F474228

General Info

Members Datasets Scaffolds Average Seq Length
672 251 1344 495

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10066531|Ga0105241_100665313
Length 579
Sequence LLKIVFGTTLLRFANRFVRQQQRSEIIQCFAMFVNFFFSPSKRSEPFEGLSFATRDRIIPASHTARKSRYNGRFAALAETAVMTILLSTLNARYAHASLGLRYLLANMGPLQEQTSLMEFVIGAKTTEVVERLLAKKPRIVGFGIYIWNVEETTKVVAMLKRVAPEVTVVLGGPEVSHETGEQEIVRLADYVVTGWGDITFPKLCGDILHGPKPIMKVHAGVQPPMAEIALPYTLYSDEDIAHRTIYVEASRGCPFKCEFCLSSLDKTAWPFGIDTFLAEMETLYQRGARLFKFVDRTFNLNVKTSQRIMQFFLDKIAANPDDPVYAHFELVPDHLPEALKATIAQFPPGALQFEIGIQSFNPEVQTLVSRRQDNAKAADNIRWLMAHSHXXXXVDLIAGLPGEDVESFARGFDQLVALGPHEIQFGILKRLRGTPIIRHTEPYKMVYEPYPPYTVLATDRIDFATMQRLVRFARYWDLVANSGRFAHTVKVLLGDSPFANFMAFSDWMYTQLDATHRIALDRLAKLVQAWLQLRGMPAHDAAALVASDYAGSAHKPADKSTQAKPAAAPERQVRHLAA

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
77 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
89 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
90 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
91 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
104 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
108 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
178 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
179 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
180 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
186 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
212 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
217 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
218 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
219 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
220 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
223 2643221556 Massilia sp. Root1485 Isolate Unclassified
224 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
225 2643221638 Duganella sp. Root336D2 Isolate Unclassified
226 2643221645 Massilia sp. Root351 Isolate Unclassified
227 2643221664 Massilia sp. Root418 Isolate Unclassified
228 2643221684 Massilia sp. Root133 Isolate Unclassified
229 2738541280 Massilia sp. GV090 Isolate Unclassified
230 2738541297 Duganella sp. GV083 Isolate Unclassified
231 2738541300 Massilia sp. GV016 Isolate Unclassified
232 2738541357 Duganella sp. GV053 Isolate Unclassified
233 2738543003 Duganella sp. GV066 Isolate Unclassified
234 2738543018 Massilia sp. GV045 Isolate Unclassified
235 2738543026 Duganella sp. GV089 Isolate Unclassified
236 2738543029 Duganella sp. GV039 Isolate Unclassified
237 2738543030 Massilia sp. GV097 Isolate Unclassified
238 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
239 2818991436 Collimonas arenae 515 Isolate Unclassified
240 2821131069 Duganella sp. 1224 Isolate Unclassified
241 2842711865 Duganella sp. R-73148 Isolate Unclassified
242 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
243 2857553236 Duganella sp. R-74557 Isolate Unclassified
244 2857558681 Duganella sp. R-74565 Isolate Unclassified
245 2857564685 Duganella sp. R-74599 Isolate Unclassified
246 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
247 2904424332 Duganella sp. 1411 Isolate Rhizosphere
248 2919476304 Duganella sp. 3397 Isolate Unclassified
249 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
250 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
251 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.39
Metatranscriptomes 0.15
Isolates 4.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.1
Nodule 0.45
Rhizoplane 3.27
Rhizosphere 75.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10066531 3300009174 Bacteria 2787
2 JGI25162J39368_1000023 3300002737 Bacteria 236658
3 JGI25150J39212_1003512 3300002774 Bacteria 3657
4 JGI25159J45721_1002946 3300002987 Bacteria 6200
5 JGI25165J46597_1000030 3300003214 Bacteria 305254
6 JGI25153J46596_10018066 3300003215 Bacteria 2753
7 rootL2_10102555 3300003322 Bacteria 2715
8 JGI25161J50226_1001616 3300003374 Bacteria 6542
9 Ga0055538_1000017 3300003751 Bacteria 305254
10 Ga0055539_1000022 3300003752 Bacteria 305254
11 Ga0055533_1000030 3300003756 Bacteria 305254
12 Ga0055525_1000028 3300003759 Bacteria 331683
13 Ga0055525_1000034 3300003759 Bacteria 305254
14 Ga0055542_1007275 3300003762 Bacteria 2264
15 Ga0055529_1000583 3300003763 Bacteria 29289
16 Ga0055526_1000149 3300003771 Bacteria 61682
17 Ga0055526_1001052 3300003771 Bacteria 20145
18 Ga0055526_1001207 3300003771 Bacteria 18616
19 Ga0055526_1005381 3300003771 Bacteria 7372
20 Ga0055537_1000578 3300003773 Bacteria 20349
21 Ga0055537_1006621 3300003773 Bacteria 2909
22 Ga0055537_1011931 3300003773 Bacteria 1727
23 Ga0055524_1000124 3300003775 Bacteria 90282
24 Ga0055524_1013278 3300003775 Bacteria 3113
25 Ga0055534_1000489 3300003784 Bacteria 21927
26 Ga0055528_1000575 3300003790 Bacteria 27746
27 Ga0055530_10004148 3300003791 Bacteria 7662
28 Ga0055531_10006260 3300003794 Bacteria 6789
29 Ga0055531_10028577 3300003794 Bacteria 1919
30 Ga0055541_1000015 3300003841 Bacteria 305254
31 Ga0055543_1002129 3300004625 Bacteria 6850
32 Ga0065165_1000167 3300005262 Bacteria 115630
33 Ga0065165_1001081 3300005262 Bacteria 32488
34 Ga0065165_1005706 3300005262 Bacteria 6850
35 Ga0070670_100173927 3300005331 Bacteria 1868
36 Ga0070682_100004447 3300005337 Bacteria 7781
37 Ga0070660_100002856 3300005339 Bacteria 11893
38 Ga0070660_100069403 3300005339 Bacteria 2748
39 Ga0070660_100139181 3300005339 Bacteria 1946
40 Ga0070661_100007701 3300005344 Bacteria 7440
41 Ga0070661_100147763 3300005344 Bacteria 1775
42 Ga0070659_100004956 3300005366 Bacteria 9526
43 Ga0068855_100176608 3300005563 Bacteria 2416
44 Ga0070664_100063092 3300005564 Bacteria 3159
45 Ga0099826_10002381 3300006948 Bacteria 12104
46 Ga0105244_10013076 3300009036 Bacteria 4869
47 Ga0105243_10019283 3300009148 Bacteria 5170
48 Ga0105237_10127719 3300009545 Bacteria 2536
49 Ga0105239_10283770 3300010375 Bacteria 1864
50 Ga0182008_10002513 3300014497 Bacteria 11447
51 Ga0182006_1000095 3300015261 Bacteria 105469
52 Ga0182006_1000216 3300015261 Bacteria 56213
53 Ga0182007_10001265 3300015262 Bacteria 13727
54 Ga0182007_10001951 3300015262 Bacteria 10665
55 Ga0182005_1000057 3300015265 Bacteria 104753
56 Ga0182005_1000119 3300015265 Bacteria 57192
57 Ga0182005_1000134 3300015265 Bacteria 53164
58 Ga0163161_10010197 3300017792 Bacteria 6505
59 Ga0213872_10000481 3300021361 Bacteria 32134
60 Ga0213872_10034755 3300021361 Bacteria 2306
61 Ga0209436_101730 3300025208 Bacteria 7176
62 Ga0209784_100034 3300025224 Bacteria 305504
63 Ga0209566_100038 3300025225 Bacteria 305504
64 Ga0209674_100056 3300025226 Bacteria 305504
65 Ga0209563_100011 3300025230 Bacteria 1187808
66 Ga0209563_100057 3300025230 Bacteria 305604
67 Ga0207427_100498 3300025231 Bacteria 20958
68 Ga0209437_100071 3300025233 Bacteria 305604
69 Ga0207425_1000493 3300025245 Bacteria 24717
70 Ga0207425_1000761 3300025245 Bacteria 16694
71 Ga0207425_1001383 3300025245 Bacteria 10259
72 Ga0209646_1000384 3300025246 Bacteria 28428
73 Ga0209677_100035 3300025253 Bacteria 305504
74 Ga0209677_107612 3300025253 Bacteria 2263
75 Ga0209148_1000381 3300025254 Bacteria 53384
76 Ga0209129_1000600 3300025258 Bacteria 24491
77 Ga0209129_1004176 3300025258 Bacteria 5819
78 Ga0209233_1000094 3300025261 Bacteria 305604
79 Ga0209565_1000112 3300025263 Bacteria 117209
80 Ga0209565_1002964 3300025263 Bacteria 5760
81 Ga0209565_1014178 3300025263 Bacteria 1840
82 Ga0209565_1014389 3300025263 Bacteria 1819
83 Ga0209455_1000484 3300025272 Bacteria 29439
84 Ga0209673_1000210 3300025273 Bacteria 117276
85 Ga0209130_1000016 3300025284 Bacteria 395540
86 Ga0209130_1002714 3300025284 Bacteria 8411
87 Ga0209130_1003164 3300025284 Bacteria 7277
88 Ga0209130_1004431 3300025284 Bacteria 5331
89 Ga0209675_1000761 3300025291 Bacteria 21640
90 Ga0209675_1003306 3300025291 Bacteria 7743
91 Ga0209675_1013045 3300025291 Bacteria 2631
92 Ga0209675_1017794 3300025291 Bacteria 2015
93 Ga0209025_1014809 3300025294 Bacteria 4761
94 Ga0209564_1000010 3300025295 Bacteria 885399
95 Ga0209564_1000245 3300025295 Bacteria 117378
96 Ga0209564_1001321 3300025295 Bacteria 26542
97 Ga0209564_1002064 3300025295 Bacteria 17279
98 Ga0209564_1020018 3300025295 Bacteria 2472
99 Ga0209758_1000957 3300025297 Bacteria 38982
100 Ga0209758_1001720 3300025297 Bacteria 24474
101 Ga0209050_1000086 3300025298 Bacteria 262009
102 Ga0209050_1002207 3300025298 Bacteria 17496
103 Ga0209256_1000268 3300025299 Bacteria 91897
104 Ga0209256_1001618 3300025299 Bacteria 21976
105 Ga0209256_1002073 3300025299 Bacteria 17627
106 Ga0209256_1002630 3300025299 Bacteria 14174
107 Ga0209256_1007095 3300025299 Bacteria 5658
108 Ga0209051_1006544 3300025303 Bacteria 6544
109 Ga0209257_1006299 3300025304 Bacteria 7744
110 Ga0209257_1007877 3300025304 Bacteria 6271
111 Ga0207655_1009754 3300025728 Bacteria 5918
112 Ga0207671_10112100 3300025914 Bacteria 2076
113 Ga0207657_10018511 3300025919 Bacteria 6644
114 Ga0207657_10095874 3300025919 Bacteria 2468
115 Ga0207657_10146190 3300025919 Bacteria 1928
116 Ga0207649_10025866 3300025920 Bacteria 3428
117 Ga0207690_10013185 3300025932 Bacteria 4961
118 Ga0207706_10086551 3300025933 Bacteria 2755
119 Ga0207709_10032012 3300025935 Bacteria 3077
120 Ga0207679_10144187 3300025945 Bacteria 1929
121 Ga0209281_1011138 3300027111 Bacteria 2026
122 Ga0209282_1000066 3300027666 Bacteria 87072
123 Ga0307515_10099073 3300028794 Bacteria 3542
124 Ga0316182_1122702 3300030745 Bacteria 3826
125 Ga0307408_100001878 3300031548 Bacteria 15299
126 Ga0307408_100006441 3300031548 Bacteria 7781
127 Ga0307408_100013856 3300031548 Bacteria 5353
128 Ga0307408_100048403 3300031548 Bacteria 3049
129 Ga0265314_10048457 3300031711 Bacteria 2982
130 Ga0395899_0000575 3300037312 Bacteria 39137
131 Ga0395899_0000762 3300037312 Bacteria 31826
132 Ga0395899_0001822 3300037312 Bacteria 17649
133 Ga0395899_0014827 3300037312 Bacteria 5948
134 Ga0395899_0061046 3300037312 Bacteria 2776
135 Ga0395900_0004198 3300037418 Bacteria 15292
136 Ga0395900_0020705 3300037418 Bacteria 6721
137 Ga0395900_0026862 3300037418 Bacteria 5891
138 Ga0395900_0049797 3300037418 Bacteria 4316
139 Ga0395900_0065519 3300037418 Bacteria 3732
140 Ga0395900_0170962 3300037418 Bacteria 2212
141 Ga0395898_0089301 3300037466 Bacteria 2965
142 Ga0395898_0118987 3300037466 Bacteria 2530
143 Ga0395905_0001070 3300037471 Bacteria 34507
144 Ga0395905_0009521 3300037471 Bacteria 9490
145 Ga0395905_0055021 3300037471 Bacteria 3724
146 Ga0395901_0001364 3300038443 Bacteria 25549
147 Ga0395901_0006884 3300038443 Bacteria 11482
148 Ga0395901_0050535 3300038443 Bacteria 4319
149 Ga0436361_0108001 3300039447 Bacteria 112244
150 Ga0436361_0217337 3300039447 Bacteria 18930
151 Ga0436361_1031912 3300039447 Bacteria 21537
152 Ga0439448_0008515 3300042005 Bacteria 3005
153 Ga0450897_000149 3300042128 Bacteria 3289
154 Ga0450904_000062 3300042139 Bacteria 24255
155 Ga0439458_0002215 3300042157 Bacteria 4797
156 Ga0466972_0000373 3300044658 Bacteria 24131
157 Ga0466972_0026689 3300044658 Bacteria 2861
158 Ga0466965_0028388 3300044683 Bacteria 2719
159 Ga0466965_0030967 3300044683 Bacteria 2607
160 Ga0466966_0087480 3300044684 Bacteria 1936
161 Ga0466966_0089391 3300044684 Bacteria 1913
162 Ga0466963_0070914 3300044694 Bacteria 2344
163 Ga0466964_0000883 3300044706 Bacteria 9829
164 Ga0466964_0002132 3300044706 Bacteria 6976
165 Ga0466964_0011013 3300044706 Bacteria 3416
166 Ga0466964_0038294 3300044706 Bacteria 1927
167 Ga0453684_0029009 3300044712 Bacteria 7872
168 Ga0466968_0000881 3300044735 Bacteria 10552
169 Ga0466968_0006523 3300044735 Bacteria 4403
170 Ga0466968_0047929 3300044735 Bacteria 1818
171 Ga0466970_0018709 3300044765 Bacteria 3589
172 Ga0466957_0000182 3300044842 Bacteria 28463
173 Ga0466957_0026183 3300044842 Bacteria 3459
174 Ga0466957_0079753 3300044842 Bacteria 2037
175 Ga0466959_0002186 3300045049 Bacteria 12439
176 Ga0466959_0044565 3300045049 Bacteria 3268
177 Ga0466967_0090863 3300045976 Bacteria 2774
178 Ga0495617_000010 3300046452 Bacteria 310258
179 Ga0495617_000471 3300046452 Bacteria 21547
180 Ga0495617_013939 3300046452 Bacteria 2732
181 Ga0495627_000378 3300046453 Bacteria 40927
182 Ga0495627_000690 3300046453 Bacteria 25783
183 Ga0495592_0011996 3300046454 Bacteria 6568
184 Ga0495603_0033142 3300046455 Bacteria 3108
185 Ga0495590_0000009 3300046457 Bacteria 320425
186 Ga0495590_0000201 3300046457 Bacteria 33657
187 Ga0495590_0008255 3300046457 Bacteria 3981
188 Ga0495590_0024851 3300046457 Bacteria 2109
189 Ga0495591_000867 3300046458 Bacteria 21241
190 Ga0495629_0034848 3300046459 Bacteria 3558
191 Ga0495638_0004523 3300046460 Bacteria 10535
192 Ga0495638_0018956 3300046460 Bacteria 4559
193 Ga0495638_0021457 3300046460 Bacteria 4256
194 Ga0495638_0091992 3300046460 Bacteria 1826
195 Ga0495651_0025844 3300046462 Bacteria 4571
196 Ga0495653_0000959 3300046463 Bacteria 22101
197 Ga0495653_0007503 3300046463 Bacteria 8919
198 Ga0495653_0021789 3300046463 Bacteria 5187
199 Ga0495653_0048941 3300046463 Bacteria 3259
200 Ga0495650_0000062 3300046471 Bacteria 277977
201 Ga0495650_0001085 3300046471 Bacteria 29863
202 Ga0495650_0001544 3300046471 Bacteria 21838
203 Ga0495650_0001553 3300046471 Bacteria 21682
204 Ga0495650_0003055 3300046471 Bacteria 12597
205 Ga0495650_0003201 3300046471 Bacteria 12180
206 Ga0495650_0027270 3300046471 Bacteria 2642
207 Ga0495580_0082024 3300046472 Bacteria 2247
208 Ga0495582_0001880 3300046473 Bacteria 11839
209 Ga0495605_0000635 3300046474 Bacteria 26971
210 Ga0495605_0000941 3300046474 Bacteria 19886
211 Ga0495605_0001966 3300046474 Bacteria 13026
212 Ga0495605_0004232 3300046474 Bacteria 8451
213 Ga0495605_0005989 3300046474 Bacteria 7027
214 Ga0495605_0024319 3300046474 Bacteria 3171
215 Ga0495605_0060256 3300046474 Bacteria 1819
216 Ga0495584_0000092 3300046491 Bacteria 62079
217 Ga0495584_0001978 3300046491 Bacteria 11796
218 Ga0495584_0003316 3300046491 Bacteria 8912
219 Ga0495584_0004486 3300046491 Bacteria 7503
220 Ga0495584_0004909 3300046491 Bacteria 7136
221 Ga0495584_0007603 3300046491 Bacteria 5647
222 Ga0495584_0014663 3300046491 Bacteria 3992
223 Ga0495584_0026964 3300046491 Bacteria 2911
224 Ga0495584_0044137 3300046491 Bacteria 2250
225 Ga0495584_0070975 3300046491 Bacteria 1750
226 Ga0495585_0000984 3300046492 Bacteria 23867
227 Ga0495585_0001005 3300046492 Bacteria 23544
228 Ga0495585_0001417 3300046492 Bacteria 18856
229 Ga0495585_0001517 3300046492 Bacteria 18039
230 Ga0495585_0004278 3300046492 Bacteria 9295
231 Ga0495585_0011361 3300046492 Bacteria 5269
232 Ga0495585_0022517 3300046492 Bacteria 3616
233 Ga0495585_0031792 3300046492 Bacteria 2994
234 Ga0495585_0043376 3300046492 Bacteria 2516
235 Ga0495585_0046854 3300046492 Bacteria 2409
236 Ga0495594_0022587 3300046499 Bacteria 3365
237 Ga0495594_0034582 3300046499 Bacteria 2749
238 Ga0495594_0045489 3300046499 Bacteria 2409
239 Ga0495594_0052771 3300046499 Bacteria 2238
240 Ga0495594_0060757 3300046499 Bacteria 2090
241 Ga0495596_0000350 3300046500 Bacteria 29880
242 Ga0495596_0003154 3300046500 Bacteria 8494
243 Ga0495596_0005660 3300046500 Bacteria 5867
244 Ga0495596_0017984 3300046500 Bacteria 2918
245 Ga0495596_0029258 3300046500 Bacteria 2209
246 Ga0495607_0001154 3300046501 Bacteria 23921
247 Ga0495607_0002568 3300046501 Bacteria 14670
248 Ga0495607_0005276 3300046501 Bacteria 9295
249 Ga0495607_0005305 3300046501 Bacteria 9266
250 Ga0495607_0005622 3300046501 Bacteria 8944
251 Ga0495607_0016913 3300046501 Bacteria 4695
252 Ga0495607_0016975 3300046501 Bacteria 4686
253 Ga0495607_0051073 3300046501 Bacteria 2403
254 Ga0495607_0055384 3300046501 Bacteria 2281
255 Ga0495583_0000329 3300046506 Bacteria 75158
256 Ga0495583_0000952 3300046506 Bacteria 33646
257 Ga0495583_0001471 3300046506 Bacteria 23592
258 Ga0495583_0001555 3300046506 Bacteria 22720
259 Ga0495583_0005015 3300046506 Bacteria 9169
260 Ga0495583_0005584 3300046506 Bacteria 8483
261 Ga0495583_0015248 3300046506 Bacteria 4188
262 Ga0495583_0023988 3300046506 Bacteria 3074
263 Ga0495583_0024089 3300046506 Bacteria 3065
264 Ga0495583_0024817 3300046506 Bacteria 3005
265 Ga0495583_0028401 3300046506 Bacteria 2750
266 Ga0495583_0031168 3300046506 Bacteria 2588
267 Ga0495606_0000428 3300046507 Bacteria 70021
268 Ga0495606_0001517 3300046507 Bacteria 30788
269 Ga0495606_0001842 3300046507 Bacteria 26721
270 Ga0495606_0001977 3300046507 Bacteria 25276
271 Ga0495606_0002381 3300046507 Bacteria 22050
272 Ga0495606_0004131 3300046507 Bacteria 14744
273 Ga0495606_0007799 3300046507 Bacteria 9473
274 Ga0495606_0009754 3300046507 Bacteria 8076
275 Ga0495606_0012328 3300046507 Bacteria 6871
276 Ga0495606_0031689 3300046507 Bacteria 3671
277 Ga0495606_0095805 3300046507 Bacteria 1816
278 Ga0495608_0013893 3300046511 Bacteria 5589
279 Ga0495610_0000014 3300046512 Bacteria 444708
280 Ga0495610_0003364 3300046512 Bacteria 12537
281 Ga0495610_0007708 3300046512 Bacteria 7103
282 Ga0495616_0000547 3300046513 Bacteria 28354
283 Ga0495616_0001040 3300046513 Bacteria 19861
284 Ga0495616_0001268 3300046513 Bacteria 17756
285 Ga0495616_0006198 3300046513 Bacteria 7275
286 Ga0495616_0039681 3300046513 Bacteria 2409
287 Ga0495616_0045400 3300046513 Bacteria 2224
288 Ga0495616_0046318 3300046513 Bacteria 2195
289 Ga0495616_0059304 3300046513 Bacteria 1882
290 Ga0495616_0060690 3300046513 Bacteria 1856
291 Ga0495618_0011394 3300046514 Bacteria 5391
292 Ga0495620_0035174 3300046515 Bacteria 2255
293 Ga0495628_0000076 3300046516 Bacteria 78344
294 Ga0495628_0003214 3300046516 Bacteria 14649
295 Ga0495631_0000869 3300046518 Bacteria 19019
296 Ga0495631_0016477 3300046518 Bacteria 3521
297 Ga0495631_0031969 3300046518 Bacteria 2374
298 Ga0495631_0032702 3300046518 Bacteria 2343
299 Ga0495632_0001345 3300046519 Bacteria 20659
300 Ga0495632_0005648 3300046519 Bacteria 8226
301 Ga0495632_0007159 3300046519 Bacteria 7055
302 Ga0495632_0016710 3300046519 Bacteria 4071
303 Ga0495632_0041955 3300046519 Bacteria 2295
304 Ga0495637_0000003 3300046520 Bacteria 623293
305 Ga0495637_0007025 3300046520 Bacteria 5605
306 Ga0495637_0008969 3300046520 Bacteria 4893
307 Ga0495637_0029493 3300046520 Bacteria 2442
308 Ga0495643_0000891 3300046522 Bacteria 31774
309 Ga0495643_0001105 3300046522 Bacteria 26855
310 Ga0495643_0001198 3300046522 Bacteria 25224
311 Ga0495643_0004987 3300046522 Bacteria 9103
312 Ga0495643_0006489 3300046522 Bacteria 7698
313 Ga0495643_0013877 3300046522 Bacteria 4806
314 Ga0495643_0018368 3300046522 Bacteria 4065
315 Ga0495643_0029050 3300046522 Bacteria 3095
316 Ga0495643_0033135 3300046522 Bacteria 2861
317 Ga0495643_0059405 3300046522 Bacteria 2032
318 Ga0495643_0060639 3300046522 Bacteria 2007
319 Ga0495643_0064493 3300046522 Bacteria 1935
320 Ga0495643_0071994 3300046522 Bacteria 1813
321 Ga0495644_0008384 3300046523 Bacteria 3979
322 Ga0495644_0008814 3300046523 Bacteria 3879
323 Ga0495644_0028801 3300046523 Bacteria 2100
324 Ga0495644_0040765 3300046523 Bacteria 1750
325 Ga0495648_0000751 3300046524 Bacteria 34631
326 Ga0495648_0003454 3300046524 Bacteria 13901
327 Ga0495648_0003783 3300046524 Bacteria 13155
328 Ga0495648_0003840 3300046524 Bacteria 13034
329 Ga0495648_0013959 3300046524 Bacteria 5909
330 Ga0495648_0013960 3300046524 Bacteria 5909
331 Ga0495648_0030685 3300046524 Bacteria 3550
332 Ga0495648_0048992 3300046524 Bacteria 2594
333 Ga0495648_0063249 3300046524 Bacteria 2186
334 Ga0495648_0077271 3300046524 Bacteria 1909
335 Ga0495666_0005811 3300046526 Bacteria 6220
336 Ga0495666_0016084 3300046526 Bacteria 3724
337 Ga0495666_0061554 3300046526 Bacteria 1793
338 Ga0495642_0001015 3300046528 Bacteria 13038
339 Ga0495642_0001627 3300046528 Bacteria 9782
340 Ga0495642_0002398 3300046528 Bacteria 7635
341 Ga0495642_0008834 3300046528 Bacteria 3853
342 Ga0495642_0012745 3300046528 Bacteria 3245
343 Ga0495642_0012999 3300046528 Bacteria 3214
344 Ga0495642_0019212 3300046528 Bacteria 2678
345 Ga0495642_0021647 3300046528 Bacteria 2529
346 Ga0495642_0030631 3300046528 Bacteria 2152
347 Ga0495642_0030640 3300046528 Bacteria 2152
348 Ga0495642_0045011 3300046528 Bacteria 1803
349 Ga0495652_0003764 3300046529 Bacteria 14834
350 Ga0495652_0009821 3300046529 Bacteria 8677
351 Ga0495652_0036452 3300046529 Bacteria 4276
352 Ga0495654_0000245 3300046530 Bacteria 50772
353 Ga0495654_0012652 3300046530 Bacteria 4529
354 Ga0495654_0024540 3300046530 Bacteria 3113
355 Ga0495654_0032088 3300046530 Bacteria 2663
356 Ga0495654_0034903 3300046530 Bacteria 2535
357 Ga0495654_0037648 3300046530 Bacteria 2423
358 Ga0495654_0050256 3300046530 Bacteria 2039
359 Ga0495665_0006918 3300046531 Bacteria 6119
360 Ga0495665_0036121 3300046531 Bacteria 2637
361 Ga0495586_0018444 3300046535 Bacteria 3715
362 Ga0495586_0054080 3300046535 Bacteria 2175
363 Ga0495587_0107167 3300046536 Bacteria 1607
364 Ga0495609_0000038 3300046538 Bacteria 182264
365 Ga0495609_0000736 3300046538 Bacteria 24883
366 Ga0495609_0000927 3300046538 Bacteria 21234
367 Ga0495609_0001172 3300046538 Bacteria 18081
368 Ga0495609_0008725 3300046538 Bacteria 4942
369 Ga0495609_0012599 3300046538 Bacteria 4009
370 Ga0495609_0017938 3300046538 Bacteria 3284
371 Ga0495609_0018151 3300046538 Bacteria 3262
372 Ga0495609_0019486 3300046538 Bacteria 3139
373 Ga0495609_0029589 3300046538 Bacteria 2493
374 Ga0495597_0000288 3300046542 Bacteria 45373
375 Ga0495597_0000754 3300046542 Bacteria 25593
376 Ga0495597_0001046 3300046542 Bacteria 21145
377 Ga0495597_0001377 3300046542 Bacteria 17571
378 Ga0495597_0003076 3300046542 Bacteria 10039
379 Ga0495597_0010764 3300046542 Bacteria 4456
380 Ga0495597_0011276 3300046542 Bacteria 4337
381 Ga0495597_0032083 3300046542 Bacteria 2386
382 Ga0495622_0000440 3300046557 Bacteria 26975
383 Ga0495622_0001964 3300046557 Bacteria 10077
384 Ga0495622_0019116 3300046557 Bacteria 3190
385 Ga0495633_0000663 3300046558 Bacteria 31797
386 Ga0495633_0001228 3300046558 Bacteria 20576
387 Ga0495633_0001987 3300046558 Bacteria 14800
388 Ga0495633_0003355 3300046558 Bacteria 10742
389 Ga0495633_0009283 3300046558 Bacteria 5449
390 Ga0495633_0015925 3300046558 Bacteria 3891
391 Ga0495633_0016702 3300046558 Bacteria 3776
392 Ga0495633_0035248 3300046558 Bacteria 2403
393 Ga0495633_0037159 3300046558 Bacteria 2330
394 Ga0495633_0056263 3300046558 Bacteria 1848
395 Ga0495668_0000188 3300046616 Bacteria 92177
396 Ga0495668_0000944 3300046616 Bacteria 32399
397 Ga0495668_0001593 3300046616 Bacteria 21330
398 Ga0495668_0003040 3300046616 Bacteria 13057
399 Ga0495668_0005723 3300046616 Bacteria 8308
400 Ga0495668_0005969 3300046616 Bacteria 8092
401 Ga0495668_0006127 3300046616 Bacteria 7963
402 Ga0495668_0007409 3300046616 Bacteria 7015
403 Ga0495668_0017479 3300046616 Bacteria 4157
404 Ga0495668_0017741 3300046616 Bacteria 4124
405 Ga0495668_0021260 3300046616 Bacteria 3722
406 Ga0495668_0022165 3300046616 Bacteria 3632
407 Ga0495668_0024931 3300046616 Bacteria 3399
408 Ga0495668_0036185 3300046616 Bacteria 2766
409 Ga0495634_0011154 3300046642 Bacteria 6554
410 Ga0495611_0003521 3300046648 Bacteria 6893
411 Ga0495611_0008645 3300046648 Bacteria 4307
412 Ga0495611_0031927 3300046648 Bacteria 2320
413 Ga0495611_0036620 3300046648 Bacteria 2178
414 Ga0495611_0037483 3300046648 Bacteria 2154
415 Ga0495611_0047414 3300046648 Bacteria 1928
416 Ga0495611_0049865 3300046648 Bacteria 1885
417 Ga0495625_0001377 3300046660 Bacteria 29891
418 Ga0495625_0002229 3300046660 Bacteria 21422
419 Ga0495625_0007279 3300046660 Bacteria 9678
420 Ga0495625_0018246 3300046660 Bacteria 5483
421 Ga0495625_0052488 3300046660 Bacteria 2919
422 Ga0495625_0053260 3300046660 Bacteria 2895
423 Ga0495635_0039741 3300046663 Bacteria 3253
424 Ga0495659_0000345 3300046664 Bacteria 18182
425 Ga0495659_0003587 3300046664 Bacteria 4938
426 Ga0495659_0018298 3300046664 Bacteria 2333
427 Ga0495661_0000701 3300046665 Bacteria 33249
428 Ga0495661_0001914 3300046665 Bacteria 16567
429 Ga0495661_0003740 3300046665 Bacteria 11142
430 Ga0495661_0007084 3300046665 Bacteria 7831
431 Ga0495661_0008346 3300046665 Bacteria 7170
432 Ga0495661_0012015 3300046665 Bacteria 5859
433 Ga0495661_0027563 3300046665 Bacteria 3645
434 Ga0495661_0030271 3300046665 Bacteria 3448
435 Ga0495661_0050080 3300046665 Bacteria 2530
436 Ga0495661_0054827 3300046665 Bacteria 2392
437 Ga0495661_0057819 3300046665 Bacteria 2313
438 Ga0495588_0000172 3300046674 Bacteria 81934
439 Ga0495588_0017386 3300046674 Bacteria 3491
440 Ga0495588_0023142 3300046674 Bacteria 3073
441 Ga0495588_0025786 3300046674 Bacteria 2931
442 Ga0495588_0046363 3300046674 Bacteria 2229
443 Ga0495588_0067717 3300046674 Bacteria 1853
444 Ga0495657_0046654 3300046675 Bacteria 2932
445 Ga0495599_0000548 3300046678 Bacteria 21463
446 Ga0495623_0042242 3300046679 Bacteria 2905
447 Ga0495623_0066424 3300046679 Bacteria 2253
448 Ga0495646_0004359 3300046680 Bacteria 8918
449 Ga0495646_0011253 3300046680 Bacteria 5682
450 Ga0495669_0000345 3300046684 Bacteria 24290
451 Ga0495669_0003212 3300046684 Bacteria 6728
452 Ga0495669_0010943 3300046684 Bacteria 3840
453 Ga0495669_0016952 3300046684 Bacteria 3124
454 Ga0495669_0025187 3300046684 Bacteria 2593
455 Ga0495624_0026346 3300046690 Bacteria 3811
456 Ga0495670_0008565 3300046691 Bacteria 5036
457 Ga0495670_0010105 3300046691 Bacteria 4641
458 Ga0495670_0011273 3300046691 Bacteria 4394
459 Ga0495670_0024277 3300046691 Bacteria 2996
460 Ga0495670_0028735 3300046691 Bacteria 2756
461 Ga0495670_0065275 3300046691 Bacteria 1834
462 Ga0495671_0001130 3300046692 Bacteria 18376
463 Ga0495671_0003794 3300046692 Bacteria 9189
464 Ga0495671_0006115 3300046692 Bacteria 6987
465 Ga0495671_0013465 3300046692 Bacteria 4428
466 Ga0495671_0014611 3300046692 Bacteria 4220
467 Ga0495671_0026142 3300046692 Bacteria 3028
468 Ga0495649_0006101 3300046694 Bacteria 7530
469 Ga0495649_0012477 3300046694 Bacteria 4939
470 Ga0495649_0023222 3300046694 Bacteria 3465
471 Ga0495649_0039096 3300046694 Bacteria 2601
472 Ga0495589_0000733 3300046794 Bacteria 21165
473 Ga0495589_0000986 3300046794 Bacteria 17334
474 Ga0495589_0001840 3300046794 Bacteria 12048
475 Ga0495589_0025222 3300046794 Bacteria 3018
476 Ga0495589_0026866 3300046794 Bacteria 2914
477 Ga0495589_0045265 3300046794 Bacteria 2186
478 Ga0495589_0047046 3300046794 Bacteria 2138
479 Ga0495600_0000693 3300046809 Bacteria 17639
480 Ga0495600_0023815 3300046809 Bacteria 3940
481 Ga0495660_0001060 3300046810 Bacteria 19886
482 Ga0495660_0010144 3300046810 Bacteria 5475
483 Ga0495660_0014658 3300046810 Bacteria 4533
484 Ga0495660_0018713 3300046810 Bacteria 3978
485 Ga0495660_0030299 3300046810 Bacteria 3048
486 Ga0495660_0042283 3300046810 Bacteria 2519
487 Ga0495660_0076761 3300046810 Bacteria 1759
488 Ga0495581_0023785 3300047315 Bacteria 3550
489 Ga0495581_0026084 3300047315 Bacteria 3389
490 Ga0495604_0019774 3300047317 Bacteria 5387
491 Ga0495604_0031201 3300047317 Bacteria 4228
492 Ga0495636_0001239 3300047318 Bacteria 9652
493 Ga0495636_0008533 3300047318 Bacteria 4043
494 Ga0495636_0009579 3300047318 Bacteria 3815
495 Ga0495674_0009946 3300047319 Bacteria 9019
496 Ga0495672_0000019 3300047320 Bacteria 448153
497 Ga0495672_0000859 3300047320 Bacteria 32082
498 Ga0495672_0001040 3300047320 Bacteria 28407
499 Ga0495672_0001173 3300047320 Bacteria 26565
500 Ga0495672_0001685 3300047320 Bacteria 21405
501 Ga0495672_0006826 3300047320 Bacteria 8722
502 Ga0495672_0029389 3300047320 Bacteria 3461
503 Ga0495672_0068974 3300047320 Bacteria 2008
504 Ga0495676_0000972 3300047321 Bacteria 24006
505 Ga0495676_0035194 3300047321 Bacteria 4191
506 Ga0495676_0035928 3300047321 Bacteria 4142
507 Ga0495676_0038611 3300047321 Bacteria 3964
508 Ga0495676_0052653 3300047321 Bacteria 3247
509 Ga0495680_0007712 3300047322 Bacteria 9828
510 Ga0495683_0000692 3300047323 Bacteria 24644
511 Ga0495683_0003705 3300047323 Bacteria 8849
512 Ga0495683_0003886 3300047323 Bacteria 8592
513 Ga0495683_0012603 3300047323 Bacteria 4439
514 Ga0495683_0026942 3300047323 Bacteria 2940
515 Ga0495683_0064256 3300047323 Bacteria 1812
516 Ga0495687_000405 3300047443 Bacteria 53349
517 Ga0495687_000801 3300047443 Bacteria 33906
518 Ga0495687_001993 3300047443 Bacteria 17334
519 Ga0495687_005076 3300047443 Bacteria 8543
520 Ga0495687_005120 3300047443 Bacteria 8487
521 Ga0495687_005264 3300047443 Bacteria 8312
522 Ga0495687_005317 3300047443 Bacteria 8255
523 Ga0495687_008736 3300047443 Bacteria 5753
524 Ga0495687_017089 3300047443 Bacteria 3631
525 Ga0495675_0019271 3300047444 Bacteria 4334
526 Ga0495677_0000527 3300047445 Bacteria 15974
527 Ga0495677_0003170 3300047445 Bacteria 6414
528 Ga0495677_0009195 3300047445 Bacteria 3651
529 Ga0495679_018845 3300047446 Bacteria 2439
530 Ga0495679_021744 3300047446 Bacteria 2207
531 Ga0495679_023405 3300047446 Bacteria 2095
532 Ga0495685_000157 3300047447 Bacteria 23115
533 Ga0495685_006353 3300047447 Bacteria 3864
534 Ga0495685_008725 3300047447 Bacteria 3375
535 Ga0495685_013537 3300047447 Bacteria 2769
536 Ga0495673_0000012 3300047469 Bacteria 656908
537 Ga0495673_0000604 3300047469 Bacteria 35726
538 Ga0495673_0000925 3300047469 Bacteria 26621
539 Ga0495681_0008029 3300047470 Bacteria 6657
540 Ga0495681_0010291 3300047470 Bacteria 5667
541 Ga0495681_0012752 3300047470 Bacteria 4920
542 Ga0495681_0025206 3300047470 Bacteria 3115
543 Ga0495681_0025984 3300047470 Bacteria 3057
544 Ga0495681_0029571 3300047470 Bacteria 2802
545 Ga0495681_0040177 3300047470 Bacteria 2279
546 Ga0495686_0005894 3300047472 Bacteria 9551
547 Ga0495686_0006159 3300047472 Bacteria 9273
548 Ga0495686_0006674 3300047472 Bacteria 8787
549 Ga0495686_0038904 3300047472 Bacteria 3040
550 Ga0495593_0008563 3300047673 Bacteria 5949
551 Ga0495593_0047816 3300047673 Bacteria 2274
552 Ga0495602_0032543 3300048088 Bacteria 4907
553 Ga0495602_0040161 3300048088 Bacteria 4296
554 Ga0495602_0057841 3300048088 Bacteria 3398
555 Ga0495602_0182991 3300048088 Bacteria 1614
556 Ga0495614_0001278 3300048089 Bacteria 10823
557 Ga0495626_0000005 3300048091 Bacteria 337534
558 Ga0495626_0001243 3300048091 Bacteria 20917
559 Ga0495626_0001440 3300048091 Bacteria 18927
560 Ga0495626_0001722 3300048091 Bacteria 16733
561 Ga0495626_0008571 3300048091 Bacteria 5591
562 Ga0495626_0009225 3300048091 Bacteria 5338
563 Ga0495626_0009230 3300048091 Bacteria 5336
564 Ga0495626_0018816 3300048091 Bacteria 3460
565 Ga0495626_0028198 3300048091 Bacteria 2724
566 Ga0495626_0031674 3300048091 Bacteria 2543
567 Ga0495626_0040257 3300048091 Bacteria 2208
568 Ga0495626_0041634 3300048091 Bacteria 2161
569 Ga0495626_0042191 3300048091 Bacteria 2144
570 Ga0495626_0050730 3300048091 Bacteria 1916
571 Ga0495626_0055591 3300048091 Bacteria 1813
572 Ga0496101_0031771 3300048904 Bacteria 3713
573 Ga0496101_0044087 3300048904 Bacteria 3191
574 Ga0496102_0000082 3300048905 Bacteria 139079
575 Ga0496102_0001712 3300048905 Bacteria 19183
576 Ga0496102_0015984 3300048905 Bacteria 6550
577 Ga0496102_0060081 3300048905 Bacteria 3477
578 Ga0496103_0062805 3300048906 Bacteria 2313
579 Ga0496103_0095651 3300048906 Bacteria 1877
580 Ga0496104_0158749 3300048907 Bacteria 2170
581 Ga0496105_0082523 3300048908 Bacteria 2655
582 Ga0496106_0170774 3300048909 Bacteria 1723
583 Ga0496107_0091869 3300048910 Bacteria 2219
584 Ga0496107_0097410 3300048910 Bacteria 2153
585 Ga0496107_0118093 3300048910 Bacteria 1953
586 Ga0496110_0000659 3300048913 Bacteria 23577
587 Ga0496110_0043460 3300048913 Bacteria 3923
588 Ga0496111_0002899 3300048914 Bacteria 10473
589 Ga0496112_0136023 3300048915 Bacteria 2428
590 Ga0496113_0033743 3300048916 Bacteria 3729
591 Ga0496115_0025298 3300048918 Bacteria 4621
592 Ga0496115_0080112 3300048918 Bacteria 2659
593 Ga0496116_0051207 3300048919 Bacteria 2745
594 Ga0496116_0071036 3300048919 Bacteria 2206
595 Ga0496117_0000075 3300048920 Bacteria 232451
596 Ga0496118_0000055 3300048921 Bacteria 232451
597 Ga0496121_0003786 3300048924 Bacteria 21109
598 Ga0496121_0008034 3300048924 Bacteria 12578
599 Ga0496121_0123103 3300048924 Bacteria 1955
600 Ga0496122_0003341 3300048925 Bacteria 21160
601 Ga0496122_0007255 3300048925 Bacteria 12398
602 Ga0496122_0011140 3300048925 Bacteria 9158
603 Ga0496123_0006778 3300048926 Bacteria 11006
604 Ga0496123_0007415 3300048926 Bacteria 10343
605 Ga0496123_0009556 3300048926 Bacteria 8717
606 Ga0496123_0022950 3300048926 Bacteria 4792
607 Ga0496124_0013871 3300048927 Bacteria 7837
608 Ga0496124_0021994 3300048927 Bacteria 5862
609 Ga0496124_0033769 3300048927 Bacteria 4497
610 Ga0496124_0112903 3300048927 Bacteria 2184
611 Ga0496125_0000487 3300048928 Bacteria 69494
612 Ga0496125_0011120 3300048928 Bacteria 9027
613 Ga0496125_0126119 3300048928 Bacteria 1814
614 Ga0496126_0094685 3300048929 Bacteria 2621
615 Ga0496126_0162934 3300048929 Bacteria 1904
616 Ga0495678_000027 3300049459 Bacteria 222075
617 Ga0495678_001082 3300049459 Bacteria 23004
618 Ga0495678_001136 3300049459 Bacteria 22114
619 Ga0495678_001459 3300049459 Bacteria 18557
620 Ga0495678_002154 3300049459 Bacteria 13912
621 Ga0495678_004343 3300049459 Bacteria 8245
622 Ga0495678_006992 3300049459 Bacteria 5918
623 Ga0495678_012018 3300049459 Bacteria 4120
624 Ga0495678_012665 3300049459 Bacteria 3989
625 Ga0495678_023500 3300049459 Bacteria 2677
626 Ga0495682_0001880 3300049460 Bacteria 10462
627 Ga0495682_0004649 3300049460 Bacteria 5825
628 Ga0495682_0007972 3300049460 Bacteria 4186
629 Ga0495682_0017797 3300049460 Bacteria 2678
630 Ga0501034_0145341 3300049571 Bacteria 2349
631 Ga0501269_000385 3300049766 Bacteria 10570
632 Ga0501279_000681 3300049775 Bacteria 4452
633 Ga0501035_0009455 3300049822 Bacteria 9064
634 Ga0500594_0003545 3300053118 Bacteria 3435
635 Ga0500595_000862 3300053119 Bacteria 17316
636 Ga0500618_018130 3300053125 Bacteria 1743
637 Ga0500574_000191 3300053141 Bacteria 7225
638 Ga0500586_000619 3300053145 Bacteria 7214
639 Ga0500586_049295 3300053145 Bacteria 1449
640 Ga0500619_000200 3300053154 Bacteria 13776
641 Ga0587068_002129 3300059641 Bacteria 2365
642 Ga0466962_0039282 3300061719 Bacteria 2267
643 2601666987 2600255292 Bacteria 6300551
644 2643801145 2643221556 Bacteria 7251154
645 2644029885 2643221603 Bacteria 6147767
646 2644214235 2643221638 Bacteria 6579467
647 2644251734 2643221645 Bacteria 7207331
648 2644356090 2643221664 Bacteria 7272945
649 2644471863 2643221684 Bacteria 7145183
650 2738742650 2738541280 Bacteria 6630198
651 2738826022 2738541297 Bacteria 6549566
652 2738842336 2738541300 Bacteria 6675882
653 2739149819 2738541357 Bacteria 6549408
654 2739191738 2738543003 Bacteria 6549560
655 2739273090 2738543018 Bacteria 6718814
656 2739318215 2738543026 Bacteria 6549408
657 2739336456 2738543029 Bacteria 6549249
658 2739342134 2738543030 Bacteria 6719714
659 2809146554 2808606418 Bacteria 6724496
660 2819542260 2818991436 Bacteria 5376622
661 2821136357 2821131069 Bacteria 6108407
662 2842717660 2842711865 Bacteria 7155354
663 2857552881 2857547612 Bacteria 6179999
664 2857558089 2857553236 Bacteria 6166726
665 2857563437 2857558681 Bacteria 6617694
666 2857570406 2857564685 Bacteria 6290584
667 2885083899 2885080285 Bacteria 6355622
668 2904428541 2904424332 Bacteria 7633521
669 2919476305 2919476304 Bacteria 5888696
670 2932415543 2932410948 Bacteria 6312192
671 2932421533 2932416698 Bacteria 6315112
672 8047675460 8047673197 Bacteria 7395230
673 Ga0105241_10066531
674 JGI25162J39368_1000023
675 JGI25150J39212_1003512
676 JGI25159J45721_1002946
677 JGI25165J46597_1000030
678 JGI25153J46596_10018066
679 rootL2_10102555
680 JGI25161J50226_1001616
681 Ga0055538_1000017
682 Ga0055539_1000022
683 Ga0055533_1000030
684 Ga0055525_1000028
685 Ga0055525_1000034
686 Ga0055542_1007275
687 Ga0055529_1000583
688 Ga0055526_1000149
689 Ga0055526_1001052
690 Ga0055526_1001207
691 Ga0055526_1005381
692 Ga0055537_1000578
693 Ga0055537_1006621
694 Ga0055537_1011931
695 Ga0055524_1000124
696 Ga0055524_1013278
697 Ga0055534_1000489
698 Ga0055528_1000575
699 Ga0055530_10004148
700 Ga0055531_10006260
701 Ga0055531_10028577
702 Ga0055541_1000015
703 Ga0055543_1002129
704 Ga0065165_1000167
705 Ga0065165_1001081
706 Ga0065165_1005706
707 Ga0070670_100173927
708 Ga0070682_100004447
709 Ga0070660_100002856
710 Ga0070660_100069403
711 Ga0070660_100139181
712 Ga0070661_100007701
713 Ga0070661_100147763
714 Ga0070659_100004956
715 Ga0068855_100176608
716 Ga0070664_100063092
717 Ga0099826_10002381
718 Ga0105244_10013076
719 Ga0105243_10019283
720 Ga0105237_10127719
721 Ga0105239_10283770
722 Ga0182008_10002513
723 Ga0182006_1000095
724 Ga0182006_1000216
725 Ga0182007_10001265
726 Ga0182007_10001951
727 Ga0182005_1000057
728 Ga0182005_1000119
729 Ga0182005_1000134
730 Ga0163161_10010197
731 Ga0213872_10000481
732 Ga0213872_10034755
733 Ga0209436_101730
734 Ga0209784_100034
735 Ga0209566_100038
736 Ga0209674_100056
737 Ga0209563_100011
738 Ga0209563_100057
739 Ga0207427_100498
740 Ga0209437_100071
741 Ga0207425_1000493
742 Ga0207425_1000761
743 Ga0207425_1001383
744 Ga0209646_1000384
745 Ga0209677_100035
746 Ga0209677_107612
747 Ga0209148_1000381
748 Ga0209129_1000600
749 Ga0209129_1004176
750 Ga0209233_1000094
751 Ga0209565_1000112
752 Ga0209565_1002964
753 Ga0209565_1014178
754 Ga0209565_1014389
755 Ga0209455_1000484
756 Ga0209673_1000210
757 Ga0209130_1000016
758 Ga0209130_1002714
759 Ga0209130_1003164
760 Ga0209130_1004431
761 Ga0209675_1000761
762 Ga0209675_1003306
763 Ga0209675_1013045
764 Ga0209675_1017794
765 Ga0209025_1014809
766 Ga0209564_1000010
767 Ga0209564_1000245
768 Ga0209564_1001321
769 Ga0209564_1002064
770 Ga0209564_1020018
771 Ga0209758_1000957
772 Ga0209758_1001720
773 Ga0209050_1000086
774 Ga0209050_1002207
775 Ga0209256_1000268
776 Ga0209256_1001618
777 Ga0209256_1002073
778 Ga0209256_1002630
779 Ga0209256_1007095
780 Ga0209051_1006544
781 Ga0209257_1006299
782 Ga0209257_1007877
783 Ga0207655_1009754
784 Ga0207671_10112100
785 Ga0207657_10018511
786 Ga0207657_10095874
787 Ga0207657_10146190
788 Ga0207649_10025866
789 Ga0207690_10013185
790 Ga0207706_10086551
791 Ga0207709_10032012
792 Ga0207679_10144187
793 Ga0209281_1011138
794 Ga0209282_1000066
795 Ga0307515_10099073
796 Ga0316182_1122702
797 Ga0307408_100001878
798 Ga0307408_100006441
799 Ga0307408_100013856
800 Ga0307408_100048403
801 Ga0265314_10048457
802 Ga0395899_0000575
803 Ga0395899_0000762
804 Ga0395899_0001822
805 Ga0395899_0014827
806 Ga0395899_0061046
807 Ga0395900_0004198
808 Ga0395900_0020705
809 Ga0395900_0026862
810 Ga0395900_0049797
811 Ga0395900_0065519
812 Ga0395900_0170962
813 Ga0395898_0089301
814 Ga0395898_0118987
815 Ga0395905_0001070
816 Ga0395905_0009521
817 Ga0395905_0055021
818 Ga0395901_0001364
819 Ga0395901_0006884
820 Ga0395901_0050535
821 Ga0436361_0108001
822 Ga0436361_0217337
823 Ga0436361_1031912
824 Ga0439448_0008515
825 Ga0450897_000149
826 Ga0450904_000062
827 Ga0439458_0002215
828 Ga0466972_0000373
829 Ga0466972_0026689
830 Ga0466965_0028388
831 Ga0466965_0030967
832 Ga0466966_0087480
833 Ga0466966_0089391
834 Ga0466963_0070914
835 Ga0466964_0000883
836 Ga0466964_0002132
837 Ga0466964_0011013
838 Ga0466964_0038294
839 Ga0453684_0029009
840 Ga0466968_0000881
841 Ga0466968_0006523
842 Ga0466968_0047929
843 Ga0466970_0018709
844 Ga0466957_0000182
845 Ga0466957_0026183
846 Ga0466957_0079753
847 Ga0466959_0002186
848 Ga0466959_0044565
849 Ga0466967_0090863
850 Ga0495617_000010
851 Ga0495617_000471
852 Ga0495617_013939
853 Ga0495627_000378
854 Ga0495627_000690
855 Ga0495592_0011996
856 Ga0495603_0033142
857 Ga0495590_0000009
858 Ga0495590_0000201
859 Ga0495590_0008255
860 Ga0495590_0024851
861 Ga0495591_000867
862 Ga0495629_0034848
863 Ga0495638_0004523
864 Ga0495638_0018956
865 Ga0495638_0021457
866 Ga0495638_0091992
867 Ga0495651_0025844
868 Ga0495653_0000959
869 Ga0495653_0007503
870 Ga0495653_0021789
871 Ga0495653_0048941
872 Ga0495650_0000062
873 Ga0495650_0001085
874 Ga0495650_0001544
875 Ga0495650_0001553
876 Ga0495650_0003055
877 Ga0495650_0003201
878 Ga0495650_0027270
879 Ga0495580_0082024
880 Ga0495582_0001880
881 Ga0495605_0000635
882 Ga0495605_0000941
883 Ga0495605_0001966
884 Ga0495605_0004232
885 Ga0495605_0005989
886 Ga0495605_0024319
887 Ga0495605_0060256
888 Ga0495584_0000092
889 Ga0495584_0001978
890 Ga0495584_0003316
891 Ga0495584_0004486
892 Ga0495584_0004909
893 Ga0495584_0007603
894 Ga0495584_0014663
895 Ga0495584_0026964
896 Ga0495584_0044137
897 Ga0495584_0070975
898 Ga0495585_0000984
899 Ga0495585_0001005
900 Ga0495585_0001417
901 Ga0495585_0001517
902 Ga0495585_0004278
903 Ga0495585_0011361
904 Ga0495585_0022517
905 Ga0495585_0031792
906 Ga0495585_0043376
907 Ga0495585_0046854
908 Ga0495594_0022587
909 Ga0495594_0034582
910 Ga0495594_0045489
911 Ga0495594_0052771
912 Ga0495594_0060757
913 Ga0495596_0000350
914 Ga0495596_0003154
915 Ga0495596_0005660
916 Ga0495596_0017984
917 Ga0495596_0029258
918 Ga0495607_0001154
919 Ga0495607_0002568
920 Ga0495607_0005276
921 Ga0495607_0005305
922 Ga0495607_0005622
923 Ga0495607_0016913
924 Ga0495607_0016975
925 Ga0495607_0051073
926 Ga0495607_0055384
927 Ga0495583_0000329
928 Ga0495583_0000952
929 Ga0495583_0001471
930 Ga0495583_0001555
931 Ga0495583_0005015
932 Ga0495583_0005584
933 Ga0495583_0015248
934 Ga0495583_0023988
935 Ga0495583_0024089
936 Ga0495583_0024817
937 Ga0495583_0028401
938 Ga0495583_0031168
939 Ga0495606_0000428
940 Ga0495606_0001517
941 Ga0495606_0001842
942 Ga0495606_0001977
943 Ga0495606_0002381
944 Ga0495606_0004131
945 Ga0495606_0007799
946 Ga0495606_0009754
947 Ga0495606_0012328
948 Ga0495606_0031689
949 Ga0495606_0095805
950 Ga0495608_0013893
951 Ga0495610_0000014
952 Ga0495610_0003364
953 Ga0495610_0007708
954 Ga0495616_0000547
955 Ga0495616_0001040
956 Ga0495616_0001268
957 Ga0495616_0006198
958 Ga0495616_0039681
959 Ga0495616_0045400
960 Ga0495616_0046318
961 Ga0495616_0059304
962 Ga0495616_0060690
963 Ga0495618_0011394
964 Ga0495620_0035174
965 Ga0495628_0000076
966 Ga0495628_0003214
967 Ga0495631_0000869
968 Ga0495631_0016477
969 Ga0495631_0031969
970 Ga0495631_0032702
971 Ga0495632_0001345
972 Ga0495632_0005648
973 Ga0495632_0007159
974 Ga0495632_0016710
975 Ga0495632_0041955
976 Ga0495637_0000003
977 Ga0495637_0007025
978 Ga0495637_0008969
979 Ga0495637_0029493
980 Ga0495643_0000891
981 Ga0495643_0001105
982 Ga0495643_0001198
983 Ga0495643_0004987
984 Ga0495643_0006489
985 Ga0495643_0013877
986 Ga0495643_0018368
987 Ga0495643_0029050
988 Ga0495643_0033135
989 Ga0495643_0059405
990 Ga0495643_0060639
991 Ga0495643_0064493
992 Ga0495643_0071994
993 Ga0495644_0008384
994 Ga0495644_0008814
995 Ga0495644_0028801
996 Ga0495644_0040765
997 Ga0495648_0000751
998 Ga0495648_0003454
999 Ga0495648_0003783
1000 Ga0495648_0003840
1001 Ga0495648_0013959
1002 Ga0495648_0013960
1003 Ga0495648_0030685
1004 Ga0495648_0048992
1005 Ga0495648_0063249
1006 Ga0495648_0077271
1007 Ga0495666_0005811
1008 Ga0495666_0016084
1009 Ga0495666_0061554
1010 Ga0495642_0001015
1011 Ga0495642_0001627
1012 Ga0495642_0002398
1013 Ga0495642_0008834
1014 Ga0495642_0012745
1015 Ga0495642_0012999
1016 Ga0495642_0019212
1017 Ga0495642_0021647
1018 Ga0495642_0030631
1019 Ga0495642_0030640
1020 Ga0495642_0045011
1021 Ga0495652_0003764
1022 Ga0495652_0009821
1023 Ga0495652_0036452
1024 Ga0495654_0000245
1025 Ga0495654_0012652
1026 Ga0495654_0024540
1027 Ga0495654_0032088
1028 Ga0495654_0034903
1029 Ga0495654_0037648
1030 Ga0495654_0050256
1031 Ga0495665_0006918
1032 Ga0495665_0036121
1033 Ga0495586_0018444
1034 Ga0495586_0054080
1035 Ga0495587_0107167
1036 Ga0495609_0000038
1037 Ga0495609_0000736
1038 Ga0495609_0000927
1039 Ga0495609_0001172
1040 Ga0495609_0008725
1041 Ga0495609_0012599
1042 Ga0495609_0017938
1043 Ga0495609_0018151
1044 Ga0495609_0019486
1045 Ga0495609_0029589
1046 Ga0495597_0000288
1047 Ga0495597_0000754
1048 Ga0495597_0001046
1049 Ga0495597_0001377
1050 Ga0495597_0003076
1051 Ga0495597_0010764
1052 Ga0495597_0011276
1053 Ga0495597_0032083
1054 Ga0495622_0000440
1055 Ga0495622_0001964
1056 Ga0495622_0019116
1057 Ga0495633_0000663
1058 Ga0495633_0001228
1059 Ga0495633_0001987
1060 Ga0495633_0003355
1061 Ga0495633_0009283
1062 Ga0495633_0015925
1063 Ga0495633_0016702
1064 Ga0495633_0035248
1065 Ga0495633_0037159
1066 Ga0495633_0056263
1067 Ga0495668_0000188
1068 Ga0495668_0000944
1069 Ga0495668_0001593
1070 Ga0495668_0003040
1071 Ga0495668_0005723
1072 Ga0495668_0005969
1073 Ga0495668_0006127
1074 Ga0495668_0007409
1075 Ga0495668_0017479
1076 Ga0495668_0017741
1077 Ga0495668_0021260
1078 Ga0495668_0022165
1079 Ga0495668_0024931
1080 Ga0495668_0036185
1081 Ga0495634_0011154
1082 Ga0495611_0003521
1083 Ga0495611_0008645
1084 Ga0495611_0031927
1085 Ga0495611_0036620
1086 Ga0495611_0037483
1087 Ga0495611_0047414
1088 Ga0495611_0049865
1089 Ga0495625_0001377
1090 Ga0495625_0002229
1091 Ga0495625_0007279
1092 Ga0495625_0018246
1093 Ga0495625_0052488
1094 Ga0495625_0053260
1095 Ga0495635_0039741
1096 Ga0495659_0000345
1097 Ga0495659_0003587
1098 Ga0495659_0018298
1099 Ga0495661_0000701
1100 Ga0495661_0001914
1101 Ga0495661_0003740
1102 Ga0495661_0007084
1103 Ga0495661_0008346
1104 Ga0495661_0012015
1105 Ga0495661_0027563
1106 Ga0495661_0030271
1107 Ga0495661_0050080
1108 Ga0495661_0054827
1109 Ga0495661_0057819
1110 Ga0495588_0000172
1111 Ga0495588_0017386
1112 Ga0495588_0023142
1113 Ga0495588_0025786
1114 Ga0495588_0046363
1115 Ga0495588_0067717
1116 Ga0495657_0046654
1117 Ga0495599_0000548
1118 Ga0495623_0042242
1119 Ga0495623_0066424
1120 Ga0495646_0004359
1121 Ga0495646_0011253
1122 Ga0495669_0000345
1123 Ga0495669_0003212
1124 Ga0495669_0010943
1125 Ga0495669_0016952
1126 Ga0495669_0025187
1127 Ga0495624_0026346
1128 Ga0495670_0008565
1129 Ga0495670_0010105
1130 Ga0495670_0011273
1131 Ga0495670_0024277
1132 Ga0495670_0028735
1133 Ga0495670_0065275
1134 Ga0495671_0001130
1135 Ga0495671_0003794
1136 Ga0495671_0006115
1137 Ga0495671_0013465
1138 Ga0495671_0014611
1139 Ga0495671_0026142
1140 Ga0495649_0006101
1141 Ga0495649_0012477
1142 Ga0495649_0023222
1143 Ga0495649_0039096
1144 Ga0495589_0000733
1145 Ga0495589_0000986
1146 Ga0495589_0001840
1147 Ga0495589_0025222
1148 Ga0495589_0026866
1149 Ga0495589_0045265
1150 Ga0495589_0047046
1151 Ga0495600_0000693
1152 Ga0495600_0023815
1153 Ga0495660_0001060
1154 Ga0495660_0010144
1155 Ga0495660_0014658
1156 Ga0495660_0018713
1157 Ga0495660_0030299
1158 Ga0495660_0042283
1159 Ga0495660_0076761
1160 Ga0495581_0023785
1161 Ga0495581_0026084
1162 Ga0495604_0019774
1163 Ga0495604_0031201
1164 Ga0495636_0001239
1165 Ga0495636_0008533
1166 Ga0495636_0009579
1167 Ga0495674_0009946
1168 Ga0495672_0000019
1169 Ga0495672_0000859
1170 Ga0495672_0001040
1171 Ga0495672_0001173
1172 Ga0495672_0001685
1173 Ga0495672_0006826
1174 Ga0495672_0029389
1175 Ga0495672_0068974
1176 Ga0495676_0000972
1177 Ga0495676_0035194
1178 Ga0495676_0035928
1179 Ga0495676_0038611
1180 Ga0495676_0052653
1181 Ga0495680_0007712
1182 Ga0495683_0000692
1183 Ga0495683_0003705
1184 Ga0495683_0003886
1185 Ga0495683_0012603
1186 Ga0495683_0026942
1187 Ga0495683_0064256
1188 Ga0495687_000405
1189 Ga0495687_000801
1190 Ga0495687_001993
1191 Ga0495687_005076
1192 Ga0495687_005120
1193 Ga0495687_005264
1194 Ga0495687_005317
1195 Ga0495687_008736
1196 Ga0495687_017089
1197 Ga0495675_0019271
1198 Ga0495677_0000527
1199 Ga0495677_0003170
1200 Ga0495677_0009195
1201 Ga0495679_018845
1202 Ga0495679_021744
1203 Ga0495679_023405
1204 Ga0495685_000157
1205 Ga0495685_006353
1206 Ga0495685_008725
1207 Ga0495685_013537
1208 Ga0495673_0000012
1209 Ga0495673_0000604
1210 Ga0495673_0000925
1211 Ga0495681_0008029
1212 Ga0495681_0010291
1213 Ga0495681_0012752
1214 Ga0495681_0025206
1215 Ga0495681_0025984
1216 Ga0495681_0029571
1217 Ga0495681_0040177
1218 Ga0495686_0005894
1219 Ga0495686_0006159
1220 Ga0495686_0006674
1221 Ga0495686_0038904
1222 Ga0495593_0008563
1223 Ga0495593_0047816
1224 Ga0495602_0032543
1225 Ga0495602_0040161
1226 Ga0495602_0057841
1227 Ga0495602_0182991
1228 Ga0495614_0001278
1229 Ga0495626_0000005
1230 Ga0495626_0001243
1231 Ga0495626_0001440
1232 Ga0495626_0001722
1233 Ga0495626_0008571
1234 Ga0495626_0009225
1235 Ga0495626_0009230
1236 Ga0495626_0018816
1237 Ga0495626_0028198
1238 Ga0495626_0031674
1239 Ga0495626_0040257
1240 Ga0495626_0041634
1241 Ga0495626_0042191
1242 Ga0495626_0050730
1243 Ga0495626_0055591
1244 Ga0496101_0031771
1245 Ga0496101_0044087
1246 Ga0496102_0000082
1247 Ga0496102_0001712
1248 Ga0496102_0015984
1249 Ga0496102_0060081
1250 Ga0496103_0062805
1251 Ga0496103_0095651
1252 Ga0496104_0158749
1253 Ga0496105_0082523
1254 Ga0496106_0170774
1255 Ga0496107_0091869
1256 Ga0496107_0097410
1257 Ga0496107_0118093
1258 Ga0496110_0000659
1259 Ga0496110_0043460
1260 Ga0496111_0002899
1261 Ga0496112_0136023
1262 Ga0496113_0033743
1263 Ga0496115_0025298
1264 Ga0496115_0080112
1265 Ga0496116_0051207
1266 Ga0496116_0071036
1267 Ga0496117_0000075
1268 Ga0496118_0000055
1269 Ga0496121_0003786
1270 Ga0496121_0008034
1271 Ga0496121_0123103
1272 Ga0496122_0003341
1273 Ga0496122_0007255
1274 Ga0496122_0011140
1275 Ga0496123_0006778
1276 Ga0496123_0007415
1277 Ga0496123_0009556
1278 Ga0496123_0022950
1279 Ga0496124_0013871
1280 Ga0496124_0021994
1281 Ga0496124_0033769
1282 Ga0496124_0112903
1283 Ga0496125_0000487
1284 Ga0496125_0011120
1285 Ga0496125_0126119
1286 Ga0496126_0094685
1287 Ga0496126_0162934
1288 Ga0495678_000027
1289 Ga0495678_001082
1290 Ga0495678_001136
1291 Ga0495678_001459
1292 Ga0495678_002154
1293 Ga0495678_004343
1294 Ga0495678_006992
1295 Ga0495678_012018
1296 Ga0495678_012665
1297 Ga0495678_023500
1298 Ga0495682_0001880
1299 Ga0495682_0004649
1300 Ga0495682_0007972
1301 Ga0495682_0017797
1302 Ga0501034_0145341
1303 Ga0501269_000385
1304 Ga0501279_000681
1305 Ga0501035_0009455
1306 Ga0500594_0003545
1307 Ga0500595_000862
1308 Ga0500618_018130
1309 Ga0500574_000191
1310 Ga0500586_000619
1311 Ga0500586_049295
1312 Ga0500619_000200
1313 Ga0587068_002129
1314 Ga0466962_0039282
1315 2601666987
1316 2643801145
1317 2644029885
1318 2644214235
1319 2644251734
1320 2644356090
1321 2644471863
1322 2738742650
1323 2738826022
1324 2738842336
1325 2739149819
1326 2739191738
1327 2739273090
1328 2739318215
1329 2739336456
1330 2739342134
1331 2809146554
1332 2819542260
1333 2821136357
1334 2842717660
1335 2857552881
1336 2857558089
1337 2857563437
1338 2857570406
1339 2885083899
1340 2904428541
1341 2919476305
1342 2932415543
1343 2932421533
1344 8047675460

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13311

DUF4080

Protein of unknown function (DUF4080)

442

572

0.85

PF04055

Radical_SAM

Radical SAM superfamily

248

416

0.83

PF02310

B12-binding

B12 binding domain

86

205

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wtf-assembly2.cif.gz_B structure of radical s-adenosylmethionine methyltransferase, tsrm, from kitasatospora setae with tryptophan substrate and sam analog (aza-sam) bound 0.7636 2 359
6wte-assembly2.cif.gz_B structure of radical s-adenosylmethionine methyltransferase, tsrm, from kitasatospora setae with cobalamin and [4fe-4s] cluster bound 0.7595 1 365
6b4c-assembly10.cif.gz_J structure of viperin from trichoderma virens 0.7562 195 348
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.7512 168 351
6wte-assembly1.cif.gz_A structure of radical s-adenosylmethionine methyltransferase, tsrm, from kitasatospora setae with cobalamin and [4fe-4s] cluster bound 0.7506 1 372
ID Description Score Start End Superfamily
af_A0A1D6JM25_181_293_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.881 277 359 3.30.750.200
af_A4IGH2_157_284_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.8562 276 365 3.30.750.200
4jc0B03 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.8103 276 359 3.30.750.200
af_Q4CUJ9_220_394_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.8066 235 365 3.30.750.200
af_P96395_5_123_3.40.50.280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.8034 41 131 3.40.50.280
ID Description Score Start End GO Terms
AF-A0A1Z5I5E2-F1-model_v4 deleted 0.9744 286 401
AF-A0A6S6RTR1-F1-model_v4 Mg-protoporphyrin IX monomethyl ester oxidative cyclase 0.9632 3 455 GO:0003824
GO:0005829
GO:0031419
GO:0046872
GO:0051536
AF-A0A1F9LJS9-F1-model_v4 Uncharacterized protein 0.9543 1 471 GO:0003824
GO:0005829
GO:0031419
GO:0046872
GO:0051536
AF-A0A356ULS6-F1-model_v4 deleted 0.9523 250 471
AF-A0A7C5CTK3-F1-model_v4 DUF4080 domain-containing protein 0.9509 1 471 GO:0003824
GO:0005829
GO:0031419
GO:0046872
GO:0051536

Map