F474223

General Info

Members Datasets Scaffolds Average Seq Length
672 308 1344 269

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100665265|Ga0075431_1006652651
Length 307
Sequence MPTTHGVCGDRNAPSFSTSAWPGWRRFGRDRCHTAAALLDLQSHSIYSDGELTPAGVVAAAADAGVTTLALTDHDAVTGIEEAAYAAEQHGLTLVPAAEISCVHDQLDDLHMLGYWIDPKALAPACERAQQERVTRAEEIVGKLNSLGVEVSFEDAIAQAGDASSVGRPHIAKAAGTKPEQMSAFFEEYLVPGAKAFVSRRWPTAAEAIDLIRGAGGVPVLAHPFWDLDDPKAVAALIDDLAIDGVEVFYPAHDHDQTKFLVDLCAERGLTATGSSDFHGPNHKQFNRFGSYPTYDFGEPELPRKPT

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
158 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
159 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
160 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
163 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
175 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
300 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
304 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
305 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
306 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 0
Rhizoplane 9.52
Rhizosphere 84.52
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100665265 3300006847 Bacteria 1021
2 JGI24746J21847_1000617 3300001977 Bacteria 5421
3 JGI24740J21852_10005220 3300001979 Bacteria 5515
4 JGI24735J21928_10042010 3300002067 Bacteria 1332
5 JGI24748J21848_1000223 3300002074 Bacteria 6959
6 JGI24742J22300_10001281 3300002244 Bacteria 3946
7 JGI25404J52841_10000203 3300003659 Bacteria 7129
8 Ga0070658_10071798 3300005327 Bacteria 2836
9 Ga0070683_100000481 3300005329 Bacteria 28092
10 Ga0070683_100001210 3300005329 Bacteria 19627
11 Ga0070683_100011934 3300005329 Bacteria 7534
12 Ga0070683_100036323 3300005329 Bacteria 4508
13 Ga0070683_100139733 3300005329 Bacteria 2294
14 Ga0070670_100049915 3300005331 Bacteria 3597
15 Ga0070670_100079304 3300005331 Bacteria 2822
16 Ga0070677_10000396 3300005333 Bacteria 15177
17 Ga0070666_10088224 3300005335 Bacteria 2128
18 Ga0070680_100144869 3300005336 Bacteria 1993
19 Ga0070682_100000057 3300005337 Bacteria 108832
20 Ga0070682_100000629 3300005337 Bacteria 21403
21 Ga0070682_100004924 3300005337 Bacteria 7414
22 Ga0070682_100049978 3300005337 Bacteria 2609
23 Ga0068868_100000008 3300005338 Bacteria 121926
24 Ga0068868_100083335 3300005338 Bacteria 2567
25 Ga0070689_100084749 3300005340 Bacteria 2491
26 Ga0070691_10000010 3300005341 Bacteria 58327
27 Ga0070691_10000175 3300005341 Bacteria 20958
28 Ga0070691_10115987 3300005341 Bacteria 1344
29 Ga0070661_100000365 3300005344 Bacteria 35698
30 Ga0070661_100041945 3300005344 Bacteria 3339
31 Ga0070661_100371855 3300005344 Unclassified 1125
32 Ga0070692_10049295 3300005345 Bacteria 2184
33 Ga0070668_100006745 3300005347 Bacteria 8507
34 Ga0070668_100048845 3300005347 Bacteria 3255
35 Ga0070668_100366971 3300005347 Bacteria 1222
36 Ga0070675_100002793 3300005354 Bacteria 13150
37 Ga0070675_100315950 3300005354 Bacteria 1379
38 Ga0070674_100000003 3300005356 Bacteria 258221
39 Ga0070674_100000016 3300005356 Bacteria 91058
40 Ga0070674_100047945 3300005356 Bacteria 2930
41 Ga0070674_100054728 3300005356 Bacteria 2761
42 Ga0070674_100176930 3300005356 Bacteria 1631
43 Ga0070673_100068006 3300005364 Bacteria 2851
44 Ga0070688_100001580 3300005365 Bacteria 11373
45 Ga0070688_100009726 3300005365 Bacteria 5277
46 Ga0070688_100016010 3300005365 Bacteria 4278
47 Ga0070688_100018164 3300005365 Bacteria 4053
48 Ga0070659_100008696 3300005366 Bacteria 7426
49 Ga0070659_100014138 3300005366 Bacteria 5956
50 Ga0070659_100019608 3300005366 Bacteria 5129
51 Ga0070667_100002889 3300005367 Bacteria 14766
52 Ga0070667_100229586 3300005367 Bacteria 1654
53 Ga0070714_100031777 3300005435 Bacteria 4407
54 Ga0070713_100000055 3300005436 Bacteria 70759
55 Ga0070710_10047102 3300005437 Bacteria 2404
56 Ga0070710_10211997 3300005437 Unclassified 1228
57 Ga0070711_100004268 3300005439 Bacteria 8407
58 Ga0070700_100019287 3300005441 Bacteria 3933
59 Ga0070700_100099501 3300005441 Bacteria 1913
60 Ga0070663_100001559 3300005455 Bacteria 12623
61 Ga0070663_100002524 3300005455 Bacteria 10336
62 Ga0070678_100021199 3300005456 Bacteria 4280
63 Ga0070662_100000039 3300005457 Bacteria 74491
64 Ga0070662_100036309 3300005457 Bacteria 3485
65 Ga0070681_10008875 3300005458 Bacteria 9879
66 Ga0070681_10268959 3300005458 Bacteria 1616
67 Ga0068867_100027246 3300005459 Bacteria 4106
68 Ga0068867_100027776 3300005459 Bacteria 4070
69 Ga0070685_10000545 3300005466 Bacteria 21142
70 Ga0070685_10006443 3300005466 Bacteria 5987
71 Ga0070685_10062191 3300005466 Bacteria 2189
72 Ga0070679_100004239 3300005530 Bacteria 13233
73 Ga0070679_100007525 3300005530 Bacteria 10187
74 Ga0070684_100020721 3300005535 Bacteria 5454
75 Ga0070684_100023080 3300005535 Bacteria 5196
76 Ga0070684_100027962 3300005535 Bacteria 4766
77 Ga0070684_100079875 3300005535 Bacteria 2893
78 Ga0070684_100085793 3300005535 Bacteria 2792
79 Ga0068853_100045486 3300005539 Bacteria 3760
80 Ga0068853_100081011 3300005539 Bacteria 2842
81 Ga0068853_100198726 3300005539 Bacteria 1824
82 Ga0070672_100000057 3300005543 Bacteria 50189
83 Ga0070672_100005836 3300005543 Bacteria 8213
84 Ga0070686_100044154 3300005544 Bacteria 2799
85 Ga0070686_100107235 3300005544 Bacteria 1897
86 Ga0070693_100001114 3300005547 Bacteria 12060
87 Ga0070693_100203879 3300005547 Bacteria 1286
88 Ga0070665_100000128 3300005548 Bacteria 142568
89 Ga0070665_100019618 3300005548 Bacteria 6787
90 Ga0070665_100049511 3300005548 Bacteria 4215
91 Ga0070665_100160313 3300005548 Bacteria 2251
92 Ga0070704_100280022 3300005549 Bacteria 1381
93 Ga0068855_100170569 3300005563 Bacteria 2465
94 Ga0070664_100016179 3300005564 Bacteria 6112
95 Ga0070664_100022744 3300005564 Bacteria 5170
96 Ga0068857_100264891 3300005577 Bacteria 1578
97 Ga0068857_100676254 3300005577 Bacteria 979
98 Ga0068854_100000525 3300005578 Bacteria 23234
99 Ga0068856_100000057 3300005614 Bacteria 102045
100 Ga0068856_100006604 3300005614 Bacteria 11368
101 Ga0068856_100016805 3300005614 Bacteria 7090
102 Ga0068856_100265616 3300005614 Bacteria 1732
103 Ga0070702_100037764 3300005615 Bacteria 2684
104 Ga0068852_100000007 3300005616 Bacteria 158670
105 Ga0068852_100023801 3300005616 Bacteria 4937
106 Ga0068859_100036381 3300005617 Bacteria 4943
107 Ga0068864_100000035 3300005618 Bacteria 195218
108 Ga0068866_10000002 3300005718 Bacteria 394090
109 Ga0068866_10000148 3300005718 Bacteria 31770
110 Ga0068866_10021772 3300005718 Bacteria 2957
111 Ga0068861_100082457 3300005719 Bacteria 2520
112 Ga0068851_10003763 3300005834 Bacteria 6784
113 Ga0068851_10020414 3300005834 Bacteria 3209
114 Ga0068851_10024605 3300005834 Bacteria 2949
115 Ga0068863_100000415 3300005841 Bacteria 43505
116 Ga0068863_100002803 3300005841 Bacteria 17275
117 Ga0068863_100190462 3300005841 Bacteria 1971
118 Ga0068858_100000218 3300005842 Bacteria 61860
119 Ga0068858_100001041 3300005842 Bacteria 28635
120 Ga0068858_100158049 3300005842 Bacteria 2134
121 Ga0068858_100160275 3300005842 Bacteria 2118
122 Ga0068858_100219619 3300005842 Bacteria 1800
123 Ga0068860_100009932 3300005843 Bacteria 9432
124 Ga0068860_100101220 3300005843 Bacteria 2749
125 Ga0068862_100000391 3300005844 Bacteria 47191
126 Ga0081455_10013769 3300005937 Bacteria 7960
127 Ga0081455_10018091 3300005937 Bacteria 6728
128 Ga0081455_10057768 3300005937 Bacteria 3287
129 Ga0081455_10156075 3300005937 Bacteria 1754
130 Ga0081455_10211351 3300005937 Bacteria 1445
131 Ga0081538_10000296 3300005981 Bacteria 57287
132 Ga0081538_10012468 3300005981 Bacteria 6812
133 Ga0081538_10018156 3300005981 Bacteria 5300
134 Ga0081540_1005483 3300005983 Bacteria 9466
135 Ga0081539_10002725 3300005985 Bacteria 23894
136 Ga0081539_10016707 3300005985 Bacteria 5214
137 Ga0075365_10002481 3300006038 Bacteria 9066
138 Ga0075365_10003158 3300006038 Bacteria 8407
139 Ga0075365_10035347 3300006038 Bacteria 3232
140 Ga0075365_10046303 3300006038 Bacteria 2856
141 Ga0075365_10203771 3300006038 Bacteria 1386
142 Ga0075365_10360597 3300006038 Bacteria 1025
143 Ga0075368_10041580 3300006042 Bacteria 1806
144 Ga0075363_100026884 3300006048 Bacteria 2947
145 Ga0075363_100053188 3300006048 Bacteria 2163
146 Ga0075364_10017607 3300006051 Bacteria 4468
147 Ga0075364_10141275 3300006051 Bacteria 1620
148 Ga0075364_10240656 3300006051 Bacteria 1229
149 Ga0070715_10000003 3300006163 Bacteria 345282
150 Ga0070715_10033497 3300006163 Bacteria 2100
151 Ga0070712_100002058 3300006175 Bacteria 12320
152 Ga0070712_100009870 3300006175 Bacteria 6017
153 Ga0097621_100550548 3300006237 Bacteria 1050
154 Ga0075428_100294506 3300006844 Bacteria 1745
155 Ga0075430_100038867 3300006846 Bacteria 4030
156 Ga0075431_100031537 3300006847 Bacteria 5459
157 Ga0075431_100073391 3300006847 Bacteria 3530
158 Ga0075433_10001496 3300006852 Bacteria 17263
159 Ga0075433_10002936 3300006852 Bacteria 13084
160 Ga0075434_100010015 3300006871 Bacteria 8872
161 Ga0075434_100164213 3300006871 Bacteria 2240
162 Ga0075434_100404488 3300006871 Bacteria 1386
163 Ga0068865_100000009 3300006881 Bacteria 168291
164 Ga0068865_100061472 3300006881 Bacteria 2633
165 Ga0097620_100036381 3300006931 Bacteria 4943
166 Ga0111539_10004463 3300009094 Bacteria 18297
167 Ga0111539_10333572 3300009094 Bacteria 1765
168 Ga0105245_10000012 3300009098 Bacteria 267151
169 Ga0105245_10000077 3300009098 Bacteria 101470
170 Ga0105245_10001697 3300009098 Bacteria 20040
171 Ga0105245_10004922 3300009098 Bacteria 11751
172 Ga0105245_10004991 3300009098 Bacteria 11664
173 Ga0105245_10010946 3300009098 Bacteria 7892
174 Ga0105245_10369980 3300009098 Bacteria 1425
175 Ga0105245_10478094 3300009098 Bacteria 1259
176 Ga0105247_10000208 3300009101 Bacteria 56889
177 Ga0105247_10178977 3300009101 Bacteria 1414
178 Ga0114129_10074895 3300009147 Bacteria 4714
179 Ga0114129_10077098 3300009147 Bacteria 4638
180 Ga0114129_10111505 3300009147 Bacteria 3774
181 Ga0114129_10133836 3300009147 Bacteria 3403
182 Ga0114129_10402259 3300009147 Bacteria 1804
183 Ga0105243_10014256 3300009148 Bacteria 6014
184 Ga0105243_10256466 3300009148 Bacteria 1564
185 Ga0105243_10261873 3300009148 Bacteria 1549
186 Ga0105243_10350897 3300009148 Bacteria 1355
187 Ga0105241_10324451 3300009174 Bacteria 1329
188 Ga0105242_10000010 3300009176 Bacteria 151649
189 Ga0105242_10001414 3300009176 Bacteria 18911
190 Ga0105242_10058034 3300009176 Bacteria 3171
191 Ga0105242_10059547 3300009176 Bacteria 3133
192 Ga0105242_10075784 3300009176 Bacteria 2802
193 Ga0105242_10095441 3300009176 Bacteria 2510
194 Ga0105248_10000022 3300009177 Bacteria 275935
195 Ga0105248_10087690 3300009177 Bacteria 3502
196 Ga0105248_10687813 3300009177 Bacteria 1154
197 Ga0105237_10052868 3300009545 Bacteria 4076
198 Ga0105238_10000321 3300009551 Bacteria 52176
199 Ga0105238_10213592 3300009551 Bacteria 1906
200 Ga0105249_10000192 3300009553 Bacteria 69997
201 Ga0105249_10013993 3300009553 Bacteria 7092
202 Ga0105249_10028741 3300009553 Bacteria 5018
203 Ga0105249_10135836 3300009553 Bacteria 2353
204 Ga0105239_10060776 3300010375 Bacteria 4147
205 Ga0105239_10099990 3300010375 Bacteria 3207
206 Ga0105239_10172723 3300010375 Bacteria 2417
207 Ga0105246_10026116 3300011119 Bacteria 3811
208 Ga0105246_10203728 3300011119 Bacteria 1540
209 Ga0157371_10006260 3300013102 Bacteria 9857
210 Ga0157370_10067067 3300013104 Bacteria 3392
211 Ga0157370_10110965 3300013104 Bacteria 2564
212 Ga0157370_10130342 3300013104 Bacteria 2346
213 Ga0157369_10000118 3300013105 Bacteria 111618
214 Ga0157374_10005906 3300013296 Bacteria 10339
215 Ga0157374_10095055 3300013296 Bacteria 2849
216 Ga0157378_10011673 3300013297 Bacteria 7688
217 Ga0157378_10017504 3300013297 Bacteria 6291
218 Ga0157378_10050602 3300013297 Bacteria 3697
219 Ga0163162_10239225 3300013306 Bacteria 1946
220 Ga0157372_10038776 3300013307 Bacteria 5258
221 Ga0157375_10001092 3300013308 Bacteria 23513
222 Ga0157375_10006876 3300013308 Bacteria 9922
223 Ga0157375_10049665 3300013308 Bacteria 4112
224 Ga0157375_10131926 3300013308 Bacteria 2618
225 Ga0157375_10307148 3300013308 Bacteria 1750
226 Ga0157375_10466337 3300013308 Bacteria 1428
227 Ga0163163_10467912 3300014325 Unclassified 1321
228 Ga0157380_10000249 3300014326 Bacteria 32409
229 Ga0157380_10005261 3300014326 Bacteria 9044
230 Ga0157380_10173269 3300014326 Bacteria 1888
231 Ga0157380_10451726 3300014326 Bacteria 1234
232 Ga0157379_10044400 3300014968 Bacteria 3967
233 Ga0157379_10051072 3300014968 Bacteria 3693
234 Ga0157379_10111567 3300014968 Bacteria 2456
235 Ga0157379_10156977 3300014968 Bacteria 2053
236 Ga0157379_10490546 3300014968 Bacteria 1138
237 Ga0157376_10385504 3300014969 Bacteria 1351
238 Ga0157376_10581355 3300014969 Bacteria 1112
239 Ga0163161_10004856 3300017792 Bacteria 9358
240 Ga0163161_10141320 3300017792 Bacteria 1823
241 Ga0207656_10002454 3300025321 Bacteria 6253
242 Ga0207656_10010149 3300025321 Bacteria 3516
243 Ga0207656_10012896 3300025321 Bacteria 3184
244 Ga0207682_10000380 3300025893 Bacteria 20492
245 Ga0207642_10000001 3300025899 Bacteria 714030
246 Ga0207642_10000003 3300025899 Bacteria 650651
247 Ga0207642_10000004 3300025899 Bacteria 407822
248 Ga0207642_10000051 3300025899 Bacteria 34399
249 Ga0207642_10013216 3300025899 Bacteria 3007
250 Ga0207710_10059721 3300025900 Bacteria 1727
251 Ga0207688_10004076 3300025901 Bacteria 7960
252 Ga0207685_10000003 3300025905 Bacteria 344527
253 Ga0207685_10133521 3300025905 Bacteria 1104
254 Ga0207705_10029153 3300025909 Bacteria 3934
255 Ga0207707_10011056 3300025912 Bacteria 7850
256 Ga0207707_10381322 3300025912 Bacteria 1212
257 Ga0207693_10003350 3300025915 Bacteria 13697
258 Ga0207693_10043150 3300025915 Bacteria 3550
259 Ga0207663_10002464 3300025916 Bacteria 8911
260 Ga0207660_10139153 3300025917 Bacteria 1855
261 Ga0207649_10000024 3300025920 Bacteria 183104
262 Ga0207649_10011147 3300025920 Bacteria 4948
263 Ga0207652_10001557 3300025921 Bacteria 20163
264 Ga0207652_10006321 3300025921 Bacteria 9566
265 Ga0207652_10569020 3300025921 Bacteria 1018
266 Ga0207694_10000008 3300025924 Bacteria 484902
267 Ga0207694_10026190 3300025924 Bacteria 4434
268 Ga0207650_10022678 3300025925 Bacteria 4447
269 Ga0207659_10000062 3300025926 Bacteria 67607
270 Ga0207659_10225173 3300025926 Bacteria 1510
271 Ga0207687_10000011 3300025927 Bacteria 388349
272 Ga0207687_10000012 3300025927 Bacteria 370729
273 Ga0207687_10001579 3300025927 Bacteria 15685
274 Ga0207687_10002910 3300025927 Bacteria 11615
275 Ga0207687_10046298 3300025927 Bacteria 3011
276 Ga0207700_10000009 3300025928 Bacteria 314953
277 Ga0207664_10076341 3300025929 Bacteria 2712
278 Ga0207644_10047351 3300025931 Bacteria 3068
279 Ga0207690_10013252 3300025932 Bacteria 4950
280 Ga0207706_10000026 3300025933 Bacteria 149379
281 Ga0207686_10000271 3300025934 Bacteria 38452
282 Ga0207686_10001505 3300025934 Bacteria 13123
283 Ga0207686_10041038 3300025934 Bacteria 2819
284 Ga0207686_10147082 3300025934 Bacteria 1636
285 Ga0207709_10008821 3300025935 Bacteria 5561
286 Ga0207709_10160164 3300025935 Bacteria 1569
287 Ga0207709_10225073 3300025935 Bacteria 1355
288 Ga0207669_10000023 3300025937 Bacteria 96638
289 Ga0207669_10000064 3300025937 Bacteria 52977
290 Ga0207669_10014220 3300025937 Bacteria 3984
291 Ga0207669_10049282 3300025937 Bacteria 2509
292 Ga0207669_10081452 3300025937 Bacteria 2074
293 Ga0207704_10000004 3300025938 Bacteria 239295
294 Ga0207704_10280715 3300025938 Unclassified 1266
295 Ga0207691_10000642 3300025940 Bacteria 34532
296 Ga0207691_10003031 3300025940 Bacteria 16392
297 Ga0207711_10000019 3300025941 Bacteria 412779
298 Ga0207711_10180171 3300025941 Bacteria 1921
299 Ga0207661_10000166 3300025944 Bacteria 42698
300 Ga0207661_10006101 3300025944 Bacteria 8513
301 Ga0207661_10008277 3300025944 Bacteria 7430
302 Ga0207661_10036097 3300025944 Bacteria 3856
303 Ga0207661_10390934 3300025944 Bacteria 1260
304 Ga0207661_10716266 3300025944 Unclassified 921
305 Ga0207679_10013404 3300025945 Bacteria 5375
306 Ga0207679_10079809 3300025945 Bacteria 2497
307 Ga0207667_10045130 3300025949 Bacteria 4668
308 Ga0207712_10000003 3300025961 Bacteria 615314
309 Ga0207712_10004857 3300025961 Bacteria 8497
310 Ga0207712_10046712 3300025961 Bacteria 3003
311 Ga0207668_10223300 3300025972 Bacteria 1514
312 Ga0207640_10000059 3300025981 Bacteria 90901
313 Ga0207640_10012280 3300025981 Bacteria 4874
314 Ga0207658_10001012 3300025986 Bacteria 22933
315 Ga0207658_10052890 3300025986 Bacteria 2998
316 Ga0207658_10306500 3300025986 Bacteria 1370
317 Ga0207677_10000142 3300026023 Bacteria 58625
318 Ga0207703_10000028 3300026035 Bacteria 208682
319 Ga0207703_10000153 3300026035 Bacteria 79352
320 Ga0207703_10104092 3300026035 Bacteria 2411
321 Ga0207639_10000298 3300026041 Bacteria 35257
322 Ga0207639_10023840 3300026041 Bacteria 4422
323 Ga0207639_10182319 3300026041 Bacteria 1787
324 Ga0207678_10000683 3300026067 Bacteria 31055
325 Ga0207678_10001490 3300026067 Bacteria 21462
326 Ga0207708_10051241 3300026075 Bacteria 3142
327 Ga0207708_10131430 3300026075 Bacteria 1957
328 Ga0207702_10000027 3300026078 Bacteria 183792
329 Ga0207702_10010473 3300026078 Bacteria 7755
330 Ga0207702_10016462 3300026078 Bacteria 6120
331 Ga0207702_10511061 3300026078 Bacteria 1172
332 Ga0207641_10000072 3300026088 Bacteria 151067
333 Ga0207641_10004111 3300026088 Bacteria 12684
334 Ga0207641_10601707 3300026088 Bacteria 1076
335 Ga0207648_10030144 3300026089 Bacteria 4808
336 Ga0207648_10045418 3300026089 Bacteria 3853
337 Ga0207676_10000026 3300026095 Bacteria 248593
338 Ga0207674_10167069 3300026116 Bacteria 2154
339 Ga0207674_10865770 3300026116 Bacteria 871
340 Ga0207675_100116954 3300026118 Bacteria 2520
341 Ga0207683_10033093 3300026121 Bacteria 4490
342 Ga0207698_10000002 3300026142 Bacteria 404991
343 Ga0207698_10032602 3300026142 Bacteria 3776
344 Ga0207428_10127293 3300027907 Bacteria 1950
345 Ga0207428_10151168 3300027907 Bacteria 1767
346 Ga0268266_10000503 3300028379 Bacteria 55789
347 Ga0268266_10002461 3300028379 Bacteria 19801
348 Ga0268266_10089007 3300028379 Bacteria 2702
349 Ga0268266_10134732 3300028379 Bacteria 2211
350 Ga0268265_10000440 3300028380 Bacteria 43839
351 Ga0268264_10006776 3300028381 Bacteria 9622
352 Ga0268264_10096040 3300028381 Bacteria 2566
353 Ga0268264_10201875 3300028381 Bacteria 1819
354 Ga0265337_1000025 3300028556 Bacteria 70787
355 Ga0265326_10000015 3300028558 Bacteria 159279
356 Ga0265319_1000244 3300028563 Bacteria 40899
357 Ga0265322_10000003 3300028654 Bacteria 468671
358 Ga0265338_10000047 3300028800 Bacteria 220905
359 Ga0265324_10000074 3300029957 Bacteria 78102
360 Ga0265320_10000001 3300031240 Bacteria 847191
361 Ga0265325_10023820 3300031241 Bacteria 3336
362 Ga0265329_10047170 3300031242 Bacteria 1375
363 Ga0265331_10000665 3300031250 Bacteria 29661
364 Ga0265327_10000003 3300031251 Bacteria 852750
365 Ga0265316_10017500 3300031344 Bacteria 6190
366 Ga0265314_10000222 3300031711 Bacteria 84593
367 Ga0316576_10005303 3300031727 Bacteria 7853
368 Ga0316578_10177916 3300031728 Bacteria 1282
369 Ga0307406_10179138 3300031901 Bacteria 1541
370 Ga0373937_0052396 3300036401 Bacteria 3741
371 Ga0316582_0246926 3300036647 Bacteria 1223
372 Ga0316582_0323740 3300036647 Bacteria 1060
373 Ga0316584_0000455 3300036712 Bacteria 21270
374 Ga0316584_0058646 3300036712 Bacteria 2882
375 Ga0316584_0249667 3300036712 Bacteria 1296
376 Ga0395899_0125736 3300037312 Bacteria 1834
377 Ga0395900_0025358 3300037418 Bacteria 6070
378 Ga0395898_0006261 3300037466 Bacteria 12731
379 Ga0395898_0098328 3300037466 Bacteria 2810
380 Ga0395898_0438953 3300037466 Unclassified 1244
381 Ga0395905_0014463 3300037471 Bacteria 7533
382 Ga0395905_0301860 3300037471 Bacteria 1489
383 Ga0395901_0005346 3300038443 Bacteria 12975
384 Ga0395901_0016362 3300038443 Bacteria 7551
385 Ga0395901_0155151 3300038443 Bacteria 2405
386 Ga0451853_2126818 3300041512 Bacteria 2064
387 Ga0466963_0159606 3300044694 Unclassified 1569
388 Ga0466963_0177788 3300044694 Bacteria 1485
389 Ga0466957_0003873 3300044842 Bacteria 8269
390 Ga0466958_0268819 3300045836 Unclassified 1092
391 Ga0466967_0000008 3300045976 Bacteria 127135
392 Ga0466967_0098304 3300045976 Bacteria 2672
393 Ga0495592_0000497 3300046454 Bacteria 28666
394 Ga0495603_0000044 3300046455 Bacteria 53548
395 Ga0495603_0001036 3300046455 Bacteria 16063
396 Ga0495603_0005586 3300046455 Bacteria 7510
397 Ga0495629_0001573 3300046459 Bacteria 17953
398 Ga0495629_0071080 3300046459 Bacteria 2429
399 Ga0495629_0100485 3300046459 Bacteria 2018
400 Ga0495629_0105299 3300046459 Bacteria 1967
401 Ga0495629_0327975 3300046459 Bacteria 1046
402 Ga0495641_0000012 3300046461 Bacteria 144818
403 Ga0495641_0005689 3300046461 Bacteria 8305
404 Ga0495641_0029378 3300046461 Bacteria 2649
405 Ga0495651_0161981 3300046462 Bacteria 1602
406 Ga0495582_0000307 3300046473 Bacteria 27037
407 Ga0495662_0000006 3300046476 Bacteria 79206
408 Ga0495662_0025102 3300046476 Bacteria 2877
409 Ga0495594_0000021 3300046499 Bacteria 74679
410 Ga0495606_0000219 3300046507 Bacteria 101614
411 Ga0495608_0000001 3300046511 Bacteria 411278
412 Ga0495608_0000353 3300046511 Bacteria 32170
413 Ga0495618_0000003 3300046514 Bacteria 256269
414 Ga0495620_0000060 3300046515 Bacteria 95642
415 Ga0495628_0001751 3300046516 Bacteria 19729
416 Ga0495628_0010777 3300046516 Bacteria 7741
417 Ga0495628_0041635 3300046516 Bacteria 3667
418 Ga0495630_0000227 3300046517 Bacteria 44643
419 Ga0495630_0011354 3300046517 Bacteria 6447
420 Ga0495630_0073551 3300046517 Bacteria 2574
421 Ga0495637_0105238 3300046520 Bacteria 1099
422 Ga0495644_0054959 3300046523 Unclassified 1495
423 Ga0495652_0000086 3300046529 Bacteria 99373
424 Ga0495652_0009255 3300046529 Bacteria 8955
425 Ga0495652_0058595 3300046529 Bacteria 3260
426 Ga0495640_0009944 3300046533 Bacteria 7376
427 Ga0495640_0024171 3300046533 Bacteria 4421
428 Ga0495640_0153274 3300046533 Bacteria 1480
429 Ga0495586_0012295 3300046535 Bacteria 4543
430 Ga0495587_0031291 3300046536 Bacteria 3223
431 Ga0495587_0044578 3300046536 Bacteria 2638
432 Ga0495587_0213091 3300046536 Bacteria 1090
433 Ga0495645_0002782 3300046543 Bacteria 11864
434 Ga0495622_0004723 3300046557 Bacteria 6311
435 Ga0495667_0000327 3300046559 Bacteria 30003
436 Ga0495667_0083518 3300046559 Bacteria 2074
437 Ga0495656_0003147 3300046615 Bacteria 5554
438 Ga0495634_0000030 3300046642 Bacteria 110741
439 Ga0495634_0000379 3300046642 Bacteria 43465
440 Ga0495634_0026067 3300046642 Bacteria 4082
441 Ga0495634_0033763 3300046642 Bacteria 3514
442 Ga0495625_0000960 3300046660 Bacteria 38405
443 Ga0495635_0000009 3300046663 Bacteria 259024
444 Ga0495635_0196177 3300046663 Bacteria 1370
445 Ga0495588_0000179 3300046674 Bacteria 77030
446 Ga0495657_0000002 3300046675 Bacteria 411958
447 Ga0495657_0040414 3300046675 Bacteria 3199
448 Ga0495599_0341949 3300046678 Bacteria 898
449 Ga0495647_0000006 3300046681 Bacteria 105867
450 Ga0495647_0000053 3300046681 Bacteria 31238
451 Ga0495647_0141511 3300046681 Bacteria 1026
452 Ga0495658_0000190 3300046683 Bacteria 35518
453 Ga0495658_0002094 3300046683 Bacteria 10124
454 Ga0495669_0001855 3300046684 Bacteria 8664
455 Ga0495613_0000003 3300046689 Bacteria 248826
456 Ga0495613_0000242 3300046689 Bacteria 51661
457 Ga0495624_0000002 3300046690 Bacteria 189957
458 Ga0495624_0199373 3300046690 Unclassified 1216
459 Ga0495649_0199798 3300046694 Bacteria 1038
460 Ga0495600_0000467 3300046809 Bacteria 20995
461 Ga0495600_0010012 3300046809 Bacteria 5876
462 Ga0495604_0000033 3300047317 Bacteria 134810
463 Ga0495604_0001604 3300047317 Bacteria 18634
464 Ga0495604_0063165 3300047317 Bacteria 2825
465 Ga0495674_0000007 3300047319 Bacteria 336257
466 Ga0495676_0001744 3300047321 Bacteria 19010
467 Ga0495676_0006848 3300047321 Bacteria 10474
468 Ga0495676_0193041 3300047321 Bacteria 1419
469 Ga0495680_0000272 3300047322 Bacteria 57553
470 Ga0495680_0001303 3300047322 Bacteria 27171
471 Ga0495680_0005371 3300047322 Bacteria 12082
472 Ga0495680_0241414 3300047322 Unclassified 1283
473 Ga0495675_0000162 3300047444 Bacteria 47605
474 Ga0495675_0066227 3300047444 Bacteria 2283
475 Ga0495684_0270347 3300047471 Bacteria 1230
476 Ga0495686_0080264 3300047472 Bacteria 1994
477 Ga0495593_0052051 3300047673 Bacteria 2165
478 Ga0495593_0114588 3300047673 Bacteria 1375
479 Ga0495602_0000063 3300048088 Bacteria 104915
480 Ga0495602_0000188 3300048088 Bacteria 58305
481 Ga0495602_0056594 3300048088 Bacteria 3447
482 Ga0496100_0000004 3300048903 Bacteria 321778
483 Ga0496100_0000046 3300048903 Bacteria 77660
484 Ga0496101_0000007 3300048904 Bacteria 321778
485 Ga0496101_0000124 3300048904 Bacteria 75495
486 Ga0496102_0000404 3300048905 Bacteria 50274
487 Ga0496102_0013913 3300048905 Bacteria 6982
488 Ga0496102_0126421 3300048905 Bacteria 2390
489 Ga0496102_0240311 3300048905 Bacteria 1708
490 Ga0496103_0000001 3300048906 Bacteria 643471
491 Ga0496103_0011805 3300048906 Bacteria 5183
492 Ga0496103_0015494 3300048906 Bacteria 4537
493 Ga0496104_0000002 3300048907 Bacteria 686017
494 Ga0496104_0000003 3300048907 Bacteria 669219
495 Ga0496104_0000139 3300048907 Bacteria 67432
496 Ga0496104_0003874 3300048907 Bacteria 12944
497 Ga0496104_0055019 3300048907 Bacteria 3762
498 Ga0496105_0000001 3300048908 Bacteria 1328178
499 Ga0496105_0000008 3300048908 Bacteria 335652
500 Ga0496105_0000054 3300048908 Bacteria 89081
501 Ga0496105_0043820 3300048908 Bacteria 3690
502 Ga0496105_0077590 3300048908 Bacteria 2743
503 Ga0496106_0000004 3300048909 Bacteria 279896
504 Ga0496106_0000059 3300048909 Bacteria 87781
505 Ga0496106_0000239 3300048909 Bacteria 38253
506 Ga0496106_0013880 3300048909 Bacteria 5953
507 Ga0496106_0082773 3300048909 Bacteria 2467
508 Ga0496107_0000001 3300048910 Bacteria 321778
509 Ga0496107_0000018 3300048910 Bacteria 158433
510 Ga0496107_0013156 3300048910 Bacteria 5780
511 Ga0496108_0000002 3300048911 Bacteria 700890
512 Ga0496108_0000012 3300048911 Bacteria 258433
513 Ga0496108_0002243 3300048911 Bacteria 15470
514 Ga0496108_0005210 3300048911 Bacteria 10508
515 Ga0496108_0015619 3300048911 Bacteria 6193
516 Ga0496108_0155722 3300048911 Bacteria 1973
517 Ga0496109_0000001 3300048912 Bacteria 700852
518 Ga0496109_0000035 3300048912 Bacteria 159744
519 Ga0496109_0000246 3300048912 Bacteria 52127
520 Ga0496109_0000291 3300048912 Bacteria 47681
521 Ga0496109_0175693 3300048912 Bacteria 2010
522 Ga0496109_0720916 3300048912 Bacteria 935
523 Ga0496110_0000476 3300048913 Bacteria 27211
524 Ga0496110_0035346 3300048913 Bacteria 4335
525 Ga0496110_0095687 3300048913 Bacteria 2660
526 Ga0496110_0100291 3300048913 Bacteria 2595
527 Ga0496111_0000354 3300048914 Bacteria 22721
528 Ga0496111_0000772 3300048914 Bacteria 17077
529 Ga0496111_0111137 3300048914 Bacteria 2018
530 Ga0496111_0244594 3300048914 Bacteria 1332
531 Ga0496111_0441453 3300048914 Bacteria 961
532 Ga0496112_0000002 3300048915 Bacteria 782039
533 Ga0496112_0240676 3300048915 Bacteria 1762
534 Ga0496113_0000010 3300048916 Bacteria 86561
535 Ga0496113_0005366 3300048916 Bacteria 7991
536 Ga0496113_0006303 3300048916 Bacteria 7503
537 Ga0496113_0018186 3300048916 Bacteria 4893
538 Ga0496113_0303940 3300048916 Bacteria 1277
539 Ga0496114_0000043 3300048917 Bacteria 131720
540 Ga0496114_0005502 3300048917 Bacteria 9916
541 Ga0496114_0019454 3300048917 Bacteria 5501
542 Ga0496115_0000004 3300048918 Bacteria 319734
543 Ga0496115_0000211 3300048918 Bacteria 54033
544 Ga0496115_0050523 3300048918 Bacteria 3331
545 Ga0496115_0088199 3300048918 Bacteria 2532
546 Ga0496116_0000229 3300048919 Bacteria 104677
547 Ga0496117_0005642 3300048920 Bacteria 13060
548 Ga0496118_0002667 3300048921 Bacteria 23593
549 Ga0496118_0067099 3300048921 Bacteria 2615
550 Ga0496119_0006136 3300048922 Bacteria 11250
551 Ga0496119_0019921 3300048922 Bacteria 4915
552 Ga0496119_0031215 3300048922 Bacteria 3578
553 Ga0496120_0011767 3300048923 Bacteria 5992
554 Ga0496120_0039736 3300048923 Bacteria 2772
555 Ga0496121_0251465 3300048924 Bacteria 1225
556 Ga0496124_0132393 3300048927 Bacteria 1979
557 Ga0496126_0078174 3300048929 Bacteria 2932
558 Ga0501031_0009627 3300049568 Bacteria 6290
559 Ga0501032_0003351 3300049569 Bacteria 12294
560 Ga0501033_0003740 3300049570 Bacteria 12374
561 Ga0501034_0000725 3300049571 Bacteria 49918
562 Ga0501034_0028502 3300049571 Bacteria 5683
563 Ga0501036_0003647 3300049572 Bacteria 12312
564 Ga0501036_0259512 3300049572 Bacteria 1456
565 Ga0501037_0002974 3300049573 Bacteria 12302
566 Ga0501038_0000228 3300049574 Bacteria 47686
567 Ga0501039_0053926 3300049575 Bacteria 3112
568 Ga0501039_0059864 3300049575 Bacteria 2949
569 Ga0501039_0285246 3300049575 Bacteria 1298
570 Ga0501039_0424972 3300049575 Unclassified 1044
571 Ga0501040_0061447 3300049576 Bacteria 2584
572 Ga0501040_0080845 3300049576 Bacteria 2252
573 Ga0501041_0310815 3300049577 Bacteria 994
574 Ga0501042_0011450 3300049578 Bacteria 5986
575 Ga0501042_0030342 3300049578 Bacteria 3817
576 Ga0501043_0003860 3300049579 Bacteria 12317
577 Ga0501046_0001430 3300049580 Bacteria 22944
578 Ga0501047_0000413 3300049581 Bacteria 47712
579 Ga0501047_0004433 3300049581 Bacteria 13217
580 Ga0501048_0000807 3300049582 Bacteria 22984
581 Ga0501067_0202836 3300049583 Bacteria 1104
582 Ga0501068_0071189 3300049584 Bacteria 2122
583 Ga0501068_0187768 3300049584 Bacteria 1308
584 Ga0501069_0004856 3300049585 Bacteria 6962
585 Ga0501069_0067442 3300049585 Bacteria 2001
586 Ga0501070_0004278 3300049586 Bacteria 12279
587 Ga0501070_0007739 3300049586 Bacteria 9107
588 Ga0501070_0176174 3300049586 Bacteria 1760
589 Ga0501070_0357719 3300049586 Bacteria 1184
590 Ga0501071_0325491 3300049587 Bacteria 1167
591 Ga0501072_0018835 3300049588 Bacteria 5325
592 Ga0501072_0158735 3300049588 Bacteria 1804
593 Ga0501072_0186126 3300049588 Bacteria 1656
594 Ga0501072_0280712 3300049588 Bacteria 1325
595 Ga0501073_0137619 3300049589 Bacteria 1692
596 Ga0501074_0145747 3300049590 Bacteria 1693
597 Ga0501075_0006466 3300049591 Bacteria 8064
598 Ga0501075_0445053 3300049591 Bacteria 988
599 Ga0501076_0005956 3300049592 Bacteria 8803
600 Ga0501076_0070967 3300049592 Bacteria 2786
601 Ga0501076_0628049 3300049592 Bacteria 886
602 Ga0501077_0100170 3300049593 Bacteria 1836
603 Ga0501079_0129621 3300049741 Bacteria 1962
604 Ga0501079_0339868 3300049741 Unclassified 1176
605 Ga0501079_0410655 3300049741 Bacteria 1062
606 Ga0501080_0022082 3300049742 Bacteria 5896
607 Ga0501080_0299639 3300049742 Bacteria 1458
608 Ga0501080_0450406 3300049742 Bacteria 1154
609 Ga0501081_0464170 3300049743 Bacteria 941
610 Ga0501083_0002732 3300049744 Bacteria 12183
611 Ga0501083_0247137 3300049744 Bacteria 1161
612 Ga0501035_0000421 3300049822 Bacteria 47742
613 Ga0501035_0194986 3300049822 Bacteria 1740
614 Ga0501044_0000270 3300049823 Bacteria 65798
615 Ga0501044_0208517 3300049823 Bacteria 1909
616 Ga0501044_0498532 3300049823 Bacteria 1119
617 Ga0501045_0002713 3300049824 Bacteria 12086
618 nmdc:mga03n38_186692_c1 3300050490 Unclassified 1065
619 nmdc:mga03n38_262787_c1 3300050490 Bacteria 915
620 nmdc:mga03n38_42069_c1 3300050490 Bacteria 1995
621 nmdc:mga00v17_13597_c1 3300050491 Bacteria 4522
622 nmdc:mga00v17_50406_c1 3300050491 Bacteria 2529
623 nmdc:mga00v17_67807_c1 3300050491 Bacteria 2205
624 nmdc:mga0yw44_139281_c1 3300050492 Bacteria 1576
625 nmdc:mga0yw44_308154_c1 3300050492 Bacteria 1062
626 nmdc:mga0yw44_39956_c1 3300050492 Bacteria 2784
627 nmdc:mga0yw44_50750_c1 3300050492 Bacteria 2510
628 nmdc:mga0yw44_5084_c1 3300050492 Bacteria 6149
629 nmdc:mga05p37_106394_c1 3300050507 Bacteria 3451
630 nmdc:mga05p37_60498_c1 3300050507 Bacteria 4663
631 nmdc:mga06r32_166059_c1 3300050510 Bacteria 2190
632 nmdc:mga06r32_17794_c1 3300050510 Bacteria 6494
633 nmdc:mga06r32_674875_c1 3300050510 Bacteria 1000
634 nmdc:mga08y16_11543_c1 3300050511 Bacteria 9284
635 nmdc:mga08y16_152376_c1 3300050511 Bacteria 2403
636 nmdc:mga08y16_287862_c1 3300050511 Bacteria 1694
637 nmdc:mga0n895_18785_c1 3300050512 Bacteria 6405
638 nmdc:mga0n895_487575_c1 3300050512 Bacteria 1243
639 nmdc:mga0rr50_46027_c1 3300050513 Bacteria 3210
640 nmdc:mga0a205_1968_c1 3300050515 Bacteria 17890
641 nmdc:mga0a205_1_c1 3300050515 Bacteria 62269
642 nmdc:mga0a205_59419_c1 3300050515 Bacteria 3692
643 Ga0495601_0000012 3300053077 Bacteria 227853
644 Ga0495601_0000271 3300053077 Bacteria 28102
645 Ga0495601_0038157 3300053077 Bacteria 3003
646 Ga0495601_0076429 3300053077 Bacteria 2144
647 Ga0495612_0000168 3300053078 Bacteria 27483
648 Ga0495612_0011594 3300053078 Archaea 3551
649 Ga0495612_0056088 3300053078 Bacteria 1625
650 Ga0495612_0060328 3300053078 Bacteria 1570
651 Ga0495655_0000016 3300053083 Bacteria 50674
652 Ga0495655_0003962 3300053083 Bacteria 2492
653 Ga0495595_0000001 3300053084 Bacteria 495226
654 Ga0495595_0034679 3300053084 Bacteria 2283
655 Ga0495595_0144203 3300053084 Bacteria 1169
656 Ga0495619_0000018 3300053085 Bacteria 209943
657 Ga0495619_0000041 3300053085 Bacteria 112824
658 Ga0495619_0000708 3300053085 Bacteria 21719
659 Ga0495619_0001128 3300053085 Bacteria 17562
660 Ga0495619_0001674 3300053085 Bacteria 14650
661 Ga0495619_0003448 3300053085 Bacteria 10201
662 Ga0495619_0004182 3300053085 Bacteria 9211
663 Ga0495619_0032355 3300053085 Bacteria 3393
664 Ga0500566_0003650 3300053094 Bacteria 9186
665 Ga0500554_071950 3300053102 Bacteria 1127
666 Ga0500614_055431 3300053123 Bacteria 1052
667 Ga0500628_000027 3300053129 Bacteria 60626
668 Ga0501084_0024286 3300054114 Bacteria 5055
669 Ga0501084_0160100 3300054114 Bacteria 1899
670 Ga0501084_0338584 3300054114 Bacteria 1271
671 Ga0501082_0061246 3300060353 Bacteria 3240
672 Ga0501082_0086822 3300060353 Bacteria 2698
673 Ga0075431_100665265
674 JGI24746J21847_1000617
675 JGI24740J21852_10005220
676 JGI24735J21928_10042010
677 JGI24748J21848_1000223
678 JGI24742J22300_10001281
679 JGI25404J52841_10000203
680 Ga0070658_10071798
681 Ga0070683_100000481
682 Ga0070683_100001210
683 Ga0070683_100011934
684 Ga0070683_100036323
685 Ga0070683_100139733
686 Ga0070670_100049915
687 Ga0070670_100079304
688 Ga0070677_10000396
689 Ga0070666_10088224
690 Ga0070680_100144869
691 Ga0070682_100000057
692 Ga0070682_100000629
693 Ga0070682_100004924
694 Ga0070682_100049978
695 Ga0068868_100000008
696 Ga0068868_100083335
697 Ga0070689_100084749
698 Ga0070691_10000010
699 Ga0070691_10000175
700 Ga0070691_10115987
701 Ga0070661_100000365
702 Ga0070661_100041945
703 Ga0070661_100371855
704 Ga0070692_10049295
705 Ga0070668_100006745
706 Ga0070668_100048845
707 Ga0070668_100366971
708 Ga0070675_100002793
709 Ga0070675_100315950
710 Ga0070674_100000003
711 Ga0070674_100000016
712 Ga0070674_100047945
713 Ga0070674_100054728
714 Ga0070674_100176930
715 Ga0070673_100068006
716 Ga0070688_100001580
717 Ga0070688_100009726
718 Ga0070688_100016010
719 Ga0070688_100018164
720 Ga0070659_100008696
721 Ga0070659_100014138
722 Ga0070659_100019608
723 Ga0070667_100002889
724 Ga0070667_100229586
725 Ga0070714_100031777
726 Ga0070713_100000055
727 Ga0070710_10047102
728 Ga0070710_10211997
729 Ga0070711_100004268
730 Ga0070700_100019287
731 Ga0070700_100099501
732 Ga0070663_100001559
733 Ga0070663_100002524
734 Ga0070678_100021199
735 Ga0070662_100000039
736 Ga0070662_100036309
737 Ga0070681_10008875
738 Ga0070681_10268959
739 Ga0068867_100027246
740 Ga0068867_100027776
741 Ga0070685_10000545
742 Ga0070685_10006443
743 Ga0070685_10062191
744 Ga0070679_100004239
745 Ga0070679_100007525
746 Ga0070684_100020721
747 Ga0070684_100023080
748 Ga0070684_100027962
749 Ga0070684_100079875
750 Ga0070684_100085793
751 Ga0068853_100045486
752 Ga0068853_100081011
753 Ga0068853_100198726
754 Ga0070672_100000057
755 Ga0070672_100005836
756 Ga0070686_100044154
757 Ga0070686_100107235
758 Ga0070693_100001114
759 Ga0070693_100203879
760 Ga0070665_100000128
761 Ga0070665_100019618
762 Ga0070665_100049511
763 Ga0070665_100160313
764 Ga0070704_100280022
765 Ga0068855_100170569
766 Ga0070664_100016179
767 Ga0070664_100022744
768 Ga0068857_100264891
769 Ga0068857_100676254
770 Ga0068854_100000525
771 Ga0068856_100000057
772 Ga0068856_100006604
773 Ga0068856_100016805
774 Ga0068856_100265616
775 Ga0070702_100037764
776 Ga0068852_100000007
777 Ga0068852_100023801
778 Ga0068859_100036381
779 Ga0068864_100000035
780 Ga0068866_10000002
781 Ga0068866_10000148
782 Ga0068866_10021772
783 Ga0068861_100082457
784 Ga0068851_10003763
785 Ga0068851_10020414
786 Ga0068851_10024605
787 Ga0068863_100000415
788 Ga0068863_100002803
789 Ga0068863_100190462
790 Ga0068858_100000218
791 Ga0068858_100001041
792 Ga0068858_100158049
793 Ga0068858_100160275
794 Ga0068858_100219619
795 Ga0068860_100009932
796 Ga0068860_100101220
797 Ga0068862_100000391
798 Ga0081455_10013769
799 Ga0081455_10018091
800 Ga0081455_10057768
801 Ga0081455_10156075
802 Ga0081455_10211351
803 Ga0081538_10000296
804 Ga0081538_10012468
805 Ga0081538_10018156
806 Ga0081540_1005483
807 Ga0081539_10002725
808 Ga0081539_10016707
809 Ga0075365_10002481
810 Ga0075365_10003158
811 Ga0075365_10035347
812 Ga0075365_10046303
813 Ga0075365_10203771
814 Ga0075365_10360597
815 Ga0075368_10041580
816 Ga0075363_100026884
817 Ga0075363_100053188
818 Ga0075364_10017607
819 Ga0075364_10141275
820 Ga0075364_10240656
821 Ga0070715_10000003
822 Ga0070715_10033497
823 Ga0070712_100002058
824 Ga0070712_100009870
825 Ga0097621_100550548
826 Ga0075428_100294506
827 Ga0075430_100038867
828 Ga0075431_100031537
829 Ga0075431_100073391
830 Ga0075433_10001496
831 Ga0075433_10002936
832 Ga0075434_100010015
833 Ga0075434_100164213
834 Ga0075434_100404488
835 Ga0068865_100000009
836 Ga0068865_100061472
837 Ga0097620_100036381
838 Ga0111539_10004463
839 Ga0111539_10333572
840 Ga0105245_10000012
841 Ga0105245_10000077
842 Ga0105245_10001697
843 Ga0105245_10004922
844 Ga0105245_10004991
845 Ga0105245_10010946
846 Ga0105245_10369980
847 Ga0105245_10478094
848 Ga0105247_10000208
849 Ga0105247_10178977
850 Ga0114129_10074895
851 Ga0114129_10077098
852 Ga0114129_10111505
853 Ga0114129_10133836
854 Ga0114129_10402259
855 Ga0105243_10014256
856 Ga0105243_10256466
857 Ga0105243_10261873
858 Ga0105243_10350897
859 Ga0105241_10324451
860 Ga0105242_10000010
861 Ga0105242_10001414
862 Ga0105242_10058034
863 Ga0105242_10059547
864 Ga0105242_10075784
865 Ga0105242_10095441
866 Ga0105248_10000022
867 Ga0105248_10087690
868 Ga0105248_10687813
869 Ga0105237_10052868
870 Ga0105238_10000321
871 Ga0105238_10213592
872 Ga0105249_10000192
873 Ga0105249_10013993
874 Ga0105249_10028741
875 Ga0105249_10135836
876 Ga0105239_10060776
877 Ga0105239_10099990
878 Ga0105239_10172723
879 Ga0105246_10026116
880 Ga0105246_10203728
881 Ga0157371_10006260
882 Ga0157370_10067067
883 Ga0157370_10110965
884 Ga0157370_10130342
885 Ga0157369_10000118
886 Ga0157374_10005906
887 Ga0157374_10095055
888 Ga0157378_10011673
889 Ga0157378_10017504
890 Ga0157378_10050602
891 Ga0163162_10239225
892 Ga0157372_10038776
893 Ga0157375_10001092
894 Ga0157375_10006876
895 Ga0157375_10049665
896 Ga0157375_10131926
897 Ga0157375_10307148
898 Ga0157375_10466337
899 Ga0163163_10467912
900 Ga0157380_10000249
901 Ga0157380_10005261
902 Ga0157380_10173269
903 Ga0157380_10451726
904 Ga0157379_10044400
905 Ga0157379_10051072
906 Ga0157379_10111567
907 Ga0157379_10156977
908 Ga0157379_10490546
909 Ga0157376_10385504
910 Ga0157376_10581355
911 Ga0163161_10004856
912 Ga0163161_10141320
913 Ga0207656_10002454
914 Ga0207656_10010149
915 Ga0207656_10012896
916 Ga0207682_10000380
917 Ga0207642_10000001
918 Ga0207642_10000003
919 Ga0207642_10000004
920 Ga0207642_10000051
921 Ga0207642_10013216
922 Ga0207710_10059721
923 Ga0207688_10004076
924 Ga0207685_10000003
925 Ga0207685_10133521
926 Ga0207705_10029153
927 Ga0207707_10011056
928 Ga0207707_10381322
929 Ga0207693_10003350
930 Ga0207693_10043150
931 Ga0207663_10002464
932 Ga0207660_10139153
933 Ga0207649_10000024
934 Ga0207649_10011147
935 Ga0207652_10001557
936 Ga0207652_10006321
937 Ga0207652_10569020
938 Ga0207694_10000008
939 Ga0207694_10026190
940 Ga0207650_10022678
941 Ga0207659_10000062
942 Ga0207659_10225173
943 Ga0207687_10000011
944 Ga0207687_10000012
945 Ga0207687_10001579
946 Ga0207687_10002910
947 Ga0207687_10046298
948 Ga0207700_10000009
949 Ga0207664_10076341
950 Ga0207644_10047351
951 Ga0207690_10013252
952 Ga0207706_10000026
953 Ga0207686_10000271
954 Ga0207686_10001505
955 Ga0207686_10041038
956 Ga0207686_10147082
957 Ga0207709_10008821
958 Ga0207709_10160164
959 Ga0207709_10225073
960 Ga0207669_10000023
961 Ga0207669_10000064
962 Ga0207669_10014220
963 Ga0207669_10049282
964 Ga0207669_10081452
965 Ga0207704_10000004
966 Ga0207704_10280715
967 Ga0207691_10000642
968 Ga0207691_10003031
969 Ga0207711_10000019
970 Ga0207711_10180171
971 Ga0207661_10000166
972 Ga0207661_10006101
973 Ga0207661_10008277
974 Ga0207661_10036097
975 Ga0207661_10390934
976 Ga0207661_10716266
977 Ga0207679_10013404
978 Ga0207679_10079809
979 Ga0207667_10045130
980 Ga0207712_10000003
981 Ga0207712_10004857
982 Ga0207712_10046712
983 Ga0207668_10223300
984 Ga0207640_10000059
985 Ga0207640_10012280
986 Ga0207658_10001012
987 Ga0207658_10052890
988 Ga0207658_10306500
989 Ga0207677_10000142
990 Ga0207703_10000028
991 Ga0207703_10000153
992 Ga0207703_10104092
993 Ga0207639_10000298
994 Ga0207639_10023840
995 Ga0207639_10182319
996 Ga0207678_10000683
997 Ga0207678_10001490
998 Ga0207708_10051241
999 Ga0207708_10131430
1000 Ga0207702_10000027
1001 Ga0207702_10010473
1002 Ga0207702_10016462
1003 Ga0207702_10511061
1004 Ga0207641_10000072
1005 Ga0207641_10004111
1006 Ga0207641_10601707
1007 Ga0207648_10030144
1008 Ga0207648_10045418
1009 Ga0207676_10000026
1010 Ga0207674_10167069
1011 Ga0207674_10865770
1012 Ga0207675_100116954
1013 Ga0207683_10033093
1014 Ga0207698_10000002
1015 Ga0207698_10032602
1016 Ga0207428_10127293
1017 Ga0207428_10151168
1018 Ga0268266_10000503
1019 Ga0268266_10002461
1020 Ga0268266_10089007
1021 Ga0268266_10134732
1022 Ga0268265_10000440
1023 Ga0268264_10006776
1024 Ga0268264_10096040
1025 Ga0268264_10201875
1026 Ga0265337_1000025
1027 Ga0265326_10000015
1028 Ga0265319_1000244
1029 Ga0265322_10000003
1030 Ga0265338_10000047
1031 Ga0265324_10000074
1032 Ga0265320_10000001
1033 Ga0265325_10023820
1034 Ga0265329_10047170
1035 Ga0265331_10000665
1036 Ga0265327_10000003
1037 Ga0265316_10017500
1038 Ga0265314_10000222
1039 Ga0316576_10005303
1040 Ga0316578_10177916
1041 Ga0307406_10179138
1042 Ga0373937_0052396
1043 Ga0316582_0246926
1044 Ga0316582_0323740
1045 Ga0316584_0000455
1046 Ga0316584_0058646
1047 Ga0316584_0249667
1048 Ga0395899_0125736
1049 Ga0395900_0025358
1050 Ga0395898_0006261
1051 Ga0395898_0098328
1052 Ga0395898_0438953
1053 Ga0395905_0014463
1054 Ga0395905_0301860
1055 Ga0395901_0005346
1056 Ga0395901_0016362
1057 Ga0395901_0155151
1058 Ga0451853_2126818
1059 Ga0466963_0159606
1060 Ga0466963_0177788
1061 Ga0466957_0003873
1062 Ga0466958_0268819
1063 Ga0466967_0000008
1064 Ga0466967_0098304
1065 Ga0495592_0000497
1066 Ga0495603_0000044
1067 Ga0495603_0001036
1068 Ga0495603_0005586
1069 Ga0495629_0001573
1070 Ga0495629_0071080
1071 Ga0495629_0100485
1072 Ga0495629_0105299
1073 Ga0495629_0327975
1074 Ga0495641_0000012
1075 Ga0495641_0005689
1076 Ga0495641_0029378
1077 Ga0495651_0161981
1078 Ga0495582_0000307
1079 Ga0495662_0000006
1080 Ga0495662_0025102
1081 Ga0495594_0000021
1082 Ga0495606_0000219
1083 Ga0495608_0000001
1084 Ga0495608_0000353
1085 Ga0495618_0000003
1086 Ga0495620_0000060
1087 Ga0495628_0001751
1088 Ga0495628_0010777
1089 Ga0495628_0041635
1090 Ga0495630_0000227
1091 Ga0495630_0011354
1092 Ga0495630_0073551
1093 Ga0495637_0105238
1094 Ga0495644_0054959
1095 Ga0495652_0000086
1096 Ga0495652_0009255
1097 Ga0495652_0058595
1098 Ga0495640_0009944
1099 Ga0495640_0024171
1100 Ga0495640_0153274
1101 Ga0495586_0012295
1102 Ga0495587_0031291
1103 Ga0495587_0044578
1104 Ga0495587_0213091
1105 Ga0495645_0002782
1106 Ga0495622_0004723
1107 Ga0495667_0000327
1108 Ga0495667_0083518
1109 Ga0495656_0003147
1110 Ga0495634_0000030
1111 Ga0495634_0000379
1112 Ga0495634_0026067
1113 Ga0495634_0033763
1114 Ga0495625_0000960
1115 Ga0495635_0000009
1116 Ga0495635_0196177
1117 Ga0495588_0000179
1118 Ga0495657_0000002
1119 Ga0495657_0040414
1120 Ga0495599_0341949
1121 Ga0495647_0000006
1122 Ga0495647_0000053
1123 Ga0495647_0141511
1124 Ga0495658_0000190
1125 Ga0495658_0002094
1126 Ga0495669_0001855
1127 Ga0495613_0000003
1128 Ga0495613_0000242
1129 Ga0495624_0000002
1130 Ga0495624_0199373
1131 Ga0495649_0199798
1132 Ga0495600_0000467
1133 Ga0495600_0010012
1134 Ga0495604_0000033
1135 Ga0495604_0001604
1136 Ga0495604_0063165
1137 Ga0495674_0000007
1138 Ga0495676_0001744
1139 Ga0495676_0006848
1140 Ga0495676_0193041
1141 Ga0495680_0000272
1142 Ga0495680_0001303
1143 Ga0495680_0005371
1144 Ga0495680_0241414
1145 Ga0495675_0000162
1146 Ga0495675_0066227
1147 Ga0495684_0270347
1148 Ga0495686_0080264
1149 Ga0495593_0052051
1150 Ga0495593_0114588
1151 Ga0495602_0000063
1152 Ga0495602_0000188
1153 Ga0495602_0056594
1154 Ga0496100_0000004
1155 Ga0496100_0000046
1156 Ga0496101_0000007
1157 Ga0496101_0000124
1158 Ga0496102_0000404
1159 Ga0496102_0013913
1160 Ga0496102_0126421
1161 Ga0496102_0240311
1162 Ga0496103_0000001
1163 Ga0496103_0011805
1164 Ga0496103_0015494
1165 Ga0496104_0000002
1166 Ga0496104_0000003
1167 Ga0496104_0000139
1168 Ga0496104_0003874
1169 Ga0496104_0055019
1170 Ga0496105_0000001
1171 Ga0496105_0000008
1172 Ga0496105_0000054
1173 Ga0496105_0043820
1174 Ga0496105_0077590
1175 Ga0496106_0000004
1176 Ga0496106_0000059
1177 Ga0496106_0000239
1178 Ga0496106_0013880
1179 Ga0496106_0082773
1180 Ga0496107_0000001
1181 Ga0496107_0000018
1182 Ga0496107_0013156
1183 Ga0496108_0000002
1184 Ga0496108_0000012
1185 Ga0496108_0002243
1186 Ga0496108_0005210
1187 Ga0496108_0015619
1188 Ga0496108_0155722
1189 Ga0496109_0000001
1190 Ga0496109_0000035
1191 Ga0496109_0000246
1192 Ga0496109_0000291
1193 Ga0496109_0175693
1194 Ga0496109_0720916
1195 Ga0496110_0000476
1196 Ga0496110_0035346
1197 Ga0496110_0095687
1198 Ga0496110_0100291
1199 Ga0496111_0000354
1200 Ga0496111_0000772
1201 Ga0496111_0111137
1202 Ga0496111_0244594
1203 Ga0496111_0441453
1204 Ga0496112_0000002
1205 Ga0496112_0240676
1206 Ga0496113_0000010
1207 Ga0496113_0005366
1208 Ga0496113_0006303
1209 Ga0496113_0018186
1210 Ga0496113_0303940
1211 Ga0496114_0000043
1212 Ga0496114_0005502
1213 Ga0496114_0019454
1214 Ga0496115_0000004
1215 Ga0496115_0000211
1216 Ga0496115_0050523
1217 Ga0496115_0088199
1218 Ga0496116_0000229
1219 Ga0496117_0005642
1220 Ga0496118_0002667
1221 Ga0496118_0067099
1222 Ga0496119_0006136
1223 Ga0496119_0019921
1224 Ga0496119_0031215
1225 Ga0496120_0011767
1226 Ga0496120_0039736
1227 Ga0496121_0251465
1228 Ga0496124_0132393
1229 Ga0496126_0078174
1230 Ga0501031_0009627
1231 Ga0501032_0003351
1232 Ga0501033_0003740
1233 Ga0501034_0000725
1234 Ga0501034_0028502
1235 Ga0501036_0003647
1236 Ga0501036_0259512
1237 Ga0501037_0002974
1238 Ga0501038_0000228
1239 Ga0501039_0053926
1240 Ga0501039_0059864
1241 Ga0501039_0285246
1242 Ga0501039_0424972
1243 Ga0501040_0061447
1244 Ga0501040_0080845
1245 Ga0501041_0310815
1246 Ga0501042_0011450
1247 Ga0501042_0030342
1248 Ga0501043_0003860
1249 Ga0501046_0001430
1250 Ga0501047_0000413
1251 Ga0501047_0004433
1252 Ga0501048_0000807
1253 Ga0501067_0202836
1254 Ga0501068_0071189
1255 Ga0501068_0187768
1256 Ga0501069_0004856
1257 Ga0501069_0067442
1258 Ga0501070_0004278
1259 Ga0501070_0007739
1260 Ga0501070_0176174
1261 Ga0501070_0357719
1262 Ga0501071_0325491
1263 Ga0501072_0018835
1264 Ga0501072_0158735
1265 Ga0501072_0186126
1266 Ga0501072_0280712
1267 Ga0501073_0137619
1268 Ga0501074_0145747
1269 Ga0501075_0006466
1270 Ga0501075_0445053
1271 Ga0501076_0005956
1272 Ga0501076_0070967
1273 Ga0501076_0628049
1274 Ga0501077_0100170
1275 Ga0501079_0129621
1276 Ga0501079_0339868
1277 Ga0501079_0410655
1278 Ga0501080_0022082
1279 Ga0501080_0299639
1280 Ga0501080_0450406
1281 Ga0501081_0464170
1282 Ga0501083_0002732
1283 Ga0501083_0247137
1284 Ga0501035_0000421
1285 Ga0501035_0194986
1286 Ga0501044_0000270
1287 Ga0501044_0208517
1288 Ga0501044_0498532
1289 Ga0501045_0002713
1290 nmdc:mga03n38_186692_c1
1291 nmdc:mga03n38_262787_c1
1292 nmdc:mga03n38_42069_c1
1293 nmdc:mga00v17_13597_c1
1294 nmdc:mga00v17_50406_c1
1295 nmdc:mga00v17_67807_c1
1296 nmdc:mga0yw44_139281_c1
1297 nmdc:mga0yw44_308154_c1
1298 nmdc:mga0yw44_39956_c1
1299 nmdc:mga0yw44_50750_c1
1300 nmdc:mga0yw44_5084_c1
1301 nmdc:mga05p37_106394_c1
1302 nmdc:mga05p37_60498_c1
1303 nmdc:mga06r32_166059_c1
1304 nmdc:mga06r32_17794_c1
1305 nmdc:mga06r32_674875_c1
1306 nmdc:mga08y16_11543_c1
1307 nmdc:mga08y16_152376_c1
1308 nmdc:mga08y16_287862_c1
1309 nmdc:mga0n895_18785_c1
1310 nmdc:mga0n895_487575_c1
1311 nmdc:mga0rr50_46027_c1
1312 nmdc:mga0a205_1968_c1
1313 nmdc:mga0a205_1_c1
1314 nmdc:mga0a205_59419_c1
1315 Ga0495601_0000012
1316 Ga0495601_0000271
1317 Ga0495601_0038157
1318 Ga0495601_0076429
1319 Ga0495612_0000168
1320 Ga0495612_0011594
1321 Ga0495612_0056088
1322 Ga0495612_0060328
1323 Ga0495655_0000016
1324 Ga0495655_0003962
1325 Ga0495595_0000001
1326 Ga0495595_0034679
1327 Ga0495595_0144203
1328 Ga0495619_0000018
1329 Ga0495619_0000041
1330 Ga0495619_0000708
1331 Ga0495619_0001128
1332 Ga0495619_0001674
1333 Ga0495619_0003448
1334 Ga0495619_0004182
1335 Ga0495619_0032355
1336 Ga0500566_0003650
1337 Ga0500554_071950
1338 Ga0500614_055431
1339 Ga0500628_000027
1340 Ga0501084_0024286
1341 Ga0501084_0160100
1342 Ga0501084_0338584
1343 Ga0501082_0061246
1344 Ga0501082_0086822

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02811

PHP

PHP domain

40

188

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yb4-assembly1.cif.gz_A structure of an amidohydrolase from chromobacterium violaceum (efi target efi-500202) with bound so4, no metal 0.8876 2 262
3e0f-assembly1.cif.gz_A crystal structure of a putative metal-dependent phosphoesterase (bad_1165) from bifidobacterium adolescentis atcc 15703 at 2.40 a resolution 0.8702 2 254
2yb4-assembly1.cif.gz_A structure of an amidohydrolase from chromobacterium violaceum (efi target efi-500202) with bound so4, no metal 0.8629 2 262
7ug9-assembly1.cif.gz_A crystal structure of rnase am php domain 0.8445 1 252
3e0f-assembly1.cif.gz_A crystal structure of a putative metal-dependent phosphoesterase (bad_1165) from bifidobacterium adolescentis atcc 15703 at 2.40 a resolution 0.822 2 254
ID Description Score Start End Superfamily
2yb4A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.8296 96 163 1.10.150.650
3e0fA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8193 2 254 3.20.20.140
2yb4A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8177 2 262 3.20.20.140
2yb4A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.7708 96 163 1.10.150.650
af_Q58842_163_361_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7644 12 57 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A537YU32-F1-model_v4 PHP domain-containing protein 0.9941 1 268 GO:0004534
GO:0035312
AF-A0A537YU32-F1-model_v4 PHP domain-containing protein 0.9904 1 268 GO:0004534
GO:0035312
AF-A0A535JZJ8-F1-model_v4 PHP domain-containing protein 0.984 2 80 GO:0004534
GO:0035312
AF-A0A3C1D6Y6-F1-model_v4 Phosphatase 0.9806 1 78 GO:0004534
GO:0035312
AF-A0A3B8TRU9-F1-model_v4 deleted 0.9801 2 78

Map