495601_0076429 | 3300053077 | Bacteria | 2144 |
| 647 | Ga0495612_0000168 | 3300053078 | Bacteria | 27483 |
| 648 | Ga0495612_0011594 | 3300053078 | Archaea | 3551 |
| 649 | Ga0495612_0056088 | 3300053078 | Bacteria | 1625 |
| 650 | Ga0495612_0060328 | 3300053078 | Bacteria | 1570 |
| 651 | Ga0495655_0000016 | 3300053083 | Bacteria | 50674 |
| 652 | Ga0495655_0003962 | 3300053083 | Bacteria | 2492 |
| 653 | Ga0495595_0000001 | 3300053084 | Bacteria | 495226 |
| 654 | Ga0495595_0034679 | 3300053084 | Bacteria | 2283 |
| 655 | Ga0495595_0144203 | 3300053084 | Bacteria | 1169 |
| 656 | Ga0495619_0000018 | 3300053085 | Bacteria | 209943 |
| 657 | Ga0495619_0000041 | 3300053085 | Bacteria | 112824 |
| 658 | Ga0495619_0000708 | 3300053085 | Bacteria | 21719 |
| 659 | Ga0495619_0001128 | 3300053085 | Bacteria | 17562 |
| 660 | Ga0495619_0001674 | 3300053085 | Bacteria | 14650 |
| 661 | Ga0495619_0003448 | 3300053085 | Bacteria | 10201 |
| 662 | Ga0495619_0004182 | 3300053085 | Bacteria | 9211 |
| 663 | Ga0495619_0032355 | 3300053085 | Bacteria | 3393 |
| 664 | Ga0500566_0003650 | 3300053094 | Bacteria | 9186 |
| 665 | Ga0500554_071950 | 3300053102 | Bacteria | 1127 |
| 666 | Ga0500614_055431 | 3300053123 | Bacteria | 1052 |
| 667 | Ga0500628_000027 | 3300053129 | Bacteria | 60626 |
| 668 | Ga0501084_0024286 | 3300054114 | Bacteria | 5055 |
| 669 | Ga0501084_0160100 | 3300054114 | Bacteria | 1899 |
| 670 | Ga0501084_0338584 | 3300054114 | Bacteria | 1271 |
| 671 | Ga0501082_0061246 | 3300060353 | Bacteria | 3240 |
| 672 | Ga0501082_0086822 | 3300060353 | Bacteria | 2698 |
| 673 | Ga0075431_100665265 | |||
| 674 | JGI24746J21847_1000617 | |||
| 675 | JGI24740J21852_10005220 | |||
| 676 | JGI24735J21928_10042010 | |||
| 677 | JGI24748J21848_1000223 | |||
| 678 | JGI24742J22300_10001281 | |||
| 679 | JGI25404J52841_10000203 | |||
| 680 | Ga0070658_10071798 | |||
| 681 | Ga0070683_100000481 | |||
| 682 | Ga0070683_100001210 | |||
| 683 | Ga0070683_100011934 | |||
| 684 | Ga0070683_100036323 | |||
| 685 | Ga0070683_100139733 | |||
| 686 | Ga0070670_100049915 | |||
| 687 | Ga0070670_100079304 | |||
| 688 | Ga0070677_10000396 | |||
| 689 | Ga0070666_10088224 | |||
| 690 | Ga0070680_100144869 | |||
| 691 | Ga0070682_100000057 | |||
| 692 | Ga0070682_100000629 | |||
| 693 | Ga0070682_100004924 | |||
| 694 | Ga0070682_100049978 | |||
| 695 | Ga0068868_100000008 | |||
| 696 | Ga0068868_100083335 | |||
| 697 | Ga0070689_100084749 | |||
| 698 | Ga0070691_10000010 | |||
| 699 | Ga0070691_10000175 | |||
| 700 | Ga0070691_10115987 | |||
| 701 | Ga0070661_100000365 | |||
| 702 | Ga0070661_100041945 | |||
| 703 | Ga0070661_100371855 | |||
| 704 | Ga0070692_10049295 | |||
| 705 | Ga0070668_100006745 | |||
| 706 | Ga0070668_100048845 | |||
| 707 | Ga0070668_100366971 | |||
| 708 | Ga0070675_100002793 | |||
| 709 | Ga0070675_100315950 | |||
| 710 | Ga0070674_100000003 | |||
| 711 | Ga0070674_100000016 | |||
| 712 | Ga0070674_100047945 | |||
| 713 | Ga0070674_100054728 | |||
| 714 | Ga0070674_100176930 | |||
| 715 | Ga0070673_100068006 | |||
| 716 | Ga0070688_100001580 | |||
| 717 | Ga0070688_100009726 | |||
| 718 | Ga0070688_100016010 | |||
| 719 | Ga0070688_100018164 | |||
| 720 | Ga0070659_100008696 | |||
| 721 | Ga0070659_100014138 | |||
| 722 | Ga0070659_100019608 | |||
| 723 | Ga0070667_100002889 | |||
| 724 | Ga0070667_100229586 | |||
| 725 | Ga0070714_100031777 | |||
| 726 | Ga0070713_100000055 | |||
| 727 | Ga0070710_10047102 | |||
| 728 | Ga0070710_10211997 | |||
| 729 | Ga0070711_100004268 | |||
| 730 | Ga0070700_100019287 | |||
| 731 | Ga0070700_100099501 | |||
| 732 | Ga0070663_100001559 | |||
| 733 | Ga0070663_100002524 | |||
| 734 | Ga0070678_100021199 | |||
| 735 | Ga0070662_100000039 | |||
| 736 | Ga0070662_100036309 | |||
| 737 | Ga0070681_10008875 | |||
| 738 | Ga0070681_10268959 | |||
| 739 | Ga0068867_100027246 | |||
| 740 | Ga0068867_100027776 | |||
| 741 | Ga0070685_10000545 | |||
| 742 | Ga0070685_10006443 | |||
| 743 | Ga0070685_10062191 | |||
| 744 | Ga0070679_100004239 | |||
| 745 | Ga0070679_100007525 | |||
| 746 | Ga0070684_100020721 | |||
| 747 | Ga0070684_100023080 | |||
| 748 | Ga0070684_100027962 | |||
| 749 | Ga0070684_100079875 | |||
| 750 | Ga0070684_100085793 | |||
| 751 | Ga0068853_100045486 | |||
| 752 | Ga0068853_100081011 | |||
| 753 | Ga0068853_100198726 | |||
| 754 | Ga0070672_100000057 | |||
| 755 | Ga0070672_100005836 | |||
| 756 | Ga0070686_100044154 | |||
| 757 | Ga0070686_100107235 | |||
| 758 | Ga0070693_100001114 | |||
| 759 | Ga0070693_100203879 | |||
| 760 | Ga0070665_100000128 | |||
| 761 | Ga0070665_100019618 | |||
| 762 | Ga0070665_100049511 | |||
| 763 | Ga0070665_100160313 | |||
| 764 | Ga0070704_100280022 | |||
| 765 | Ga0068855_100170569 | |||
| 766 | Ga0070664_100016179 | |||
| 767 | Ga0070664_100022744 | |||
| 768 | Ga0068857_100264891 | |||
| 769 | Ga0068857_100676254 | |||
| 770 | Ga0068854_100000525 | |||
| 771 | Ga0068856_100000057 | |||
| 772 | Ga0068856_100006604 | |||
| 773 | Ga0068856_100016805 | |||
| 774 | Ga0068856_100265616 | |||
| 775 | Ga0070702_100037764 | |||
| 776 | Ga0068852_100000007 | |||
| 777 | Ga0068852_100023801 | |||
| 778 | Ga0068859_100036381 | |||
| 779 | Ga0068864_100000035 | |||
| 780 | Ga0068866_10000002 | |||
| 781 | Ga0068866_10000148 | |||
| 782 | Ga0068866_10021772 | |||
| 783 | Ga0068861_100082457 | |||
| 784 | Ga0068851_10003763 | |||
| 785 | Ga0068851_10020414 | |||
| 786 | Ga0068851_10024605 | |||
| 787 | Ga0068863_100000415 | |||
| 788 | Ga0068863_100002803 | |||
| 789 | Ga0068863_100190462 | |||
| 790 | Ga0068858_100000218 | |||
| 791 | Ga0068858_100001041 | |||
| 792 | Ga0068858_100158049 | |||
| 793 | Ga0068858_100160275 | |||
| 794 | Ga0068858_100219619 | |||
| 795 | Ga0068860_100009932 | |||
| 796 | Ga0068860_100101220 | |||
| 797 | Ga0068862_100000391 | |||
| 798 | Ga0081455_10013769 | |||
| 799 | Ga0081455_10018091 | |||
| 800 | Ga0081455_10057768 | |||
| 801 | Ga0081455_10156075 | |||
| 802 | Ga0081455_10211351 | |||
| 803 | Ga0081538_10000296 | |||
| 804 | Ga0081538_10012468 | |||
| 805 | Ga0081538_10018156 | |||
| 806 | Ga0081540_1005483 | |||
| 807 | Ga0081539_10002725 | |||
| 808 | Ga0081539_10016707 | |||
| 809 | Ga0075365_10002481 | |||
| 810 | Ga0075365_10003158 | |||
| 811 | Ga0075365_10035347 | |||
| 812 | Ga0075365_10046303 | |||
| 813 | Ga0075365_10203771 | |||
| 814 | Ga0075365_10360597 | |||
| 815 | Ga0075368_10041580 | |||
| 816 | Ga0075363_100026884 | |||
| 817 | Ga0075363_100053188 | |||
| 818 | Ga0075364_10017607 | |||
| 819 | Ga0075364_10141275 | |||
| 820 | Ga0075364_10240656 | |||
| 821 | Ga0070715_10000003 | |||
| 822 | Ga0070715_10033497 | |||
| 823 | Ga0070712_100002058 | |||
| 824 | Ga0070712_100009870 | |||
| 825 | Ga0097621_100550548 | |||
| 826 | Ga0075428_100294506 | |||
| 827 | Ga0075430_100038867 | |||
| 828 | Ga0075431_100031537 | |||
| 829 | Ga0075431_100073391 | |||
| 830 | Ga0075433_10001496 | |||
| 831 | Ga0075433_10002936 | |||
| 832 | Ga0075434_100010015 | |||
| 833 | Ga0075434_100164213 | |||
| 834 | Ga0075434_100404488 | |||
| 835 | Ga0068865_100000009 | |||
| 836 | Ga0068865_100061472 | |||
| 837 | Ga0097620_100036381 | |||
| 838 | Ga0111539_10004463 | |||
| 839 | Ga0111539_10333572 | |||
| 840 | Ga0105245_10000012 | |||
| 841 | Ga0105245_10000077 | |||
| 842 | Ga0105245_10001697 | |||
| 843 | Ga0105245_10004922 | |||
| 844 | Ga0105245_10004991 | |||
| 845 | Ga0105245_10010946 | |||
| 846 | Ga0105245_10369980 | |||
| 847 | Ga0105245_10478094 | |||
| 848 | Ga0105247_10000208 | |||
| 849 | Ga0105247_10178977 | |||
| 850 | Ga0114129_10074895 | |||
| 851 | Ga0114129_10077098 | |||
| 852 | Ga0114129_10111505 | |||
| 853 | Ga0114129_10133836 | |||
| 854 | Ga0114129_10402259 | |||
| 855 | Ga0105243_10014256 | |||
| 856 | Ga0105243_10256466 | |||
| 857 | Ga0105243_10261873 | |||
| 858 | Ga0105243_10350897 | |||
| 859 | Ga0105241_10324451 | |||
| 860 | Ga0105242_10000010 | |||
| 861 | Ga0105242_10001414 | |||
| 862 | Ga0105242_10058034 | |||
| 863 | Ga0105242_10059547 | |||
| 864 | Ga0105242_10075784 | |||
| 865 | Ga0105242_10095441 | |||
| 866 | Ga0105248_10000022 | |||
| 867 | Ga0105248_10087690 | |||
| 868 | Ga0105248_10687813 | |||
| 869 | Ga0105237_10052868 | |||
| 870 | Ga0105238_10000321 | |||
| 871 | Ga0105238_10213592 | |||
| 872 | Ga0105249_10000192 | |||
| 873 | Ga0105249_10013993 | |||
| 874 | Ga0105249_10028741 | |||
| 875 | Ga0105249_10135836 | |||
| 876 | Ga0105239_10060776 | |||
| 877 | Ga0105239_10099990 | |||
| 878 | Ga0105239_10172723 | |||
| 879 | Ga0105246_10026116 | |||
| 880 | Ga0105246_10203728 | |||
| 881 | Ga0157371_10006260 | |||
| 882 | Ga0157370_10067067 | |||
| 883 | Ga0157370_10110965 | |||
| 884 | Ga0157370_10130342 | |||
| 885 | Ga0157369_10000118 | |||
| 886 | Ga0157374_10005906 | |||
| 887 | Ga0157374_10095055 | |||
| 888 | Ga0157378_10011673 | |||
| 889 | Ga0157378_10017504 | |||
| 890 | Ga0157378_10050602 | |||
| 891 | Ga0163162_10239225 | |||
| 892 | Ga0157372_10038776 | |||
| 893 | Ga0157375_10001092 | |||
| 894 | Ga0157375_10006876 | |||
| 895 | Ga0157375_10049665 | |||
| 896 | Ga0157375_10131926 | |||
| 897 | Ga0157375_10307148 | |||
| 898 | Ga0157375_10466337 | |||
| 899 | Ga0163163_10467912 | |||
| 900 | Ga0157380_10000249 | |||
| 901 | Ga0157380_10005261 | |||
| 902 | Ga0157380_10173269 | |||
| 903 | Ga0157380_10451726 | |||
| 904 | Ga0157379_10044400 | |||
| 905 | Ga0157379_10051072 | |||
| 906 | Ga0157379_10111567 | |||
| 907 | Ga0157379_10156977 | |||
| 908 | Ga0157379_10490546 | |||
| 909 | Ga0157376_10385504 | |||
| 910 | Ga0157376_10581355 | |||
| 911 | Ga0163161_10004856 | |||
| 912 | Ga0163161_10141320 | |||
| 913 | Ga0207656_10002454 | |||
| 914 | Ga0207656_10010149 | |||
| 915 | Ga0207656_10012896 | |||
| 916 | Ga0207682_10000380 | |||
| 917 | Ga0207642_10000001 | |||
| 918 | Ga0207642_10000003 | |||
| 919 | Ga0207642_10000004 | |||
| 920 | Ga0207642_10000051 | |||
| 921 | Ga0207642_10013216 | |||
| 922 | Ga0207710_10059721 | |||
| 923 | Ga0207688_10004076 | |||
| 924 | Ga0207685_10000003 | |||
| 925 | Ga0207685_10133521 | |||
| 926 | Ga0207705_10029153 | |||
| 927 | Ga0207707_10011056 | |||
| 928 | Ga0207707_10381322 | |||
| 929 | Ga0207693_10003350 | |||
| 930 | Ga0207693_10043150 | |||
| 931 | Ga0207663_10002464 | |||
| 932 | Ga0207660_10139153 | |||
| 933 | Ga0207649_10000024 | |||
| 934 | Ga0207649_10011147 | |||
| 935 | Ga0207652_10001557 | |||
| 936 | Ga0207652_10006321 | |||
| 937 | Ga0207652_10569020 | |||
| 938 | Ga0207694_10000008 | |||
| 939 | Ga0207694_10026190 | |||
| 940 | Ga0207650_10022678 | |||
| 941 | Ga0207659_10000062 | |||
| 942 | Ga0207659_10225173 | |||
| 943 | Ga0207687_10000011 | |||
| 944 | Ga0207687_10000012 | |||
| 945 | Ga0207687_10001579 | |||
| 946 | Ga0207687_10002910 | |||
| 947 | Ga0207687_10046298 | |||
| 948 | Ga0207700_10000009 | |||
| 949 | Ga0207664_10076341 | |||
| 950 | Ga0207644_10047351 | |||
| 951 | Ga0207690_10013252 | |||
| 952 | Ga0207706_10000026 | |||
| 953 | Ga0207686_10000271 | |||
| 954 | Ga0207686_10001505 | |||
| 955 | Ga0207686_10041038 | |||
| 956 | Ga0207686_10147082 | |||
| 957 | Ga0207709_10008821 | |||
| 958 | Ga0207709_10160164 | |||
| 959 | Ga0207709_10225073 | |||
| 960 | Ga0207669_10000023 | |||
| 961 | Ga0207669_10000064 | |||
| 962 | Ga0207669_10014220 | |||
| 963 | Ga0207669_10049282 | |||
| 964 | Ga0207669_10081452 | |||
| 965 | Ga0207704_10000004 | |||
| 966 | Ga0207704_10280715 | |||
| 967 | Ga0207691_10000642 | |||
| 968 | Ga0207691_10003031 | |||
| 969 | Ga0207711_10000019 | |||
| 970 | Ga0207711_10180171 | |||
| 971 | Ga0207661_10000166 | |||
| 972 | Ga0207661_10006101 | |||
| 973 | Ga0207661_10008277 | |||
| 974 | Ga0207661_10036097 | |||
| 975 | Ga0207661_10390934 | |||
| 976 | Ga0207661_10716266 | |||
| 977 | Ga0207679_10013404 | |||
| 978 | Ga0207679_10079809 | |||
| 979 | Ga0207667_10045130 | |||
| 980 | Ga0207712_10000003 | |||
| 981 | Ga0207712_10004857 | |||
| 982 | Ga0207712_10046712 | |||
| 983 | Ga0207668_10223300 | |||
| 984 | Ga0207640_10000059 | |||
| 985 | Ga0207640_10012280 | |||
| 986 | Ga0207658_10001012 | |||
| 987 | Ga0207658_10052890 | |||
| 988 | Ga0207658_10306500 | |||
| 989 | Ga0207677_10000142 | |||
| 990 | Ga0207703_10000028 | |||
| 991 | Ga0207703_10000153 | |||
| 992 | Ga0207703_10104092 | |||
| 993 | Ga0207639_10000298 | |||
| 994 | Ga0207639_10023840 | |||
| 995 | Ga0207639_10182319 | |||
| 996 | Ga0207678_10000683 | |||
| 997 | Ga0207678_10001490 | |||
| 998 | Ga0207708_10051241 | |||
| 999 | Ga0207708_10131430 | |||
| 1000 | Ga0207702_10000027 | |||
| 1001 | Ga0207702_10010473 | |||
| 1002 | Ga0207702_10016462 | |||
| 1003 | Ga0207702_10511061 | |||
| 1004 | Ga0207641_10000072 | |||
| 1005 | Ga0207641_10004111 | |||
| 1006 | Ga0207641_10601707 | |||
| 1007 | Ga0207648_10030144 | |||
| 1008 | Ga0207648_10045418 | |||
| 1009 | Ga0207676_10000026 | |||
| 1010 | Ga0207674_10167069 | |||
| 1011 | Ga0207674_10865770 | |||
| 1012 | Ga0207675_100116954 | |||
| 1013 | Ga0207683_10033093 | |||
| 1014 | Ga0207698_10000002 | |||
| 1015 | Ga0207698_10032602 | |||
| 1016 | Ga0207428_10127293 | |||
| 1017 | Ga0207428_10151168 | |||
| 1018 | Ga0268266_10000503 | |||
| 1019 | Ga0268266_10002461 | |||
| 1020 | Ga0268266_10089007 | |||
| 1021 | Ga0268266_10134732 | |||
| 1022 | Ga0268265_10000440 | |||
| 1023 | Ga0268264_10006776 | |||
| 1024 | Ga0268264_10096040 | |||
| 1025 | Ga0268264_10201875 | |||
| 1026 | Ga0265337_1000025 | |||
| 1027 | Ga0265326_10000015 | |||
| 1028 | Ga0265319_1000244 | |||
| 1029 | Ga0265322_10000003 | |||
| 1030 | Ga0265338_10000047 | |||
| 1031 | Ga0265324_10000074 | |||
| 1032 | Ga0265320_10000001 | |||
| 1033 | Ga0265325_10023820 | |||
| 1034 | Ga0265329_10047170 | |||
| 1035 | Ga0265331_10000665 | |||
| 1036 | Ga0265327_10000003 | |||
| 1037 | Ga0265316_10017500 | |||
| 1038 | Ga0265314_10000222 | |||
| 1039 | Ga0316576_10005303 | |||
| 1040 | Ga0316578_10177916 | |||
| 1041 | Ga0307406_10179138 | |||
| 1042 | Ga0373937_0052396 | |||
| 1043 | Ga0316582_0246926 | |||
| 1044 | Ga0316582_0323740 | |||
| 1045 | Ga0316584_0000455 | |||
| 1046 | Ga0316584_0058646 | |||
| 1047 | Ga0316584_0249667 | |||
| 1048 | Ga0395899_0125736 | |||
| 1049 | Ga0395900_0025358 | |||
| 1050 | Ga0395898_0006261 | |||
| 1051 | Ga0395898_0098328 | |||
| 1052 | Ga0395898_0438953 | |||
| 1053 | Ga0395905_0014463 | |||
| 1054 | Ga0395905_0301860 | |||
| 1055 | Ga0395901_0005346 | |||
| 1056 | Ga0395901_0016362 | |||
| 1057 | Ga0395901_0155151 | |||
| 1058 | Ga0451853_2126818 | |||
| 1059 | Ga0466963_0159606 | |||
| 1060 | Ga0466963_0177788 | |||
| 1061 | Ga0466957_0003873 | |||
| 1062 | Ga0466958_0268819 | |||
| 1063 | Ga0466967_0000008 | |||
| 1064 | Ga0466967_0098304 | |||
| 1065 | Ga0495592_0000497 | |||
| 1066 | Ga0495603_0000044 | |||
| 1067 | Ga0495603_0001036 | |||
| 1068 | Ga0495603_0005586 | |||
| 1069 | Ga0495629_0001573 | |||
| 1070 | Ga0495629_0071080 | |||
| 1071 | Ga0495629_0100485 | |||
| 1072 | Ga0495629_0105299 | |||
| 1073 | Ga0495629_0327975 | |||
| 1074 | Ga0495641_0000012 | |||
| 1075 | Ga0495641_0005689 | |||
| 1076 | Ga0495641_0029378 | |||
| 1077 | Ga0495651_0161981 | |||
| 1078 | Ga0495582_0000307 | |||
| 1079 | Ga0495662_0000006 | |||
| 1080 | Ga0495662_0025102 | |||
| 1081 | Ga0495594_0000021 | |||
| 1082 | Ga0495606_0000219 | |||
| 1083 | Ga0495608_0000001 | |||
| 1084 | Ga0495608_0000353 | |||
| 1085 | Ga0495618_0000003 | |||
| 1086 | Ga0495620_0000060 | |||
| 1087 | Ga0495628_0001751 | |||
| 1088 | Ga0495628_0010777 | |||
| 1089 | Ga0495628_0041635 | |||
| 1090 | Ga0495630_0000227 | |||
| 1091 | Ga0495630_0011354 | |||
| 1092 | Ga0495630_0073551 | |||
| 1093 | Ga0495637_0105238 | |||
| 1094 | Ga0495644_0054959 | |||
| 1095 | Ga0495652_0000086 | |||
| 1096 | Ga0495652_0009255 | |||
| 1097 | Ga0495652_0058595 | |||
| 1098 | Ga0495640_0009944 | |||
| 1099 | Ga0495640_0024171 | |||
| 1100 | Ga0495640_0153274 | |||
| 1101 | Ga0495586_0012295 | |||
| 1102 | Ga0495587_0031291 | |||
| 1103 | Ga0495587_0044578 | |||
| 1104 | Ga0495587_0213091 | |||
| 1105 | Ga0495645_0002782 | |||
| 1106 | Ga0495622_0004723 | |||
| 1107 | Ga0495667_0000327 | |||
| 1108 | Ga0495667_0083518 | |||
| 1109 | Ga0495656_0003147 | |||
| 1110 | Ga0495634_0000030 | |||
| 1111 | Ga0495634_0000379 | |||
| 1112 | Ga0495634_0026067 | |||
| 1113 | Ga0495634_0033763 | |||
| 1114 | Ga0495625_0000960 | |||
| 1115 | Ga0495635_0000009 | |||
| 1116 | Ga0495635_0196177 | |||
| 1117 | Ga0495588_0000179 | |||
| 1118 | Ga0495657_0000002 | |||
| 1119 | Ga0495657_0040414 | |||
| 1120 | Ga0495599_0341949 | |||
| 1121 | Ga0495647_0000006 | |||
| 1122 | Ga0495647_0000053 | |||
| 1123 | Ga0495647_0141511 | |||
| 1124 | Ga0495658_0000190 | |||
| 1125 | Ga0495658_0002094 | |||
| 1126 | Ga0495669_0001855 | |||
| 1127 | Ga0495613_0000003 | |||
| 1128 | Ga0495613_0000242 | |||
| 1129 | Ga0495624_0000002 | |||
| 1130 | Ga0495624_0199373 | |||
| 1131 | Ga0495649_0199798 | |||
| 1132 | Ga0495600_0000467 | |||
| 1133 | Ga0495600_0010012 | |||
| 1134 | Ga0495604_0000033 | |||
| 1135 | Ga0495604_0001604 | |||
| 1136 | Ga0495604_0063165 | |||
| 1137 | Ga0495674_0000007 | |||
| 1138 | Ga0495676_0001744 | |||
| 1139 | Ga0495676_0006848 | |||
| 1140 | Ga0495676_0193041 | |||
| 1141 | Ga0495680_0000272 | |||
| 1142 | Ga0495680_0001303 | |||
| 1143 | Ga0495680_0005371 | |||
| 1144 | Ga0495680_0241414 | |||
| 1145 | Ga0495675_0000162 | |||
| 1146 | Ga0495675_0066227 | |||
| 1147 | Ga0495684_0270347 | |||
| 1148 | Ga0495686_0080264 | |||
| 1149 | Ga0495593_0052051 | |||
| 1150 | Ga0495593_0114588 | |||
| 1151 | Ga0495602_0000063 | |||
| 1152 | Ga0495602_0000188 | |||
| 1153 | Ga0495602_0056594 | |||
| 1154 | Ga0496100_0000004 | |||
| 1155 | Ga0496100_0000046 | |||
| 1156 | Ga0496101_0000007 | |||
| 1157 | Ga0496101_0000124 | |||
| 1158 | Ga0496102_0000404 | |||
| 1159 | Ga0496102_0013913 | |||
| 1160 | Ga0496102_0126421 | |||
| 1161 | Ga0496102_0240311 | |||
| 1162 | Ga0496103_0000001 | |||
| 1163 | Ga0496103_0011805 | |||
| 1164 | Ga0496103_0015494 | |||
| 1165 | Ga0496104_0000002 | |||
| 1166 | Ga0496104_0000003 | |||
| 1167 | Ga0496104_0000139 | |||
| 1168 | Ga0496104_0003874 | |||
| 1169 | Ga0496104_0055019 | |||
| 1170 | Ga0496105_0000001 | |||
| 1171 | Ga0496105_0000008 | |||
| 1172 | Ga0496105_0000054 | |||
| 1173 | Ga0496105_0043820 | |||
| 1174 | Ga0496105_0077590 | |||
| 1175 | Ga0496106_0000004 | |||
| 1176 | Ga0496106_0000059 | |||
| 1177 | Ga0496106_0000239 | |||
| 1178 | Ga0496106_0013880 | |||
| 1179 | Ga0496106_0082773 | |||
| 1180 | Ga0496107_0000001 | |||
| 1181 | Ga0496107_0000018 | |||
| 1182 | Ga0496107_0013156 | |||
| 1183 | Ga0496108_0000002 | |||
| 1184 | Ga0496108_0000012 | |||
| 1185 | Ga0496108_0002243 | |||
| 1186 | Ga0496108_0005210 | |||
| 1187 | Ga0496108_0015619 | |||
| 1188 | Ga0496108_0155722 | |||
| 1189 | Ga0496109_0000001 | |||
| 1190 | Ga0496109_0000035 | |||
| 1191 | Ga0496109_0000246 | |||
| 1192 | Ga0496109_0000291 | |||
| 1193 | Ga0496109_0175693 | |||
| 1194 | Ga0496109_0720916 | |||
| 1195 | Ga0496110_0000476 | |||
| 1196 | Ga0496110_0035346 | |||
| 1197 | Ga0496110_0095687 | |||
| 1198 | Ga0496110_0100291 | |||
| 1199 | Ga0496111_0000354 | |||
| 1200 | Ga0496111_0000772 | |||
| 1201 | Ga0496111_0111137 | |||
| 1202 | Ga0496111_0244594 | |||
| 1203 | Ga0496111_0441453 | |||
| 1204 | Ga0496112_0000002 | |||
| 1205 | Ga0496112_0240676 | |||
| 1206 | Ga0496113_0000010 | |||
| 1207 | Ga0496113_0005366 | |||
| 1208 | Ga0496113_0006303 | |||
| 1209 | Ga0496113_0018186 | |||
| 1210 | Ga0496113_0303940 | |||
| 1211 | Ga0496114_0000043 | |||
| 1212 | Ga0496114_0005502 | |||
| 1213 | Ga0496114_0019454 | |||
| 1214 | Ga0496115_0000004 | |||
| 1215 | Ga0496115_0000211 | |||
| 1216 | Ga0496115_0050523 | |||
| 1217 | Ga0496115_0088199 | |||
| 1218 | Ga0496116_0000229 | |||
| 1219 | Ga0496117_0005642 | |||
| 1220 | Ga0496118_0002667 | |||
| 1221 | Ga0496118_0067099 | |||
| 1222 | Ga0496119_0006136 | |||
| 1223 | Ga0496119_0019921 | |||
| 1224 | Ga0496119_0031215 | |||
| 1225 | Ga0496120_0011767 | |||
| 1226 | Ga0496120_0039736 | |||
| 1227 | Ga0496121_0251465 | |||
| 1228 | Ga0496124_0132393 | |||
| 1229 | Ga0496126_0078174 | |||
| 1230 | Ga0501031_0009627 | |||
| 1231 | Ga0501032_0003351 | |||
| 1232 | Ga0501033_0003740 | |||
| 1233 | Ga0501034_0000725 | |||
| 1234 | Ga0501034_0028502 | |||
| 1235 | Ga0501036_0003647 | |||
| 1236 | Ga0501036_0259512 | |||
| 1237 | Ga0501037_0002974 | |||
| 1238 | Ga0501038_0000228 | |||
| 1239 | Ga0501039_0053926 | |||
| 1240 | Ga0501039_0059864 | |||
| 1241 | Ga0501039_0285246 | |||
| 1242 | Ga0501039_0424972 | |||
| 1243 | Ga0501040_0061447 | |||
| 1244 | Ga0501040_0080845 | |||
| 1245 | Ga0501041_0310815 | |||
| 1246 | Ga0501042_0011450 | |||
| 1247 | Ga0501042_0030342 | |||
| 1248 | Ga0501043_0003860 | |||
| 1249 | Ga0501046_0001430 | |||
| 1250 | Ga0501047_0000413 | |||
| 1251 | Ga0501047_0004433 | |||
| 1252 | Ga0501048_0000807 | |||
| 1253 | Ga0501067_0202836 | |||
| 1254 | Ga0501068_0071189 | |||
| 1255 | Ga0501068_0187768 | |||
| 1256 | Ga0501069_0004856 | |||
| 1257 | Ga0501069_0067442 | |||
| 1258 | Ga0501070_0004278 | |||
| 1259 | Ga0501070_0007739 | |||
| 1260 | Ga0501070_0176174 | |||
| 1261 | Ga0501070_0357719 | |||
| 1262 | Ga0501071_0325491 | |||
| 1263 | Ga0501072_0018835 | |||
| 1264 | Ga0501072_0158735 | |||
| 1265 | Ga0501072_0186126 | |||
| 1266 | Ga0501072_0280712 | |||
| 1267 | Ga0501073_0137619 | |||
| 1268 | Ga0501074_0145747 | |||
| 1269 | Ga0501075_0006466 | |||
| 1270 | Ga0501075_0445053 | |||
| 1271 | Ga0501076_0005956 | |||
| 1272 | Ga0501076_0070967 | |||
| 1273 | Ga0501076_0628049 | |||
| 1274 | Ga0501077_0100170 | |||
| 1275 | Ga0501079_0129621 | |||
| 1276 | Ga0501079_0339868 | |||
| 1277 | Ga0501079_0410655 | |||
| 1278 | Ga0501080_0022082 | |||
| 1279 | Ga0501080_0299639 | |||
| 1280 | Ga0501080_0450406 | |||
| 1281 | Ga0501081_0464170 | |||
| 1282 | Ga0501083_0002732 | |||
| 1283 | Ga0501083_0247137 | |||
| 1284 | Ga0501035_0000421 | |||
| 1285 | Ga0501035_0194986 | |||
| 1286 | Ga0501044_0000270 | |||
| 1287 | Ga0501044_0208517 | |||
| 1288 | Ga0501044_0498532 | |||
| 1289 | Ga0501045_0002713 | |||
| 1290 | nmdc:mga03n38_186692_c1 | |||
| 1291 | nmdc:mga03n38_262787_c1 | |||
| 1292 | nmdc:mga03n38_42069_c1 | |||
| 1293 | nmdc:mga00v17_13597_c1 | |||
| 1294 | nmdc:mga00v17_50406_c1 | |||
| 1295 | nmdc:mga00v17_67807_c1 | |||
| 1296 | nmdc:mga0yw44_139281_c1 | |||
| 1297 | nmdc:mga0yw44_308154_c1 | |||
| 1298 | nmdc:mga0yw44_39956_c1 | |||
| 1299 | nmdc:mga0yw44_50750_c1 | |||
| 1300 | nmdc:mga0yw44_5084_c1 | |||
| 1301 | nmdc:mga05p37_106394_c1 | |||
| 1302 | nmdc:mga05p37_60498_c1 | |||
| 1303 | nmdc:mga06r32_166059_c1 | |||
| 1304 | nmdc:mga06r32_17794_c1 | |||
| 1305 | nmdc:mga06r32_674875_c1 | |||
| 1306 | nmdc:mga08y16_11543_c1 | |||
| 1307 | nmdc:mga08y16_152376_c1 | |||
| 1308 | nmdc:mga08y16_287862_c1 | |||
| 1309 | nmdc:mga0n895_18785_c1 | |||
| 1310 | nmdc:mga0n895_487575_c1 | |||
| 1311 | nmdc:mga0rr50_46027_c1 | |||
| 1312 | nmdc:mga0a205_1968_c1 | |||
| 1313 | nmdc:mga0a205_1_c1 | |||
| 1314 | nmdc:mga0a205_59419_c1 | |||
| 1315 | Ga0495601_0000012 | |||
| 1316 | Ga0495601_0000271 | |||
| 1317 | Ga0495601_0038157 | |||
| 1318 | Ga0495601_0076429 | |||
| 1319 | Ga0495612_0000168 | |||
| 1320 | Ga0495612_0011594 | |||
| 1321 | Ga0495612_0056088 | |||
| 1322 | Ga0495612_0060328 | |||
| 1323 | Ga0495655_0000016 | |||
| 1324 | Ga0495655_0003962 | |||
| 1325 | Ga0495595_0000001 | |||
| 1326 | Ga0495595_0034679 | |||
| 1327 | Ga0495595_0144203 | |||
| 1328 | Ga0495619_0000018 | |||
| 1329 | Ga0495619_0000041 | |||
| 1330 | Ga0495619_0000708 | |||
| 1331 | Ga0495619_0001128 | |||
| 1332 | Ga0495619_0001674 | |||
| 1333 | Ga0495619_0003448 | |||
| 1334 | Ga0495619_0004182 | |||
| 1335 | Ga0495619_0032355 | |||
| 1336 | Ga0500566_0003650 | |||
| 1337 | Ga0500554_071950 | |||
| 1338 | Ga0500614_055431 | |||
| 1339 | Ga0500628_000027 | |||
| 1340 | Ga0501084_0024286 | |||
| 1341 | Ga0501084_0160100 | |||
| 1342 | Ga0501084_0338584 | |||
| 1343 | Ga0501082_0061246 | |||
| 1344 | Ga0501082_0086822 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2yb4-assembly1.cif.gz_A | structure of an amidohydrolase from chromobacterium violaceum (efi target efi-500202) with bound so4, no metal | 0.8876 | 2 | 262 |
| 3e0f-assembly1.cif.gz_A | crystal structure of a putative metal-dependent phosphoesterase (bad_1165) from bifidobacterium adolescentis atcc 15703 at 2.40 a resolution | 0.8702 | 2 | 254 |
| 2yb4-assembly1.cif.gz_A | structure of an amidohydrolase from chromobacterium violaceum (efi target efi-500202) with bound so4, no metal | 0.8629 | 2 | 262 |
| 7ug9-assembly1.cif.gz_A | crystal structure of rnase am php domain | 0.8445 | 1 | 252 |
| 3e0f-assembly1.cif.gz_A | crystal structure of a putative metal-dependent phosphoesterase (bad_1165) from bifidobacterium adolescentis atcc 15703 at 2.40 a resolution | 0.822 | 2 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2yb4A02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.8296 | 96 | 163 | 1.10.150.650 |
| 3e0fA01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8193 | 2 | 254 | 3.20.20.140 |
| 2yb4A01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8177 | 2 | 262 | 3.20.20.140 |
| 2yb4A02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.7708 | 96 | 163 | 1.10.150.650 |
| af_Q58842_163_361_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7644 | 12 | 57 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537YU32-F1-model_v4 | PHP domain-containing protein | 0.9941 | 1 | 268 |
GO:0004534
GO:0035312 |
| AF-A0A537YU32-F1-model_v4 | PHP domain-containing protein | 0.9904 | 1 | 268 |
GO:0004534
GO:0035312 |
| AF-A0A535JZJ8-F1-model_v4 | PHP domain-containing protein | 0.984 | 2 | 80 |
GO:0004534
GO:0035312 |
| AF-A0A3C1D6Y6-F1-model_v4 | Phosphatase | 0.9806 | 1 | 78 |
GO:0004534
GO:0035312 |
| AF-A0A3B8TRU9-F1-model_v4 | deleted | 0.9801 | 2 | 78 |
|