F474228
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 672 | 251 | 1344 | 495 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10066531|Ga0105241_100665313 |
| Length | 579 |
| Sequence | LLKIVFGTTLLRFANRFVRQQQRSEIIQCFAMFVNFFFSPSKRSEPFEGLSFATRDRIIPASHTARKSRYNGRFAALAETAVMTILLSTLNARYAHASLGLRYLLANMGPLQEQTSLMEFVIGAKTTEVVERLLAKKPRIVGFGIYIWNVEETTKVVAMLKRVAPEVTVVLGGPEVSHETGEQEIVRLADYVVTGWGDITFPKLCGDILHGPKPIMKVHAGVQPPMAEIALPYTLYSDEDIAHRTIYVEASRGCPFKCEFCLSSLDKTAWPFGIDTFLAEMETLYQRGARLFKFVDRTFNLNVKTSQRIMQFFLDKIAANPDDPVYAHFELVPDHLPEALKATIAQFPPGALQFEIGIQSFNPEVQTLVSRRQDNAKAADNIRWLMAHSHXXXXVDLIAGLPGEDVESFARGFDQLVALGPHEIQFGILKRLRGTPIIRHTEPYKMVYEPYPPYTVLATDRIDFATMQRLVRFARYWDLVANSGRFAHTVKVLLGDSPFANFMAFSDWMYTQLDATHRIALDRLAKLVQAWLQLRGMPAHDAAALVASDYAGSAHKPADKSTQAKPAAAPERQVRHLAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 9 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 33 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 38 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 39 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 40 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 41 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 43 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 51 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 52 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 55 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 77 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 78 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 79 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 80 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 81 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 82 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 83 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 84 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 85 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 86 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 87 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 88 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 89 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 90 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 91 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 92 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 93 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 94 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 95 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 96 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 97 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 98 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 99 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 100 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 101 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 102 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 103 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 192 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 193 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 196 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 197 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 198 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 199 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 200 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 201 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 202 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 203 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 204 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 205 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 206 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 207 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 208 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 212 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 213 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 215 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 216 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 217 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 218 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 219 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 220 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 222 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 223 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 224 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 225 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 226 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 227 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 228 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 229 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 230 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 231 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 232 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 233 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 234 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 235 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 236 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 237 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 238 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 239 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 240 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 241 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 242 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 243 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 244 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 245 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 246 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 247 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 248 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 249 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 250 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 251 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.39 |
| Metatranscriptomes | 0.15 |
| Isolates | 4.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.1 |
| Nodule | 0.45 |
| Rhizoplane | 3.27 |
| Rhizosphere | 75.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105241_10066531 | 3300009174 | Bacteria | 2787 |
| 2 | JGI25162J39368_1000023 | 3300002737 | Bacteria | 236658 |
| 3 | JGI25150J39212_1003512 | 3300002774 | Bacteria | 3657 |
| 4 | JGI25159J45721_1002946 | 3300002987 | Bacteria | 6200 |
| 5 | JGI25165J46597_1000030 | 3300003214 | Bacteria | 305254 |
| 6 | JGI25153J46596_10018066 | 3300003215 | Bacteria | 2753 |
| 7 | rootL2_10102555 | 3300003322 | Bacteria | 2715 |
| 8 | JGI25161J50226_1001616 | 3300003374 | Bacteria | 6542 |
| 9 | Ga0055538_1000017 | 3300003751 | Bacteria | 305254 |
| 10 | Ga0055539_1000022 | 3300003752 | Bacteria | 305254 |
| 11 | Ga0055533_1000030 | 3300003756 | Bacteria | 305254 |
| 12 | Ga0055525_1000028 | 3300003759 | Bacteria | 331683 |
| 13 | Ga0055525_1000034 | 3300003759 | Bacteria | 305254 |
| 14 | Ga0055542_1007275 | 3300003762 | Bacteria | 2264 |
| 15 | Ga0055529_1000583 | 3300003763 | Bacteria | 29289 |
| 16 | Ga0055526_1000149 | 3300003771 | Bacteria | 61682 |
| 17 | Ga0055526_1001052 | 3300003771 | Bacteria | 20145 |
| 18 | Ga0055526_1001207 | 3300003771 | Bacteria | 18616 |
| 19 | Ga0055526_1005381 | 3300003771 | Bacteria | 7372 |
| 20 | Ga0055537_1000578 | 3300003773 | Bacteria | 20349 |
| 21 | Ga0055537_1006621 | 3300003773 | Bacteria | 2909 |
| 22 | Ga0055537_1011931 | 3300003773 | Bacteria | 1727 |
| 23 | Ga0055524_1000124 | 3300003775 | Bacteria | 90282 |
| 24 | Ga0055524_1013278 | 3300003775 | Bacteria | 3113 |
| 25 | Ga0055534_1000489 | 3300003784 | Bacteria | 21927 |
| 26 | Ga0055528_1000575 | 3300003790 | Bacteria | 27746 |
| 27 | Ga0055530_10004148 | 3300003791 | Bacteria | 7662 |
| 28 | Ga0055531_10006260 | 3300003794 | Bacteria | 6789 |
| 29 | Ga0055531_10028577 | 3300003794 | Bacteria | 1919 |
| 30 | Ga0055541_1000015 | 3300003841 | Bacteria | 305254 |
| 31 | Ga0055543_1002129 | 3300004625 | Bacteria | 6850 |
| 32 | Ga0065165_1000167 | 3300005262 | Bacteria | 115630 |
| 33 | Ga0065165_1001081 | 3300005262 | Bacteria | 32488 |
| 34 | Ga0065165_1005706 | 3300005262 | Bacteria | 6850 |
| 35 | Ga0070670_100173927 | 3300005331 | Bacteria | 1868 |
| 36 | Ga0070682_100004447 | 3300005337 | Bacteria | 7781 |
| 37 | Ga0070660_100002856 | 3300005339 | Bacteria | 11893 |
| 38 | Ga0070660_100069403 | 3300005339 | Bacteria | 2748 |
| 39 | Ga0070660_100139181 | 3300005339 | Bacteria | 1946 |
| 40 | Ga0070661_100007701 | 3300005344 | Bacteria | 7440 |
| 41 | Ga0070661_100147763 | 3300005344 | Bacteria | 1775 |
| 42 | Ga0070659_100004956 | 3300005366 | Bacteria | 9526 |
| 43 | Ga0068855_100176608 | 3300005563 | Bacteria | 2416 |
| 44 | Ga0070664_100063092 | 3300005564 | Bacteria | 3159 |
| 45 | Ga0099826_10002381 | 3300006948 | Bacteria | 12104 |
| 46 | Ga0105244_10013076 | 3300009036 | Bacteria | 4869 |
| 47 | Ga0105243_10019283 | 3300009148 | Bacteria | 5170 |
| 48 | Ga0105237_10127719 | 3300009545 | Bacteria | 2536 |
| 49 | Ga0105239_10283770 | 3300010375 | Bacteria | 1864 |
| 50 | Ga0182008_10002513 | 3300014497 | Bacteria | 11447 |
| 51 | Ga0182006_1000095 | 3300015261 | Bacteria | 105469 |
| 52 | Ga0182006_1000216 | 3300015261 | Bacteria | 56213 |
| 53 | Ga0182007_10001265 | 3300015262 | Bacteria | 13727 |
| 54 | Ga0182007_10001951 | 3300015262 | Bacteria | 10665 |
| 55 | Ga0182005_1000057 | 3300015265 | Bacteria | 104753 |
| 56 | Ga0182005_1000119 | 3300015265 | Bacteria | 57192 |
| 57 | Ga0182005_1000134 | 3300015265 | Bacteria | 53164 |
| 58 | Ga0163161_10010197 | 3300017792 | Bacteria | 6505 |
| 59 | Ga0213872_10000481 | 3300021361 | Bacteria | 32134 |
| 60 | Ga0213872_10034755 | 3300021361 | Bacteria | 2306 |
| 61 | Ga0209436_101730 | 3300025208 | Bacteria | 7176 |
| 62 | Ga0209784_100034 | 3300025224 | Bacteria | 305504 |
| 63 | Ga0209566_100038 | 3300025225 | Bacteria | 305504 |
| 64 | Ga0209674_100056 | 3300025226 | Bacteria | 305504 |
| 65 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 66 | Ga0209563_100057 | 3300025230 | Bacteria | 305604 |
| 67 | Ga0207427_100498 | 3300025231 | Bacteria | 20958 |
| 68 | Ga0209437_100071 | 3300025233 | Bacteria | 305604 |
| 69 | Ga0207425_1000493 | 3300025245 | Bacteria | 24717 |
| 70 | Ga0207425_1000761 | 3300025245 | Bacteria | 16694 |
| 71 | Ga0207425_1001383 | 3300025245 | Bacteria | 10259 |
| 72 | Ga0209646_1000384 | 3300025246 | Bacteria | 28428 |
| 73 | Ga0209677_100035 | 3300025253 | Bacteria | 305504 |
| 74 | Ga0209677_107612 | 3300025253 | Bacteria | 2263 |
| 75 | Ga0209148_1000381 | 3300025254 | Bacteria | 53384 |
| 76 | Ga0209129_1000600 | 3300025258 | Bacteria | 24491 |
| 77 | Ga0209129_1004176 | 3300025258 | Bacteria | 5819 |
| 78 | Ga0209233_1000094 | 3300025261 | Bacteria | 305604 |
| 79 | Ga0209565_1000112 | 3300025263 | Bacteria | 117209 |
| 80 | Ga0209565_1002964 | 3300025263 | Bacteria | 5760 |
| 81 | Ga0209565_1014178 | 3300025263 | Bacteria | 1840 |
| 82 | Ga0209565_1014389 | 3300025263 | Bacteria | 1819 |
| 83 | Ga0209455_1000484 | 3300025272 | Bacteria | 29439 |
| 84 | Ga0209673_1000210 | 3300025273 | Bacteria | 117276 |
| 85 | Ga0209130_1000016 | 3300025284 | Bacteria | 395540 |
| 86 | Ga0209130_1002714 | 3300025284 | Bacteria | 8411 |
| 87 | Ga0209130_1003164 | 3300025284 | Bacteria | 7277 |
| 88 | Ga0209130_1004431 | 3300025284 | Bacteria | 5331 |
| 89 | Ga0209675_1000761 | 3300025291 | Bacteria | 21640 |
| 90 | Ga0209675_1003306 | 3300025291 | Bacteria | 7743 |
| 91 | Ga0209675_1013045 | 3300025291 | Bacteria | 2631 |
| 92 | Ga0209675_1017794 | 3300025291 | Bacteria | 2015 |
| 93 | Ga0209025_1014809 | 3300025294 | Bacteria | 4761 |
| 94 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 95 | Ga0209564_1000245 | 3300025295 | Bacteria | 117378 |
| 96 | Ga0209564_1001321 | 3300025295 | Bacteria | 26542 |
| 97 | Ga0209564_1002064 | 3300025295 | Bacteria | 17279 |
| 98 | Ga0209564_1020018 | 3300025295 | Bacteria | 2472 |
| 99 | Ga0209758_1000957 | 3300025297 | Bacteria | 38982 |
| 100 | Ga0209758_1001720 | 3300025297 | Bacteria | 24474 |
| 101 | Ga0209050_1000086 | 3300025298 | Bacteria | 262009 |
| 102 | Ga0209050_1002207 | 3300025298 | Bacteria | 17496 |
| 103 | Ga0209256_1000268 | 3300025299 | Bacteria | 91897 |
| 104 | Ga0209256_1001618 | 3300025299 | Bacteria | 21976 |
| 105 | Ga0209256_1002073 | 3300025299 | Bacteria | 17627 |
| 106 | Ga0209256_1002630 | 3300025299 | Bacteria | 14174 |
| 107 | Ga0209256_1007095 | 3300025299 | Bacteria | 5658 |
| 108 | Ga0209051_1006544 | 3300025303 | Bacteria | 6544 |
| 109 | Ga0209257_1006299 | 3300025304 | Bacteria | 7744 |
| 110 | Ga0209257_1007877 | 3300025304 | Bacteria | 6271 |
| 111 | Ga0207655_1009754 | 3300025728 | Bacteria | 5918 |
| 112 | Ga0207671_10112100 | 3300025914 | Bacteria | 2076 |
| 113 | Ga0207657_10018511 | 3300025919 | Bacteria | 6644 |
| 114 | Ga0207657_10095874 | 3300025919 | Bacteria | 2468 |
| 115 | Ga0207657_10146190 | 3300025919 | Bacteria | 1928 |
| 116 | Ga0207649_10025866 | 3300025920 | Bacteria | 3428 |
| 117 | Ga0207690_10013185 | 3300025932 | Bacteria | 4961 |
| 118 | Ga0207706_10086551 | 3300025933 | Bacteria | 2755 |
| 119 | Ga0207709_10032012 | 3300025935 | Bacteria | 3077 |
| 120 | Ga0207679_10144187 | 3300025945 | Bacteria | 1929 |
| 121 | Ga0209281_1011138 | 3300027111 | Bacteria | 2026 |
| 122 | Ga0209282_1000066 | 3300027666 | Bacteria | 87072 |
| 123 | Ga0307515_10099073 | 3300028794 | Bacteria | 3542 |
| 124 | Ga0316182_1122702 | 3300030745 | Bacteria | 3826 |
| 125 | Ga0307408_100001878 | 3300031548 | Bacteria | 15299 |
| 126 | Ga0307408_100006441 | 3300031548 | Bacteria | 7781 |
| 127 | Ga0307408_100013856 | 3300031548 | Bacteria | 5353 |
| 128 | Ga0307408_100048403 | 3300031548 | Bacteria | 3049 |
| 129 | Ga0265314_10048457 | 3300031711 | Bacteria | 2982 |
| 130 | Ga0395899_0000575 | 3300037312 | Bacteria | 39137 |
| 131 | Ga0395899_0000762 | 3300037312 | Bacteria | 31826 |
| 132 | Ga0395899_0001822 | 3300037312 | Bacteria | 17649 |
| 133 | Ga0395899_0014827 | 3300037312 | Bacteria | 5948 |
| 134 | Ga0395899_0061046 | 3300037312 | Bacteria | 2776 |
| 135 | Ga0395900_0004198 | 3300037418 | Bacteria | 15292 |
| 136 | Ga0395900_0020705 | 3300037418 | Bacteria | 6721 |
| 137 | Ga0395900_0026862 | 3300037418 | Bacteria | 5891 |
| 138 | Ga0395900_0049797 | 3300037418 | Bacteria | 4316 |
| 139 | Ga0395900_0065519 | 3300037418 | Bacteria | 3732 |
| 140 | Ga0395900_0170962 | 3300037418 | Bacteria | 2212 |
| 141 | Ga0395898_0089301 | 3300037466 | Bacteria | 2965 |
| 142 | Ga0395898_0118987 | 3300037466 | Bacteria | 2530 |
| 143 | Ga0395905_0001070 | 3300037471 | Bacteria | 34507 |
| 144 | Ga0395905_0009521 | 3300037471 | Bacteria | 9490 |
| 145 | Ga0395905_0055021 | 3300037471 | Bacteria | 3724 |
| 146 | Ga0395901_0001364 | 3300038443 | Bacteria | 25549 |
| 147 | Ga0395901_0006884 | 3300038443 | Bacteria | 11482 |
| 148 | Ga0395901_0050535 | 3300038443 | Bacteria | 4319 |
| 149 | Ga0436361_0108001 | 3300039447 | Bacteria | 112244 |
| 150 | Ga0436361_0217337 | 3300039447 | Bacteria | 18930 |
| 151 | Ga0436361_1031912 | 3300039447 | Bacteria | 21537 |
| 152 | Ga0439448_0008515 | 3300042005 | Bacteria | 3005 |
| 153 | Ga0450897_000149 | 3300042128 | Bacteria | 3289 |
| 154 | Ga0450904_000062 | 3300042139 | Bacteria | 24255 |
| 155 | Ga0439458_0002215 | 3300042157 | Bacteria | 4797 |
| 156 | Ga0466972_0000373 | 3300044658 | Bacteria | 24131 |
| 157 | Ga0466972_0026689 | 3300044658 | Bacteria | 2861 |
| 158 | Ga0466965_0028388 | 3300044683 | Bacteria | 2719 |
| 159 | Ga0466965_0030967 | 3300044683 | Bacteria | 2607 |
| 160 | Ga0466966_0087480 | 3300044684 | Bacteria | 1936 |
| 161 | Ga0466966_0089391 | 3300044684 | Bacteria | 1913 |
| 162 | Ga0466963_0070914 | 3300044694 | Bacteria | 2344 |
| 163 | Ga0466964_0000883 | 3300044706 | Bacteria | 9829 |
| 164 | Ga0466964_0002132 | 3300044706 | Bacteria | 6976 |
| 165 | Ga0466964_0011013 | 3300044706 | Bacteria | 3416 |
| 166 | Ga0466964_0038294 | 3300044706 | Bacteria | 1927 |
| 167 | Ga0453684_0029009 | 3300044712 | Bacteria | 7872 |
| 168 | Ga0466968_0000881 | 3300044735 | Bacteria | 10552 |
| 169 | Ga0466968_0006523 | 3300044735 | Bacteria | 4403 |
| 170 | Ga0466968_0047929 | 3300044735 | Bacteria | 1818 |
| 171 | Ga0466970_0018709 | 3300044765 | Bacteria | 3589 |
| 172 | Ga0466957_0000182 | 3300044842 | Bacteria | 28463 |
| 173 | Ga0466957_0026183 | 3300044842 | Bacteria | 3459 |
| 174 | Ga0466957_0079753 | 3300044842 | Bacteria | 2037 |
| 175 | Ga0466959_0002186 | 3300045049 | Bacteria | 12439 |
| 176 | Ga0466959_0044565 | 3300045049 | Bacteria | 3268 |
| 177 | Ga0466967_0090863 | 3300045976 | Bacteria | 2774 |
| 178 | Ga0495617_000010 | 3300046452 | Bacteria | 310258 |
| 179 | Ga0495617_000471 | 3300046452 | Bacteria | 21547 |
| 180 | Ga0495617_013939 | 3300046452 | Bacteria | 2732 |
| 181 | Ga0495627_000378 | 3300046453 | Bacteria | 40927 |
| 182 | Ga0495627_000690 | 3300046453 | Bacteria | 25783 |
| 183 | Ga0495592_0011996 | 3300046454 | Bacteria | 6568 |
| 184 | Ga0495603_0033142 | 3300046455 | Bacteria | 3108 |
| 185 | Ga0495590_0000009 | 3300046457 | Bacteria | 320425 |
| 186 | Ga0495590_0000201 | 3300046457 | Bacteria | 33657 |
| 187 | Ga0495590_0008255 | 3300046457 | Bacteria | 3981 |
| 188 | Ga0495590_0024851 | 3300046457 | Bacteria | 2109 |
| 189 | Ga0495591_000867 | 3300046458 | Bacteria | 21241 |
| 190 | Ga0495629_0034848 | 3300046459 | Bacteria | 3558 |
| 191 | Ga0495638_0004523 | 3300046460 | Bacteria | 10535 |
| 192 | Ga0495638_0018956 | 3300046460 | Bacteria | 4559 |
| 193 | Ga0495638_0021457 | 3300046460 | Bacteria | 4256 |
| 194 | Ga0495638_0091992 | 3300046460 | Bacteria | 1826 |
| 195 | Ga0495651_0025844 | 3300046462 | Bacteria | 4571 |
| 196 | Ga0495653_0000959 | 3300046463 | Bacteria | 22101 |
| 197 | Ga0495653_0007503 | 3300046463 | Bacteria | 8919 |
| 198 | Ga0495653_0021789 | 3300046463 | Bacteria | 5187 |
| 199 | Ga0495653_0048941 | 3300046463 | Bacteria | 3259 |
| 200 | Ga0495650_0000062 | 3300046471 | Bacteria | 277977 |
| 201 | Ga0495650_0001085 | 3300046471 | Bacteria | 29863 |
| 202 | Ga0495650_0001544 | 3300046471 | Bacteria | 21838 |
| 203 | Ga0495650_0001553 | 3300046471 | Bacteria | 21682 |
| 204 | Ga0495650_0003055 | 3300046471 | Bacteria | 12597 |
| 205 | Ga0495650_0003201 | 3300046471 | Bacteria | 12180 |
| 206 | Ga0495650_0027270 | 3300046471 | Bacteria | 2642 |
| 207 | Ga0495580_0082024 | 3300046472 | Bacteria | 2247 |
| 208 | Ga0495582_0001880 | 3300046473 | Bacteria | 11839 |
| 209 | Ga0495605_0000635 | 3300046474 | Bacteria | 26971 |
| 210 | Ga0495605_0000941 | 3300046474 | Bacteria | 19886 |
| 211 | Ga0495605_0001966 | 3300046474 | Bacteria | 13026 |
| 212 | Ga0495605_0004232 | 3300046474 | Bacteria | 8451 |
| 213 | Ga0495605_0005989 | 3300046474 | Bacteria | 7027 |
| 214 | Ga0495605_0024319 | 3300046474 | Bacteria | 3171 |
| 215 | Ga0495605_0060256 | 3300046474 | Bacteria | 1819 |
| 216 | Ga0495584_0000092 | 3300046491 | Bacteria | 62079 |
| 217 | Ga0495584_0001978 | 3300046491 | Bacteria | 11796 |
| 218 | Ga0495584_0003316 | 3300046491 | Bacteria | 8912 |
| 219 | Ga0495584_0004486 | 3300046491 | Bacteria | 7503 |
| 220 | Ga0495584_0004909 | 3300046491 | Bacteria | 7136 |
| 221 | Ga0495584_0007603 | 3300046491 | Bacteria | 5647 |
| 222 | Ga0495584_0014663 | 3300046491 | Bacteria | 3992 |
| 223 | Ga0495584_0026964 | 3300046491 | Bacteria | 2911 |
| 224 | Ga0495584_0044137 | 3300046491 | Bacteria | 2250 |
| 225 | Ga0495584_0070975 | 3300046491 | Bacteria | 1750 |
| 226 | Ga0495585_0000984 | 3300046492 | Bacteria | 23867 |
| 227 | Ga0495585_0001005 | 3300046492 | Bacteria | 23544 |
| 228 | Ga0495585_0001417 | 3300046492 | Bacteria | 18856 |
| 229 | Ga0495585_0001517 | 3300046492 | Bacteria | 18039 |
| 230 | Ga0495585_0004278 | 3300046492 | Bacteria | 9295 |
| 231 | Ga0495585_0011361 | 3300046492 | Bacteria | 5269 |
| 232 | Ga0495585_0022517 | 3300046492 | Bacteria | 3616 |
| 233 | Ga0495585_0031792 | 3300046492 | Bacteria | 2994 |
| 234 | Ga0495585_0043376 | 3300046492 | Bacteria | 2516 |
| 235 | Ga0495585_0046854 | 3300046492 | Bacteria | 2409 |
| 236 | Ga0495594_0022587 | 3300046499 | Bacteria | 3365 |
| 237 | Ga0495594_0034582 | 3300046499 | Bacteria | 2749 |
| 238 | Ga0495594_0045489 | 3300046499 | Bacteria | 2409 |
| 239 | Ga0495594_0052771 | 3300046499 | Bacteria | 2238 |
| 240 | Ga0495594_0060757 | 3300046499 | Bacteria | 2090 |
| 241 | Ga0495596_0000350 | 3300046500 | Bacteria | 29880 |
| 242 | Ga0495596_0003154 | 3300046500 | Bacteria | 8494 |
| 243 | Ga0495596_0005660 | 3300046500 | Bacteria | 5867 |
| 244 | Ga0495596_0017984 | 3300046500 | Bacteria | 2918 |
| 245 | Ga0495596_0029258 | 3300046500 | Bacteria | 2209 |
| 246 | Ga0495607_0001154 | 3300046501 | Bacteria | 23921 |
| 247 | Ga0495607_0002568 | 3300046501 | Bacteria | 14670 |
| 248 | Ga0495607_0005276 | 3300046501 | Bacteria | 9295 |
| 249 | Ga0495607_0005305 | 3300046501 | Bacteria | 9266 |
| 250 | Ga0495607_0005622 | 3300046501 | Bacteria | 8944 |
| 251 | Ga0495607_0016913 | 3300046501 | Bacteria | 4695 |
| 252 | Ga0495607_0016975 | 3300046501 | Bacteria | 4686 |
| 253 | Ga0495607_0051073 | 3300046501 | Bacteria | 2403 |
| 254 | Ga0495607_0055384 | 3300046501 | Bacteria | 2281 |
| 255 | Ga0495583_0000329 | 3300046506 | Bacteria | 75158 |
| 256 | Ga0495583_0000952 | 3300046506 | Bacteria | 33646 |
| 257 | Ga0495583_0001471 | 3300046506 | Bacteria | 23592 |
| 258 | Ga0495583_0001555 | 3300046506 | Bacteria | 22720 |
| 259 | Ga0495583_0005015 | 3300046506 | Bacteria | 9169 |
| 260 | Ga0495583_0005584 | 3300046506 | Bacteria | 8483 |
| 261 | Ga0495583_0015248 | 3300046506 | Bacteria | 4188 |
| 262 | Ga0495583_0023988 | 3300046506 | Bacteria | 3074 |
| 263 | Ga0495583_0024089 | 3300046506 | Bacteria | 3065 |
| 264 | Ga0495583_0024817 | 3300046506 | Bacteria | 3005 |
| 265 | Ga0495583_0028401 | 3300046506 | Bacteria | 2750 |
| 266 | Ga0495583_0031168 | 3300046506 | Bacteria | 2588 |
| 267 | Ga0495606_0000428 | 3300046507 | Bacteria | 70021 |
| 268 | Ga0495606_0001517 | 3300046507 | Bacteria | 30788 |
| 269 | Ga0495606_0001842 | 3300046507 | Bacteria | 26721 |
| 270 | Ga0495606_0001977 | 3300046507 | Bacteria | 25276 |
| 271 | Ga0495606_0002381 | 3300046507 | Bacteria | 22050 |
| 272 | Ga0495606_0004131 | 3300046507 | Bacteria | 14744 |
| 273 | Ga0495606_0007799 | 3300046507 | Bacteria | 9473 |
| 274 | Ga0495606_0009754 | 3300046507 | Bacteria | 8076 |
| 275 | Ga0495606_0012328 | 3300046507 | Bacteria | 6871 |
| 276 | Ga0495606_0031689 | 3300046507 | Bacteria | 3671 |
| 277 | Ga0495606_0095805 | 3300046507 | Bacteria | 1816 |
| 278 | Ga0495608_0013893 | 3300046511 | Bacteria | 5589 |
| 279 | Ga0495610_0000014 | 3300046512 | Bacteria | 444708 |
| 280 | Ga0495610_0003364 | 3300046512 | Bacteria | 12537 |
| 281 | Ga0495610_0007708 | 3300046512 | Bacteria | 7103 |
| 282 | Ga0495616_0000547 | 3300046513 | Bacteria | 28354 |
| 283 | Ga0495616_0001040 | 3300046513 | Bacteria | 19861 |
| 284 | Ga0495616_0001268 | 3300046513 | Bacteria | 17756 |
| 285 | Ga0495616_0006198 | 3300046513 | Bacteria | 7275 |
| 286 | Ga0495616_0039681 | 3300046513 | Bacteria | 2409 |
| 287 | Ga0495616_0045400 | 3300046513 | Bacteria | 2224 |
| 288 | Ga0495616_0046318 | 3300046513 | Bacteria | 2195 |
| 289 | Ga0495616_0059304 | 3300046513 | Bacteria | 1882 |
| 290 | Ga0495616_0060690 | 3300046513 | Bacteria | 1856 |
| 291 | Ga0495618_0011394 | 3300046514 | Bacteria | 5391 |
| 292 | Ga0495620_0035174 | 3300046515 | Bacteria | 2255 |
| 293 | Ga0495628_0000076 | 3300046516 | Bacteria | 78344 |
| 294 | Ga0495628_0003214 | 3300046516 | Bacteria | 14649 |
| 295 | Ga0495631_0000869 | 3300046518 | Bacteria | 19019 |
| 296 | Ga0495631_0016477 | 3300046518 | Bacteria | 3521 |
| 297 | Ga0495631_0031969 | 3300046518 | Bacteria | 2374 |
| 298 | Ga0495631_0032702 | 3300046518 | Bacteria | 2343 |
| 299 | Ga0495632_0001345 | 3300046519 | Bacteria | 20659 |
| 300 | Ga0495632_0005648 | 3300046519 | Bacteria | 8226 |
| 301 | Ga0495632_0007159 | 3300046519 | Bacteria | 7055 |
| 302 | Ga0495632_0016710 | 3300046519 | Bacteria | 4071 |
| 303 | Ga0495632_0041955 | 3300046519 | Bacteria | 2295 |
| 304 | Ga0495637_0000003 | 3300046520 | Bacteria | 623293 |
| 305 | Ga0495637_0007025 | 3300046520 | Bacteria | 5605 |
| 306 | Ga0495637_0008969 | 3300046520 | Bacteria | 4893 |
| 307 | Ga0495637_0029493 | 3300046520 | Bacteria | 2442 |
| 308 | Ga0495643_0000891 | 3300046522 | Bacteria | 31774 |
| 309 | Ga0495643_0001105 | 3300046522 | Bacteria | 26855 |
| 310 | Ga0495643_0001198 | 3300046522 | Bacteria | 25224 |
| 311 | Ga0495643_0004987 | 3300046522 | Bacteria | 9103 |
| 312 | Ga0495643_0006489 | 3300046522 | Bacteria | 7698 |
| 313 | Ga0495643_0013877 | 3300046522 | Bacteria | 4806 |
| 314 | Ga0495643_0018368 | 3300046522 | Bacteria | 4065 |
| 315 | Ga0495643_0029050 | 3300046522 | Bacteria | 3095 |
| 316 | Ga0495643_0033135 | 3300046522 | Bacteria | 2861 |
| 317 | Ga0495643_0059405 | 3300046522 | Bacteria | 2032 |
| 318 | Ga0495643_0060639 | 3300046522 | Bacteria | 2007 |
| 319 | Ga0495643_0064493 | 3300046522 | Bacteria | 1935 |
| 320 | Ga0495643_0071994 | 3300046522 | Bacteria | 1813 |
| 321 | Ga0495644_0008384 | 3300046523 | Bacteria | 3979 |
| 322 | Ga0495644_0008814 | 3300046523 | Bacteria | 3879 |
| 323 | Ga0495644_0028801 | 3300046523 | Bacteria | 2100 |
| 324 | Ga0495644_0040765 | 3300046523 | Bacteria | 1750 |
| 325 | Ga0495648_0000751 | 3300046524 | Bacteria | 34631 |
| 326 | Ga0495648_0003454 | 3300046524 | Bacteria | 13901 |
| 327 | Ga0495648_0003783 | 3300046524 | Bacteria | 13155 |
| 328 | Ga0495648_0003840 | 3300046524 | Bacteria | 13034 |
| 329 | Ga0495648_0013959 | 3300046524 | Bacteria | 5909 |
| 330 | Ga0495648_0013960 | 3300046524 | Bacteria | 5909 |
| 331 | Ga0495648_0030685 | 3300046524 | Bacteria | 3550 |
| 332 | Ga0495648_0048992 | 3300046524 | Bacteria | 2594 |
| 333 | Ga0495648_0063249 | 3300046524 | Bacteria | 2186 |
| 334 | Ga0495648_0077271 | 3300046524 | Bacteria | 1909 |
| 335 | Ga0495666_0005811 | 3300046526 | Bacteria | 6220 |
| 336 | Ga0495666_0016084 | 3300046526 | Bacteria | 3724 |
| 337 | Ga0495666_0061554 | 3300046526 | Bacteria | 1793 |
| 338 | Ga0495642_0001015 | 3300046528 | Bacteria | 13038 |
| 339 | Ga0495642_0001627 | 3300046528 | Bacteria | 9782 |
| 340 | Ga0495642_0002398 | 3300046528 | Bacteria | 7635 |
| 341 | Ga0495642_0008834 | 3300046528 | Bacteria | 3853 |
| 342 | Ga0495642_0012745 | 3300046528 | Bacteria | 3245 |
| 343 | Ga0495642_0012999 | 3300046528 | Bacteria | 3214 |
| 344 | Ga0495642_0019212 | 3300046528 | Bacteria | 2678 |
| 345 | Ga0495642_0021647 | 3300046528 | Bacteria | 2529 |
| 346 | Ga0495642_0030631 | 3300046528 | Bacteria | 2152 |
| 347 | Ga0495642_0030640 | 3300046528 | Bacteria | 2152 |
| 348 | Ga0495642_0045011 | 3300046528 | Bacteria | 1803 |
| 349 | Ga0495652_0003764 | 3300046529 | Bacteria | 14834 |
| 350 | Ga0495652_0009821 | 3300046529 | Bacteria | 8677 |
| 351 | Ga0495652_0036452 | 3300046529 | Bacteria | 4276 |
| 352 | Ga0495654_0000245 | 3300046530 | Bacteria | 50772 |
| 353 | Ga0495654_0012652 | 3300046530 | Bacteria | 4529 |
| 354 | Ga0495654_0024540 | 3300046530 | Bacteria | 3113 |
| 355 | Ga0495654_0032088 | 3300046530 | Bacteria | 2663 |
| 356 | Ga0495654_0034903 | 3300046530 | Bacteria | 2535 |
| 357 | Ga0495654_0037648 | 3300046530 | Bacteria | 2423 |
| 358 | Ga0495654_0050256 | 3300046530 | Bacteria | 2039 |
| 359 | Ga0495665_0006918 | 3300046531 | Bacteria | 6119 |
| 360 | Ga0495665_0036121 | 3300046531 | Bacteria | 2637 |
| 361 | Ga0495586_0018444 | 3300046535 | Bacteria | 3715 |
| 362 | Ga0495586_0054080 | 3300046535 | Bacteria | 2175 |
| 363 | Ga0495587_0107167 | 3300046536 | Bacteria | 1607 |
| 364 | Ga0495609_0000038 | 3300046538 | Bacteria | 182264 |
| 365 | Ga0495609_0000736 | 3300046538 | Bacteria | 24883 |
| 366 | Ga0495609_0000927 | 3300046538 | Bacteria | 21234 |
| 367 | Ga0495609_0001172 | 3300046538 | Bacteria | 18081 |
| 368 | Ga0495609_0008725 | 3300046538 | Bacteria | 4942 |
| 369 | Ga0495609_0012599 | 3300046538 | Bacteria | 4009 |
| 370 | Ga0495609_0017938 | 3300046538 | Bacteria | 3284 |
| 371 | Ga0495609_0018151 | 3300046538 | Bacteria | 3262 |
| 372 | Ga0495609_0019486 | 3300046538 | Bacteria | 3139 |
| 373 | Ga0495609_0029589 | 3300046538 | Bacteria | 2493 |
| 374 | Ga0495597_0000288 | 3300046542 | Bacteria | 45373 |
| 375 | Ga0495597_0000754 | 3300046542 | Bacteria | 25593 |
| 376 | Ga0495597_0001046 | 3300046542 | Bacteria | 21145 |
| 377 | Ga0495597_0001377 | 3300046542 | Bacteria | 17571 |
| 378 | Ga0495597_0003076 | 3300046542 | Bacteria | 10039 |
| 379 | Ga0495597_0010764 | 3300046542 | Bacteria | 4456 |
| 380 | Ga0495597_0011276 | 3300046542 | Bacteria | 4337 |
| 381 | Ga0495597_0032083 | 3300046542 | Bacteria | 2386 |
| 382 | Ga0495622_0000440 | 3300046557 | Bacteria | 26975 |
| 383 | Ga0495622_0001964 | 3300046557 | Bacteria | 10077 |
| 384 | Ga0495622_0019116 | 3300046557 | Bacteria | 3190 |
| 385 | Ga0495633_0000663 | 3300046558 | Bacteria | 31797 |
| 386 | Ga0495633_0001228 | 3300046558 | Bacteria | 20576 |
| 387 | Ga0495633_0001987 | 3300046558 | Bacteria | 14800 |
| 388 | Ga0495633_0003355 | 3300046558 | Bacteria | 10742 |
| 389 | Ga0495633_0009283 | 3300046558 | Bacteria | 5449 |
| 390 | Ga0495633_0015925 | 3300046558 | Bacteria | 3891 |
| 391 | Ga0495633_0016702 | 3300046558 | Bacteria | 3776 |
| 392 | Ga0495633_0035248 | 3300046558 | Bacteria | 2403 |
| 393 | Ga0495633_0037159 | 3300046558 | Bacteria | 2330 |
| 394 | Ga0495633_0056263 | 3300046558 | Bacteria | 1848 |
| 395 | Ga0495668_0000188 | 3300046616 | Bacteria | 92177 |
| 396 | Ga0495668_0000944 | 3300046616 | Bacteria | 32399 |
| 397 | Ga0495668_0001593 | 3300046616 | Bacteria | 21330 |
| 398 | Ga0495668_0003040 | 3300046616 | Bacteria | 13057 |
| 399 | Ga0495668_0005723 | 3300046616 | Bacteria | 8308 |
| 400 | Ga0495668_0005969 | 3300046616 | Bacteria | 8092 |
| 401 | Ga0495668_0006127 | 3300046616 | Bacteria | 7963 |
| 402 | Ga0495668_0007409 | 3300046616 | Bacteria | 7015 |
| 403 | Ga0495668_0017479 | 3300046616 | Bacteria | 4157 |
| 404 | Ga0495668_0017741 | 3300046616 | Bacteria | 4124 |
| 405 | Ga0495668_0021260 | 3300046616 | Bacteria | 3722 |
| 406 | Ga0495668_0022165 | 3300046616 | Bacteria | 3632 |
| 407 | Ga0495668_0024931 | 3300046616 | Bacteria | 3399 |
| 408 | Ga0495668_0036185 | 3300046616 | Bacteria | 2766 |
| 409 | Ga0495634_0011154 | 3300046642 | Bacteria | 6554 |
| 410 | Ga0495611_0003521 | 3300046648 | Bacteria | 6893 |
| 411 | Ga0495611_0008645 | 3300046648 | Bacteria | 4307 |
| 412 | Ga0495611_0031927 | 3300046648 | Bacteria | 2320 |
| 413 | Ga0495611_0036620 | 3300046648 | Bacteria | 2178 |
| 414 | Ga0495611_0037483 | 3300046648 | Bacteria | 2154 |
| 415 | Ga0495611_0047414 | 3300046648 | Bacteria | 1928 |
| 416 | Ga0495611_0049865 | 3300046648 | Bacteria | 1885 |
| 417 | Ga0495625_0001377 | 3300046660 | Bacteria | 29891 |
| 418 | Ga0495625_0002229 | 3300046660 | Bacteria | 21422 |
| 419 | Ga0495625_0007279 | 3300046660 | Bacteria | 9678 |
| 420 | Ga0495625_0018246 | 3300046660 | Bacteria | 5483 |
| 421 | Ga0495625_0052488 | 3300046660 | Bacteria | 2919 |
| 422 | Ga0495625_0053260 | 3300046660 | Bacteria | 2895 |
| 423 | Ga0495635_0039741 | 3300046663 | Bacteria | 3253 |
| 424 | Ga0495659_0000345 | 3300046664 | Bacteria | 18182 |
| 425 | Ga0495659_0003587 | 3300046664 | Bacteria | 4938 |
| 426 | Ga0495659_0018298 | 3300046664 | Bacteria | 2333 |
| 427 | Ga0495661_0000701 | 3300046665 | Bacteria | 33249 |
| 428 | Ga0495661_0001914 | 3300046665 | Bacteria | 16567 |
| 429 | Ga0495661_0003740 | 3300046665 | Bacteria | 11142 |
| 430 | Ga0495661_0007084 | 3300046665 | Bacteria | 7831 |
| 431 | Ga0495661_0008346 | 3300046665 | Bacteria | 7170 |
| 432 | Ga0495661_0012015 | 3300046665 | Bacteria | 5859 |
| 433 | Ga0495661_0027563 | 3300046665 | Bacteria | 3645 |
| 434 | Ga0495661_0030271 | 3300046665 | Bacteria | 3448 |
| 435 | Ga0495661_0050080 | 3300046665 | Bacteria | 2530 |
| 436 | Ga0495661_0054827 | 3300046665 | Bacteria | 2392 |
| 437 | Ga0495661_0057819 | 3300046665 | Bacteria | 2313 |
| 438 | Ga0495588_0000172 | 3300046674 | Bacteria | 81934 |
| 439 | Ga0495588_0017386 | 3300046674 | Bacteria | 3491 |
| 440 | Ga0495588_0023142 | 3300046674 | Bacteria | 3073 |
| 441 | Ga0495588_0025786 | 3300046674 | Bacteria | 2931 |
| 442 | Ga0495588_0046363 | 3300046674 | Bacteria | 2229 |
| 443 | Ga0495588_0067717 | 3300046674 | Bacteria | 1853 |
| 444 | Ga0495657_0046654 | 3300046675 | Bacteria | 2932 |
| 445 | Ga0495599_0000548 | 3300046678 | Bacteria | 21463 |
| 446 | Ga0495623_0042242 | 3300046679 | Bacteria | 2905 |
| 447 | Ga0495623_0066424 | 3300046679 | Bacteria | 2253 |
| 448 | Ga0495646_0004359 | 3300046680 | Bacteria | 8918 |
| 449 | Ga0495646_0011253 | 3300046680 | Bacteria | 5682 |
| 450 | Ga0495669_0000345 | 3300046684 | Bacteria | 24290 |
| 451 | Ga0495669_0003212 | 3300046684 | Bacteria | 6728 |
| 452 | Ga0495669_0010943 | 3300046684 | Bacteria | 3840 |
| 453 | Ga0495669_0016952 | 3300046684 | Bacteria | 3124 |
| 454 | Ga0495669_0025187 | 3300046684 | Bacteria | 2593 |
| 455 | Ga0495624_0026346 | 3300046690 | Bacteria | 3811 |
| 456 | Ga0495670_0008565 | 3300046691 | Bacteria | 5036 |
| 457 | Ga0495670_0010105 | 3300046691 | Bacteria | 4641 |
| 458 | Ga0495670_0011273 | 3300046691 | Bacteria | 4394 |
| 459 | Ga0495670_0024277 | 3300046691 | Bacteria | 2996 |
| 460 | Ga0495670_0028735 | 3300046691 | Bacteria | 2756 |
| 461 | Ga0495670_0065275 | 3300046691 | Bacteria | 1834 |
| 462 | Ga0495671_0001130 | 3300046692 | Bacteria | 18376 |
| 463 | Ga0495671_0003794 | 3300046692 | Bacteria | 9189 |
| 464 | Ga0495671_0006115 | 3300046692 | Bacteria | 6987 |
| 465 | Ga0495671_0013465 | 3300046692 | Bacteria | 4428 |
| 466 | Ga0495671_0014611 | 3300046692 | Bacteria | 4220 |
| 467 | Ga0495671_0026142 | 3300046692 | Bacteria | 3028 |
| 468 | Ga0495649_0006101 | 3300046694 | Bacteria | 7530 |
| 469 | Ga0495649_0012477 | 3300046694 | Bacteria | 4939 |
| 470 | Ga0495649_0023222 | 3300046694 | Bacteria | 3465 |
| 471 | Ga0495649_0039096 | 3300046694 | Bacteria | 2601 |
| 472 | Ga0495589_0000733 | 3300046794 | Bacteria | 21165 |
| 473 | Ga0495589_0000986 | 3300046794 | Bacteria | 17334 |
| 474 | Ga0495589_0001840 | 3300046794 | Bacteria | 12048 |
| 475 | Ga0495589_0025222 | 3300046794 | Bacteria | 3018 |
| 476 | Ga0495589_0026866 | 3300046794 | Bacteria | 2914 |
| 477 | Ga0495589_0045265 | 3300046794 | Bacteria | 2186 |
| 478 | Ga0495589_0047046 | 3300046794 | Bacteria | 2138 |
| 479 | Ga0495600_0000693 | 3300046809 | Bacteria | 17639 |
| 480 | Ga0495600_0023815 | 3300046809 | Bacteria | 3940 |
| 481 | Ga0495660_0001060 | 3300046810 | Bacteria | 19886 |
| 482 | Ga0495660_0010144 | 3300046810 | Bacteria | 5475 |
| 483 | Ga0495660_0014658 | 3300046810 | Bacteria | 4533 |
| 484 | Ga0495660_0018713 | 3300046810 | Bacteria | 3978 |
| 485 | Ga0495660_0030299 | 3300046810 | Bacteria | 3048 |
| 486 | Ga0495660_0042283 | 3300046810 | Bacteria | 2519 |
| 487 | Ga0495660_0076761 | 3300046810 | Bacteria | 1759 |
| 488 | Ga0495581_0023785 | 3300047315 | Bacteria | 3550 |
| 489 | Ga0495581_0026084 | 3300047315 | Bacteria | 3389 |
| 490 | Ga0495604_0019774 | 3300047317 | Bacteria | 5387 |
| 491 | Ga0495604_0031201 | 3300047317 | Bacteria | 4228 |
| 492 | Ga0495636_0001239 | 3300047318 | Bacteria | 9652 |
| 493 | Ga0495636_0008533 | 3300047318 | Bacteria | 4043 |
| 494 | Ga0495636_0009579 | 3300047318 | Bacteria | 3815 |
| 495 | Ga0495674_0009946 | 3300047319 | Bacteria | 9019 |
| 496 | Ga0495672_0000019 | 3300047320 | Bacteria | 448153 |
| 497 | Ga0495672_0000859 | 3300047320 | Bacteria | 32082 |
| 498 | Ga0495672_0001040 | 3300047320 | Bacteria | 28407 |
| 499 | Ga0495672_0001173 | 3300047320 | Bacteria | 26565 |
| 500 | Ga0495672_0001685 | 3300047320 | Bacteria | 21405 |
| 501 | Ga0495672_0006826 | 3300047320 | Bacteria | 8722 |
| 502 | Ga0495672_0029389 | 3300047320 | Bacteria | 3461 |
| 503 | Ga0495672_0068974 | 3300047320 | Bacteria | 2008 |
| 504 | Ga0495676_0000972 | 3300047321 | Bacteria | 24006 |
| 505 | Ga0495676_0035194 | 3300047321 | Bacteria | 4191 |
| 506 | Ga0495676_0035928 | 3300047321 | Bacteria | 4142 |
| 507 | Ga0495676_0038611 | 3300047321 | Bacteria | 3964 |
| 508 | Ga0495676_0052653 | 3300047321 | Bacteria | 3247 |
| 509 | Ga0495680_0007712 | 3300047322 | Bacteria | 9828 |
| 510 | Ga0495683_0000692 | 3300047323 | Bacteria | 24644 |
| 511 | Ga0495683_0003705 | 3300047323 | Bacteria | 8849 |
| 512 | Ga0495683_0003886 | 3300047323 | Bacteria | 8592 |
| 513 | Ga0495683_0012603 | 3300047323 | Bacteria | 4439 |
| 514 | Ga0495683_0026942 | 3300047323 | Bacteria | 2940 |
| 515 | Ga0495683_0064256 | 3300047323 | Bacteria | 1812 |
| 516 | Ga0495687_000405 | 3300047443 | Bacteria | 53349 |
| 517 | Ga0495687_000801 | 3300047443 | Bacteria | 33906 |
| 518 | Ga0495687_001993 | 3300047443 | Bacteria | 17334 |
| 519 | Ga0495687_005076 | 3300047443 | Bacteria | 8543 |
| 520 | Ga0495687_005120 | 3300047443 | Bacteria | 8487 |
| 521 | Ga0495687_005264 | 3300047443 | Bacteria | 8312 |
| 522 | Ga0495687_005317 | 3300047443 | Bacteria | 8255 |
| 523 | Ga0495687_008736 | 3300047443 | Bacteria | 5753 |
| 524 | Ga0495687_017089 | 3300047443 | Bacteria | 3631 |
| 525 | Ga0495675_0019271 | 3300047444 | Bacteria | 4334 |
| 526 | Ga0495677_0000527 | 3300047445 | Bacteria | 15974 |
| 527 | Ga0495677_0003170 | 3300047445 | Bacteria | 6414 |
| 528 | Ga0495677_0009195 | 3300047445 | Bacteria | 3651 |
| 529 | Ga0495679_018845 | 3300047446 | Bacteria | 2439 |
| 530 | Ga0495679_021744 | 3300047446 | Bacteria | 2207 |
| 531 | Ga0495679_023405 | 3300047446 | Bacteria | 2095 |
| 532 | Ga0495685_000157 | 3300047447 | Bacteria | 23115 |
| 533 | Ga0495685_006353 | 3300047447 | Bacteria | 3864 |
| 534 | Ga0495685_008725 | 3300047447 | Bacteria | 3375 |
| 535 | Ga0495685_013537 | 3300047447 | Bacteria | 2769 |
| 536 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 537 | Ga0495673_0000604 | 3300047469 | Bacteria | 35726 |
| 538 | Ga0495673_0000925 | 3300047469 | Bacteria | 26621 |
| 539 | Ga0495681_0008029 | 3300047470 | Bacteria | 6657 |
| 540 | Ga0495681_0010291 | 3300047470 | Bacteria | 5667 |
| 541 | Ga0495681_0012752 | 3300047470 | Bacteria | 4920 |
| 542 | Ga0495681_0025206 | 3300047470 | Bacteria | 3115 |
| 543 | Ga0495681_0025984 | 3300047470 | Bacteria | 3057 |
| 544 | Ga0495681_0029571 | 3300047470 | Bacteria | 2802 |
| 545 | Ga0495681_0040177 | 3300047470 | Bacteria | 2279 |
| 546 | Ga0495686_0005894 | 3300047472 | Bacteria | 9551 |
| 547 | Ga0495686_0006159 | 3300047472 | Bacteria | 9273 |
| 548 | Ga0495686_0006674 | 3300047472 | Bacteria | 8787 |
| 549 | Ga0495686_0038904 | 3300047472 | Bacteria | 3040 |
| 550 | Ga0495593_0008563 | 3300047673 | Bacteria | 5949 |
| 551 | Ga0495593_0047816 | 3300047673 | Bacteria | 2274 |
| 552 | Ga0495602_0032543 | 3300048088 | Bacteria | 4907 |
| 553 | Ga0495602_0040161 | 3300048088 | Bacteria | 4296 |
| 554 | Ga0495602_0057841 | 3300048088 | Bacteria | 3398 |
| 555 | Ga0495602_0182991 | 3300048088 | Bacteria | 1614 |
| 556 | Ga0495614_0001278 | 3300048089 | Bacteria | 10823 |
| 557 | Ga0495626_0000005 | 3300048091 | Bacteria | 337534 |
| 558 | Ga0495626_0001243 | 3300048091 | Bacteria | 20917 |
| 559 | Ga0495626_0001440 | 3300048091 | Bacteria | 18927 |
| 560 | Ga0495626_0001722 | 3300048091 | Bacteria | 16733 |
| 561 | Ga0495626_0008571 | 3300048091 | Bacteria | 5591 |
| 562 | Ga0495626_0009225 | 3300048091 | Bacteria | 5338 |
| 563 | Ga0495626_0009230 | 3300048091 | Bacteria | 5336 |
| 564 | Ga0495626_0018816 | 3300048091 | Bacteria | 3460 |
| 565 | Ga0495626_0028198 | 3300048091 | Bacteria | 2724 |
| 566 | Ga0495626_0031674 | 3300048091 | Bacteria | 2543 |
| 567 | Ga0495626_0040257 | 3300048091 | Bacteria | 2208 |
| 568 | Ga0495626_0041634 | 3300048091 | Bacteria | 2161 |
| 569 | Ga0495626_0042191 | 3300048091 | Bacteria | 2144 |
| 570 | Ga0495626_0050730 | 3300048091 | Bacteria | 1916 |
| 571 | Ga0495626_0055591 | 3300048091 | Bacteria | 1813 |
| 572 | Ga0496101_0031771 | 3300048904 | Bacteria | 3713 |
| 573 | Ga0496101_0044087 | 3300048904 | Bacteria | 3191 |
| 574 | Ga0496102_0000082 | 3300048905 | Bacteria | 139079 |
| 575 | Ga0496102_0001712 | 3300048905 | Bacteria | 19183 |
| 576 | Ga0496102_0015984 | 3300048905 | Bacteria | 6550 |
| 577 | Ga0496102_0060081 | 3300048905 | Bacteria | 3477 |
| 578 | Ga0496103_0062805 | 3300048906 | Bacteria | 2313 |
| 579 | Ga0496103_0095651 | 3300048906 | Bacteria | 1877 |
| 580 | Ga0496104_0158749 | 3300048907 | Bacteria | 2170 |
| 581 | Ga0496105_0082523 | 3300048908 | Bacteria | 2655 |
| 582 | Ga0496106_0170774 | 3300048909 | Bacteria | 1723 |
| 583 | Ga0496107_0091869 | 3300048910 | Bacteria | 2219 |
| 584 | Ga0496107_0097410 | 3300048910 | Bacteria | 2153 |
| 585 | Ga0496107_0118093 | 3300048910 | Bacteria | 1953 |
| 586 | Ga0496110_0000659 | 3300048913 | Bacteria | 23577 |
| 587 | Ga0496110_0043460 | 3300048913 | Bacteria | 3923 |
| 588 | Ga0496111_0002899 | 3300048914 | Bacteria | 10473 |
| 589 | Ga0496112_0136023 | 3300048915 | Bacteria | 2428 |
| 590 | Ga0496113_0033743 | 3300048916 | Bacteria | 3729 |
| 591 | Ga0496115_0025298 | 3300048918 | Bacteria | 4621 |
| 592 | Ga0496115_0080112 | 3300048918 | Bacteria | 2659 |
| 593 | Ga0496116_0051207 | 3300048919 | Bacteria | 2745 |
| 594 | Ga0496116_0071036 | 3300048919 | Bacteria | 2206 |
| 595 | Ga0496117_0000075 | 3300048920 | Bacteria | 232451 |
| 596 | Ga0496118_0000055 | 3300048921 | Bacteria | 232451 |
| 597 | Ga0496121_0003786 | 3300048924 | Bacteria | 21109 |
| 598 | Ga0496121_0008034 | 3300048924 | Bacteria | 12578 |
| 599 | Ga0496121_0123103 | 3300048924 | Bacteria | 1955 |
| 600 | Ga0496122_0003341 | 3300048925 | Bacteria | 21160 |
| 601 | Ga0496122_0007255 | 3300048925 | Bacteria | 12398 |
| 602 | Ga0496122_0011140 | 3300048925 | Bacteria | 9158 |
| 603 | Ga0496123_0006778 | 3300048926 | Bacteria | 11006 |
| 604 | Ga0496123_0007415 | 3300048926 | Bacteria | 10343 |
| 605 | Ga0496123_0009556 | 3300048926 | Bacteria | 8717 |
| 606 | Ga0496123_0022950 | 3300048926 | Bacteria | 4792 |
| 607 | Ga0496124_0013871 | 3300048927 | Bacteria | 7837 |
| 608 | Ga0496124_0021994 | 3300048927 | Bacteria | 5862 |
| 609 | Ga0496124_0033769 | 3300048927 | Bacteria | 4497 |
| 610 | Ga0496124_0112903 | 3300048927 | Bacteria | 2184 |
| 611 | Ga0496125_0000487 | 3300048928 | Bacteria | 69494 |
| 612 | Ga0496125_0011120 | 3300048928 | Bacteria | 9027 |
| 613 | Ga0496125_0126119 | 3300048928 | Bacteria | 1814 |
| 614 | Ga0496126_0094685 | 3300048929 | Bacteria | 2621 |
| 615 | Ga0496126_0162934 | 3300048929 | Bacteria | 1904 |
| 616 | Ga0495678_000027 | 3300049459 | Bacteria | 222075 |
| 617 | Ga0495678_001082 | 3300049459 | Bacteria | 23004 |
| 618 | Ga0495678_001136 | 3300049459 | Bacteria | 22114 |
| 619 | Ga0495678_001459 | 3300049459 | Bacteria | 18557 |
| 620 | Ga0495678_002154 | 3300049459 | Bacteria | 13912 |
| 621 | Ga0495678_004343 | 3300049459 | Bacteria | 8245 |
| 622 | Ga0495678_006992 | 3300049459 | Bacteria | 5918 |
| 623 | Ga0495678_012018 | 3300049459 | Bacteria | 4120 |
| 624 | Ga0495678_012665 | 3300049459 | Bacteria | 3989 |
| 625 | Ga0495678_023500 | 3300049459 | Bacteria | 2677 |
| 626 | Ga0495682_0001880 | 3300049460 | Bacteria | 10462 |
| 627 | Ga0495682_0004649 | 3300049460 | Bacteria | 5825 |
| 628 | Ga0495682_0007972 | 3300049460 | Bacteria | 4186 |
| 629 | Ga0495682_0017797 | 3300049460 | Bacteria | 2678 |
| 630 | Ga0501034_0145341 | 3300049571 | Bacteria | 2349 |
| 631 | Ga0501269_000385 | 3300049766 | Bacteria | 10570 |
| 632 | Ga0501279_000681 | 3300049775 | Bacteria | 4452 |
| 633 | Ga0501035_0009455 | 3300049822 | Bacteria | 9064 |
| 634 | Ga0500594_0003545 | 3300053118 | Bacteria | 3435 |
| 635 | Ga0500595_000862 | 3300053119 | Bacteria | 17316 |
| 636 | Ga0500618_018130 | 3300053125 | Bacteria | 1743 |
| 637 | Ga0500574_000191 | 3300053141 | Bacteria | 7225 |
| 638 | Ga0500586_000619 | 3300053145 | Bacteria | 7214 |
| 639 | Ga0500586_049295 | 3300053145 | Bacteria | 1449 |
| 640 | Ga0500619_000200 | 3300053154 | Bacteria | 13776 |
| 641 | Ga0587068_002129 | 3300059641 | Bacteria | 2365 |
| 642 | Ga0466962_0039282 | 3300061719 | Bacteria | 2267 |
| 643 | 2601666987 | 2600255292 | Bacteria | 6300551 |
| 644 | 2643801145 | 2643221556 | Bacteria | 7251154 |
| 645 | 2644029885 | 2643221603 | Bacteria | 6147767 |
| 646 | 2644214235 | 2643221638 | Bacteria | 6579467 |
| 647 | 2644251734 | 2643221645 | Bacteria | 7207331 |
| 648 | 2644356090 | 2643221664 | Bacteria | 7272945 |
| 649 | 2644471863 | 2643221684 | Bacteria | 7145183 |
| 650 | 2738742650 | 2738541280 | Bacteria | 6630198 |
| 651 | 2738826022 | 2738541297 | Bacteria | 6549566 |
| 652 | 2738842336 | 2738541300 | Bacteria | 6675882 |
| 653 | 2739149819 | 2738541357 | Bacteria | 6549408 |
| 654 | 2739191738 | 2738543003 | Bacteria | 6549560 |
| 655 | 2739273090 | 2738543018 | Bacteria | 6718814 |
| 656 | 2739318215 | 2738543026 | Bacteria | 6549408 |
| 657 | 2739336456 | 2738543029 | Bacteria | 6549249 |
| 658 | 2739342134 | 2738543030 | Bacteria | 6719714 |
| 659 | 2809146554 | 2808606418 | Bacteria | 6724496 |
| 660 | 2819542260 | 2818991436 | Bacteria | 5376622 |
| 661 | 2821136357 | 2821131069 | Bacteria | 6108407 |
| 662 | 2842717660 | 2842711865 | Bacteria | 7155354 |
| 663 | 2857552881 | 2857547612 | Bacteria | 6179999 |
| 664 | 2857558089 | 2857553236 | Bacteria | 6166726 |
| 665 | 2857563437 | 2857558681 | Bacteria | 6617694 |
| 666 | 2857570406 | 2857564685 | Bacteria | 6290584 |
| 667 | 2885083899 | 2885080285 | Bacteria | 6355622 |
| 668 | 2904428541 | 2904424332 | Bacteria | 7633521 |
| 669 | 2919476305 | 2919476304 | Bacteria | 5888696 |
| 670 | 2932415543 | 2932410948 | Bacteria | 6312192 |
| 671 | 2932421533 | 2932416698 | Bacteria | 6315112 |
| 672 | 8047675460 | 8047673197 | Bacteria | 7395230 |
| 673 | Ga0105241_10066531 | |||
| 674 | JGI25162J39368_1000023 | |||
| 675 | JGI25150J39212_1003512 | |||
| 676 | JGI25159J45721_1002946 | |||
| 677 | JGI25165J46597_1000030 | |||
| 678 | JGI25153J46596_10018066 | |||
| 679 | rootL2_10102555 | |||
| 680 | JGI25161J50226_1001616 | |||
| 681 | Ga0055538_1000017 | |||
| 682 | Ga0055539_1000022 | |||
| 683 | Ga0055533_1000030 | |||
| 684 | Ga0055525_1000028 | |||
| 685 | Ga0055525_1000034 | |||
| 686 | Ga0055542_1007275 | |||
| 687 | Ga0055529_1000583 | |||
| 688 | Ga0055526_1000149 | |||
| 689 | Ga0055526_1001052 | |||
| 690 | Ga0055526_1001207 | |||
| 691 | Ga0055526_1005381 | |||
| 692 | Ga0055537_1000578 | |||
| 693 | Ga0055537_1006621 | |||
| 694 | Ga0055537_1011931 | |||
| 695 | Ga0055524_1000124 | |||
| 696 | Ga0055524_1013278 | |||
| 697 | Ga0055534_1000489 | |||
| 698 | Ga0055528_1000575 | |||
| 699 | Ga0055530_10004148 | |||
| 700 | Ga0055531_10006260 | |||
| 701 | Ga0055531_10028577 | |||
| 702 | Ga0055541_1000015 | |||
| 703 | Ga0055543_1002129 | |||
| 704 | Ga0065165_1000167 | |||
| 705 | Ga0065165_1001081 | |||
| 706 | Ga0065165_1005706 | |||
| 707 | Ga0070670_100173927 | |||
| 708 | Ga0070682_100004447 | |||
| 709 | Ga0070660_100002856 | |||
| 710 | Ga0070660_100069403 | |||
| 711 | Ga0070660_100139181 | |||
| 712 | Ga0070661_100007701 | |||
| 713 | Ga0070661_100147763 | |||
| 714 | Ga0070659_100004956 | |||
| 715 | Ga0068855_100176608 | |||
| 716 | Ga0070664_100063092 | |||
| 717 | Ga0099826_10002381 | |||
| 718 | Ga0105244_10013076 | |||
| 719 | Ga0105243_10019283 | |||
| 720 | Ga0105237_10127719 | |||
| 721 | Ga0105239_10283770 | |||
| 722 | Ga0182008_10002513 | |||
| 723 | Ga0182006_1000095 | |||
| 724 | Ga0182006_1000216 | |||
| 725 | Ga0182007_10001265 | |||
| 726 | Ga0182007_10001951 | |||
| 727 | Ga0182005_1000057 | |||
| 728 | Ga0182005_1000119 | |||
| 729 | Ga0182005_1000134 | |||
| 730 | Ga0163161_10010197 | |||
| 731 | Ga0213872_10000481 | |||
| 732 | Ga0213872_10034755 | |||
| 733 | Ga0209436_101730 | |||
| 734 | Ga0209784_100034 | |||
| 735 | Ga0209566_100038 | |||
| 736 | Ga0209674_100056 | |||
| 737 | Ga0209563_100011 | |||
| 738 | Ga0209563_100057 | |||
| 739 | Ga0207427_100498 | |||
| 740 | Ga0209437_100071 | |||
| 741 | Ga0207425_1000493 | |||
| 742 | Ga0207425_1000761 | |||
| 743 | Ga0207425_1001383 | |||
| 744 | Ga0209646_1000384 | |||
| 745 | Ga0209677_100035 | |||
| 746 | Ga0209677_107612 | |||
| 747 | Ga0209148_1000381 | |||
| 748 | Ga0209129_1000600 | |||
| 749 | Ga0209129_1004176 | |||
| 750 | Ga0209233_1000094 | |||
| 751 | Ga0209565_1000112 | |||
| 752 | Ga0209565_1002964 | |||
| 753 | Ga0209565_1014178 | |||
| 754 | Ga0209565_1014389 | |||
| 755 | Ga0209455_1000484 | |||
| 756 | Ga0209673_1000210 | |||
| 757 | Ga0209130_1000016 | |||
| 758 | Ga0209130_1002714 | |||
| 759 | Ga0209130_1003164 | |||
| 760 | Ga0209130_1004431 | |||
| 761 | Ga0209675_1000761 | |||
| 762 | Ga0209675_1003306 | |||
| 763 | Ga0209675_1013045 | |||
| 764 | Ga0209675_1017794 | |||
| 765 | Ga0209025_1014809 | |||
| 766 | Ga0209564_1000010 | |||
| 767 | Ga0209564_1000245 | |||
| 768 | Ga0209564_1001321 | |||
| 769 | Ga0209564_1002064 | |||
| 770 | Ga0209564_1020018 | |||
| 771 | Ga0209758_1000957 | |||
| 772 | Ga0209758_1001720 | |||
| 773 | Ga0209050_1000086 | |||
| 774 | Ga0209050_1002207 | |||
| 775 | Ga0209256_1000268 | |||
| 776 | Ga0209256_1001618 | |||
| 777 | Ga0209256_1002073 | |||
| 778 | Ga0209256_1002630 | |||
| 779 | Ga0209256_1007095 | |||
| 780 | Ga0209051_1006544 | |||
| 781 | Ga0209257_1006299 | |||
| 782 | Ga0209257_1007877 | |||
| 783 | Ga0207655_1009754 | |||
| 784 | Ga0207671_10112100 | |||
| 785 | Ga0207657_10018511 | |||
| 786 | Ga0207657_10095874 | |||
| 787 | Ga0207657_10146190 | |||
| 788 | Ga0207649_10025866 | |||
| 789 | Ga0207690_10013185 | |||
| 790 | Ga0207706_10086551 | |||
| 791 | Ga0207709_10032012 | |||
| 792 | Ga0207679_10144187 | |||
| 793 | Ga0209281_1011138 | |||
| 794 | Ga0209282_1000066 | |||
| 795 | Ga0307515_10099073 | |||
| 796 | Ga0316182_1122702 | |||
| 797 | Ga0307408_100001878 | |||
| 798 | Ga0307408_100006441 | |||
| 799 | Ga0307408_100013856 | |||
| 800 | Ga0307408_100048403 | |||
| 801 | Ga0265314_10048457 | |||
| 802 | Ga0395899_0000575 | |||
| 803 | Ga0395899_0000762 | |||
| 804 | Ga0395899_0001822 | |||
| 805 | Ga0395899_0014827 | |||
| 806 | Ga0395899_0061046 | |||
| 807 | Ga0395900_0004198 | |||
| 808 | Ga0395900_0020705 | |||
| 809 | Ga0395900_0026862 | |||
| 810 | Ga0395900_0049797 | |||
| 811 | Ga0395900_0065519 | |||
| 812 | Ga0395900_0170962 | |||
| 813 | Ga0395898_0089301 | |||
| 814 | Ga0395898_0118987 | |||
| 815 | Ga0395905_0001070 | |||
| 816 | Ga0395905_0009521 | |||
| 817 | Ga0395905_0055021 | |||
| 818 | Ga0395901_0001364 | |||
| 819 | Ga0395901_0006884 | |||
| 820 | Ga0395901_0050535 | |||
| 821 | Ga0436361_0108001 | |||
| 822 | Ga0436361_0217337 | |||
| 823 | Ga0436361_1031912 | |||
| 824 | Ga0439448_0008515 | |||
| 825 | Ga0450897_000149 | |||
| 826 | Ga0450904_000062 | |||
| 827 | Ga0439458_0002215 | |||
| 828 | Ga0466972_0000373 | |||
| 829 | Ga0466972_0026689 | |||
| 830 | Ga0466965_0028388 | |||
| 831 | Ga0466965_0030967 | |||
| 832 | Ga0466966_0087480 | |||
| 833 | Ga0466966_0089391 | |||
| 834 | Ga0466963_0070914 | |||
| 835 | Ga0466964_0000883 | |||
| 836 | Ga0466964_0002132 | |||
| 837 | Ga0466964_0011013 | |||
| 838 | Ga0466964_0038294 | |||
| 839 | Ga0453684_0029009 | |||
| 840 | Ga0466968_0000881 | |||
| 841 | Ga0466968_0006523 | |||
| 842 | Ga0466968_0047929 | |||
| 843 | Ga0466970_0018709 | |||
| 844 | Ga0466957_0000182 | |||
| 845 | Ga0466957_0026183 | |||
| 846 | Ga0466957_0079753 | |||
| 847 | Ga0466959_0002186 | |||
| 848 | Ga0466959_0044565 | |||
| 849 | Ga0466967_0090863 | |||
| 850 | Ga0495617_000010 | |||
| 851 | Ga0495617_000471 | |||
| 852 | Ga0495617_013939 | |||
| 853 | Ga0495627_000378 | |||
| 854 | Ga0495627_000690 | |||
| 855 | Ga0495592_0011996 | |||
| 856 | Ga0495603_0033142 | |||
| 857 | Ga0495590_0000009 | |||
| 858 | Ga0495590_0000201 | |||
| 859 | Ga0495590_0008255 | |||
| 860 | Ga0495590_0024851 | |||
| 861 | Ga0495591_000867 | |||
| 862 | Ga0495629_0034848 | |||
| 863 | Ga0495638_0004523 | |||
| 864 | Ga0495638_0018956 | |||
| 865 | Ga0495638_0021457 | |||
| 866 | Ga0495638_0091992 | |||
| 867 | Ga0495651_0025844 | |||
| 868 | Ga0495653_0000959 | |||
| 869 | Ga0495653_0007503 | |||
| 870 | Ga0495653_0021789 | |||
| 871 | Ga0495653_0048941 | |||
| 872 | Ga0495650_0000062 | |||
| 873 | Ga0495650_0001085 | |||
| 874 | Ga0495650_0001544 | |||
| 875 | Ga0495650_0001553 | |||
| 876 | Ga0495650_0003055 | |||
| 877 | Ga0495650_0003201 | |||
| 878 | Ga0495650_0027270 | |||
| 879 | Ga0495580_0082024 | |||
| 880 | Ga0495582_0001880 | |||
| 881 | Ga0495605_0000635 | |||
| 882 | Ga0495605_0000941 | |||
| 883 | Ga0495605_0001966 | |||
| 884 | Ga0495605_0004232 | |||
| 885 | Ga0495605_0005989 | |||
| 886 | Ga0495605_0024319 | |||
| 887 | Ga0495605_0060256 | |||
| 888 | Ga0495584_0000092 | |||
| 889 | Ga0495584_0001978 | |||
| 890 | Ga0495584_0003316 | |||
| 891 | Ga0495584_0004486 | |||
| 892 | Ga0495584_0004909 | |||
| 893 | Ga0495584_0007603 | |||
| 894 | Ga0495584_0014663 | |||
| 895 | Ga0495584_0026964 | |||
| 896 | Ga0495584_0044137 | |||
| 897 | Ga0495584_0070975 | |||
| 898 | Ga0495585_0000984 | |||
| 899 | Ga0495585_0001005 | |||
| 900 | Ga0495585_0001417 | |||
| 901 | Ga0495585_0001517 | |||
| 902 | Ga0495585_0004278 | |||
| 903 | Ga0495585_0011361 | |||
| 904 | Ga0495585_0022517 | |||
| 905 | Ga0495585_0031792 | |||
| 906 | Ga0495585_0043376 | |||
| 907 | Ga0495585_0046854 | |||
| 908 | Ga0495594_0022587 | |||
| 909 | Ga0495594_0034582 | |||
| 910 | Ga0495594_0045489 | |||
| 911 | Ga0495594_0052771 | |||
| 912 | Ga0495594_0060757 | |||
| 913 | Ga0495596_0000350 | |||
| 914 | Ga0495596_0003154 | |||
| 915 | Ga0495596_0005660 | |||
| 916 | Ga0495596_0017984 | |||
| 917 | Ga0495596_0029258 | |||
| 918 | Ga0495607_0001154 | |||
| 919 | Ga0495607_0002568 | |||
| 920 | Ga0495607_0005276 | |||
| 921 | Ga0495607_0005305 | |||
| 922 | Ga0495607_0005622 | |||
| 923 | Ga0495607_0016913 | |||
| 924 | Ga0495607_0016975 | |||
| 925 | Ga0495607_0051073 | |||
| 926 | Ga0495607_0055384 | |||
| 927 | Ga0495583_0000329 | |||
| 928 | Ga0495583_0000952 | |||
| 929 | Ga0495583_0001471 | |||
| 930 | Ga0495583_0001555 | |||
| 931 | Ga0495583_0005015 | |||
| 932 | Ga0495583_0005584 | |||
| 933 | Ga0495583_0015248 | |||
| 934 | Ga0495583_0023988 | |||
| 935 | Ga0495583_0024089 | |||
| 936 | Ga0495583_0024817 | |||
| 937 | Ga0495583_0028401 | |||
| 938 | Ga0495583_0031168 | |||
| 939 | Ga0495606_0000428 | |||
| 940 | Ga0495606_0001517 | |||
| 941 | Ga0495606_0001842 | |||
| 942 | Ga0495606_0001977 | |||
| 943 | Ga0495606_0002381 | |||
| 944 | Ga0495606_0004131 | |||
| 945 | Ga0495606_0007799 | |||
| 946 | Ga0495606_0009754 | |||
| 947 | Ga0495606_0012328 | |||
| 948 | Ga0495606_0031689 | |||
| 949 | Ga0495606_0095805 | |||
| 950 | Ga0495608_0013893 | |||
| 951 | Ga0495610_0000014 | |||
| 952 | Ga0495610_0003364 | |||
| 953 | Ga0495610_0007708 | |||
| 954 | Ga0495616_0000547 | |||
| 955 | Ga0495616_0001040 | |||
| 956 | Ga0495616_0001268 | |||
| 957 | Ga0495616_0006198 | |||
| 958 | Ga0495616_0039681 | |||
| 959 | Ga0495616_0045400 | |||
| 960 | Ga0495616_0046318 | |||
| 961 | Ga0495616_0059304 | |||
| 962 | Ga0495616_0060690 | |||
| 963 | Ga0495618_0011394 | |||
| 964 | Ga0495620_0035174 | |||
| 965 | Ga0495628_0000076 | |||
| 966 | Ga0495628_0003214 | |||
| 967 | Ga0495631_0000869 | |||
| 968 | Ga0495631_0016477 | |||
| 969 | Ga0495631_0031969 | |||
| 970 | Ga0495631_0032702 | |||
| 971 | Ga0495632_0001345 | |||
| 972 | Ga0495632_0005648 | |||
| 973 | Ga0495632_0007159 | |||
| 974 | Ga0495632_0016710 | |||
| 975 | Ga0495632_0041955 | |||
| 976 | Ga0495637_0000003 | |||
| 977 | Ga0495637_0007025 | |||
| 978 | Ga0495637_0008969 | |||
| 979 | Ga0495637_0029493 | |||
| 980 | Ga0495643_0000891 | |||
| 981 | Ga0495643_0001105 | |||
| 982 | Ga0495643_0001198 | |||
| 983 | Ga0495643_0004987 | |||
| 984 | Ga0495643_0006489 | |||
| 985 | Ga0495643_0013877 | |||
| 986 | Ga0495643_0018368 | |||
| 987 | Ga0495643_0029050 | |||
| 988 | Ga0495643_0033135 | |||
| 989 | Ga0495643_0059405 | |||
| 990 | Ga0495643_0060639 | |||
| 991 | Ga0495643_0064493 | |||
| 992 | Ga0495643_0071994 | |||
| 993 | Ga0495644_0008384 | |||
| 994 | Ga0495644_0008814 | |||
| 995 | Ga0495644_0028801 | |||
| 996 | Ga0495644_0040765 | |||
| 997 | Ga0495648_0000751 | |||
| 998 | Ga0495648_0003454 | |||
| 999 | Ga0495648_0003783 | |||
| 1000 | Ga0495648_0003840 | |||
| 1001 | Ga0495648_0013959 | |||
| 1002 | Ga0495648_0013960 | |||
| 1003 | Ga0495648_0030685 | |||
| 1004 | Ga0495648_0048992 | |||
| 1005 | Ga0495648_0063249 | |||
| 1006 | Ga0495648_0077271 | |||
| 1007 | Ga0495666_0005811 | |||
| 1008 | Ga0495666_0016084 | |||
| 1009 | Ga0495666_0061554 | |||
| 1010 | Ga0495642_0001015 | |||
| 1011 | Ga0495642_0001627 | |||
| 1012 | Ga0495642_0002398 | |||
| 1013 | Ga0495642_0008834 | |||
| 1014 | Ga0495642_0012745 | |||
| 1015 | Ga0495642_0012999 | |||
| 1016 | Ga0495642_0019212 | |||
| 1017 | Ga0495642_0021647 | |||
| 1018 | Ga0495642_0030631 | |||
| 1019 | Ga0495642_0030640 | |||
| 1020 | Ga0495642_0045011 | |||
| 1021 | Ga0495652_0003764 | |||
| 1022 | Ga0495652_0009821 | |||
| 1023 | Ga0495652_0036452 | |||
| 1024 | Ga0495654_0000245 | |||
| 1025 | Ga0495654_0012652 | |||
| 1026 | Ga0495654_0024540 | |||
| 1027 | Ga0495654_0032088 | |||
| 1028 | Ga0495654_0034903 | |||
| 1029 | Ga0495654_0037648 | |||
| 1030 | Ga0495654_0050256 | |||
| 1031 | Ga0495665_0006918 | |||
| 1032 | Ga0495665_0036121 | |||
| 1033 | Ga0495586_0018444 | |||
| 1034 | Ga0495586_0054080 | |||
| 1035 | Ga0495587_0107167 | |||
| 1036 | Ga0495609_0000038 | |||
| 1037 | Ga0495609_0000736 | |||
| 1038 | Ga0495609_0000927 | |||
| 1039 | Ga0495609_0001172 | |||
| 1040 | Ga0495609_0008725 | |||
| 1041 | Ga0495609_0012599 | |||
| 1042 | Ga0495609_0017938 | |||
| 1043 | Ga0495609_0018151 | |||
| 1044 | Ga0495609_0019486 | |||
| 1045 | Ga0495609_0029589 | |||
| 1046 | Ga0495597_0000288 | |||
| 1047 | Ga0495597_0000754 | |||
| 1048 | Ga0495597_0001046 | |||
| 1049 | Ga0495597_0001377 | |||
| 1050 | Ga0495597_0003076 | |||
| 1051 | Ga0495597_0010764 | |||
| 1052 | Ga0495597_0011276 | |||
| 1053 | Ga0495597_0032083 | |||
| 1054 | Ga0495622_0000440 | |||
| 1055 | Ga0495622_0001964 | |||
| 1056 | Ga0495622_0019116 | |||
| 1057 | Ga0495633_0000663 | |||
| 1058 | Ga0495633_0001228 | |||
| 1059 | Ga0495633_0001987 | |||
| 1060 | Ga0495633_0003355 | |||
| 1061 | Ga0495633_0009283 | |||
| 1062 | Ga0495633_0015925 | |||
| 1063 | Ga0495633_0016702 | |||
| 1064 | Ga0495633_0035248 | |||
| 1065 | Ga0495633_0037159 | |||
| 1066 | Ga0495633_0056263 | |||
| 1067 | Ga0495668_0000188 | |||
| 1068 | Ga0495668_0000944 | |||
| 1069 | Ga0495668_0001593 | |||
| 1070 | Ga0495668_0003040 | |||
| 1071 | Ga0495668_0005723 | |||
| 1072 | Ga0495668_0005969 | |||
| 1073 | Ga0495668_0006127 | |||
| 1074 | Ga0495668_0007409 | |||
| 1075 | Ga0495668_0017479 | |||
| 1076 | Ga0495668_0017741 | |||
| 1077 | Ga0495668_0021260 | |||
| 1078 | Ga0495668_0022165 | |||
| 1079 | Ga0495668_0024931 | |||
| 1080 | Ga0495668_0036185 | |||
| 1081 | Ga0495634_0011154 | |||
| 1082 | Ga0495611_0003521 | |||
| 1083 | Ga0495611_0008645 | |||
| 1084 | Ga0495611_0031927 | |||
| 1085 | Ga0495611_0036620 | |||
| 1086 | Ga0495611_0037483 | |||
| 1087 | Ga0495611_0047414 | |||
| 1088 | Ga0495611_0049865 | |||
| 1089 | Ga0495625_0001377 | |||
| 1090 | Ga0495625_0002229 | |||
| 1091 | Ga0495625_0007279 | |||
| 1092 | Ga0495625_0018246 | |||
| 1093 | Ga0495625_0052488 | |||
| 1094 | Ga0495625_0053260 | |||
| 1095 | Ga0495635_0039741 | |||
| 1096 | Ga0495659_0000345 | |||
| 1097 | Ga0495659_0003587 | |||
| 1098 | Ga0495659_0018298 | |||
| 1099 | Ga0495661_0000701 | |||
| 1100 | Ga0495661_0001914 | |||
| 1101 | Ga0495661_0003740 | |||
| 1102 | Ga0495661_0007084 | |||
| 1103 | Ga0495661_0008346 | |||
| 1104 | Ga0495661_0012015 | |||
| 1105 | Ga0495661_0027563 | |||
| 1106 | Ga0495661_0030271 | |||
| 1107 | Ga0495661_0050080 | |||
| 1108 | Ga0495661_0054827 | |||
| 1109 | Ga0495661_0057819 | |||
| 1110 | Ga0495588_0000172 | |||
| 1111 | Ga0495588_0017386 | |||
| 1112 | Ga0495588_0023142 | |||
| 1113 | Ga0495588_0025786 | |||
| 1114 | Ga0495588_0046363 | |||
| 1115 | Ga0495588_0067717 | |||
| 1116 | Ga0495657_0046654 | |||
| 1117 | Ga0495599_0000548 | |||
| 1118 | Ga0495623_0042242 | |||
| 1119 | Ga0495623_0066424 | |||
| 1120 | Ga0495646_0004359 | |||
| 1121 | Ga0495646_0011253 | |||
| 1122 | Ga0495669_0000345 | |||
| 1123 | Ga0495669_0003212 | |||
| 1124 | Ga0495669_0010943 | |||
| 1125 | Ga0495669_0016952 | |||
| 1126 | Ga0495669_0025187 | |||
| 1127 | Ga0495624_0026346 | |||
| 1128 | Ga0495670_0008565 | |||
| 1129 | Ga0495670_0010105 | |||
| 1130 | Ga0495670_0011273 | |||
| 1131 | Ga0495670_0024277 | |||
| 1132 | Ga0495670_0028735 | |||
| 1133 | Ga0495670_0065275 | |||
| 1134 | Ga0495671_0001130 | |||
| 1135 | Ga0495671_0003794 | |||
| 1136 | Ga0495671_0006115 | |||
| 1137 | Ga0495671_0013465 | |||
| 1138 | Ga0495671_0014611 | |||
| 1139 | Ga0495671_0026142 | |||
| 1140 | Ga0495649_0006101 | |||
| 1141 | Ga0495649_0012477 | |||
| 1142 | Ga0495649_0023222 | |||
| 1143 | Ga0495649_0039096 | |||
| 1144 | Ga0495589_0000733 | |||
| 1145 | Ga0495589_0000986 | |||
| 1146 | Ga0495589_0001840 | |||
| 1147 | Ga0495589_0025222 | |||
| 1148 | Ga0495589_0026866 | |||
| 1149 | Ga0495589_0045265 | |||
| 1150 | Ga0495589_0047046 | |||
| 1151 | Ga0495600_0000693 | |||
| 1152 | Ga0495600_0023815 | |||
| 1153 | Ga0495660_0001060 | |||
| 1154 | Ga0495660_0010144 | |||
| 1155 | Ga0495660_0014658 | |||
| 1156 | Ga0495660_0018713 | |||
| 1157 | Ga0495660_0030299 | |||
| 1158 | Ga0495660_0042283 | |||
| 1159 | Ga0495660_0076761 | |||
| 1160 | Ga0495581_0023785 | |||
| 1161 | Ga0495581_0026084 | |||
| 1162 | Ga0495604_0019774 | |||
| 1163 | Ga0495604_0031201 | |||
| 1164 | Ga0495636_0001239 | |||
| 1165 | Ga0495636_0008533 | |||
| 1166 | Ga0495636_0009579 | |||
| 1167 | Ga0495674_0009946 | |||
| 1168 | Ga0495672_0000019 | |||
| 1169 | Ga0495672_0000859 | |||
| 1170 | Ga0495672_0001040 | |||
| 1171 | Ga0495672_0001173 | |||
| 1172 | Ga0495672_0001685 | |||
| 1173 | Ga0495672_0006826 | |||
| 1174 | Ga0495672_0029389 | |||
| 1175 | Ga0495672_0068974 | |||
| 1176 | Ga0495676_0000972 | |||
| 1177 | Ga0495676_0035194 | |||
| 1178 | Ga0495676_0035928 | |||
| 1179 | Ga0495676_0038611 | |||
| 1180 | Ga0495676_0052653 | |||
| 1181 | Ga0495680_0007712 | |||
| 1182 | Ga0495683_0000692 | |||
| 1183 | Ga0495683_0003705 | |||
| 1184 | Ga0495683_0003886 | |||
| 1185 | Ga0495683_0012603 | |||
| 1186 | Ga0495683_0026942 | |||
| 1187 | Ga0495683_0064256 | |||
| 1188 | Ga0495687_000405 | |||
| 1189 | Ga0495687_000801 | |||
| 1190 | Ga0495687_001993 | |||
| 1191 | Ga0495687_005076 | |||
| 1192 | Ga0495687_005120 | |||
| 1193 | Ga0495687_005264 | |||
| 1194 | Ga0495687_005317 | |||
| 1195 | Ga0495687_008736 | |||
| 1196 | Ga0495687_017089 | |||
| 1197 | Ga0495675_0019271 | |||
| 1198 | Ga0495677_0000527 | |||
| 1199 | Ga0495677_0003170 | |||
| 1200 | Ga0495677_0009195 | |||
| 1201 | Ga0495679_018845 | |||
| 1202 | Ga0495679_021744 | |||
| 1203 | Ga0495679_023405 | |||
| 1204 | Ga0495685_000157 | |||
| 1205 | Ga0495685_006353 | |||
| 1206 | Ga0495685_008725 | |||
| 1207 | Ga0495685_013537 | |||
| 1208 | Ga0495673_0000012 | |||
| 1209 | Ga0495673_0000604 | |||
| 1210 | Ga0495673_0000925 | |||
| 1211 | Ga0495681_0008029 | |||
| 1212 | Ga0495681_0010291 | |||
| 1213 | Ga0495681_0012752 | |||
| 1214 | Ga0495681_0025206 | |||
| 1215 | Ga0495681_0025984 | |||
| 1216 | Ga0495681_0029571 | |||
| 1217 | Ga0495681_0040177 | |||
| 1218 | Ga0495686_0005894 | |||
| 1219 | Ga0495686_0006159 | |||
| 1220 | Ga0495686_0006674 | |||
| 1221 | Ga0495686_0038904 | |||
| 1222 | Ga0495593_0008563 | |||
| 1223 | Ga0495593_0047816 | |||
| 1224 | Ga0495602_0032543 | |||
| 1225 | Ga0495602_0040161 | |||
| 1226 | Ga0495602_0057841 | |||
| 1227 | Ga0495602_0182991 | |||
| 1228 | Ga0495614_0001278 | |||
| 1229 | Ga0495626_0000005 | |||
| 1230 | Ga0495626_0001243 | |||
| 1231 | Ga0495626_0001440 | |||
| 1232 | Ga0495626_0001722 | |||
| 1233 | Ga0495626_0008571 | |||
| 1234 | Ga0495626_0009225 | |||
| 1235 | Ga0495626_0009230 | |||
| 1236 | Ga0495626_0018816 | |||
| 1237 | Ga0495626_0028198 | |||
| 1238 | Ga0495626_0031674 | |||
| 1239 | Ga0495626_0040257 | |||
| 1240 | Ga0495626_0041634 | |||
| 1241 | Ga0495626_0042191 | |||
| 1242 | Ga0495626_0050730 | |||
| 1243 | Ga0495626_0055591 | |||
| 1244 | Ga0496101_0031771 | |||
| 1245 | Ga0496101_0044087 | |||
| 1246 | Ga0496102_0000082 | |||
| 1247 | Ga0496102_0001712 | |||
| 1248 | Ga0496102_0015984 | |||
| 1249 | Ga0496102_0060081 | |||
| 1250 | Ga0496103_0062805 | |||
| 1251 | Ga0496103_0095651 | |||
| 1252 | Ga0496104_0158749 | |||
| 1253 | Ga0496105_0082523 | |||
| 1254 | Ga0496106_0170774 | |||
| 1255 | Ga0496107_0091869 | |||
| 1256 | Ga0496107_0097410 | |||
| 1257 | Ga0496107_0118093 | |||
| 1258 | Ga0496110_0000659 | |||
| 1259 | Ga0496110_0043460 | |||
| 1260 | Ga0496111_0002899 | |||
| 1261 | Ga0496112_0136023 | |||
| 1262 | Ga0496113_0033743 | |||
| 1263 | Ga0496115_0025298 | |||
| 1264 | Ga0496115_0080112 | |||
| 1265 | Ga0496116_0051207 | |||
| 1266 | Ga0496116_0071036 | |||
| 1267 | Ga0496117_0000075 | |||
| 1268 | Ga0496118_0000055 | |||
| 1269 | Ga0496121_0003786 | |||
| 1270 | Ga0496121_0008034 | |||
| 1271 | Ga0496121_0123103 | |||
| 1272 | Ga0496122_0003341 | |||
| 1273 | Ga0496122_0007255 | |||
| 1274 | Ga0496122_0011140 | |||
| 1275 | Ga0496123_0006778 | |||
| 1276 | Ga0496123_0007415 | |||
| 1277 | Ga0496123_0009556 | |||
| 1278 | Ga0496123_0022950 | |||
| 1279 | Ga0496124_0013871 | |||
| 1280 | Ga0496124_0021994 | |||
| 1281 | Ga0496124_0033769 | |||
| 1282 | Ga0496124_0112903 | |||
| 1283 | Ga0496125_0000487 | |||
| 1284 | Ga0496125_0011120 | |||
| 1285 | Ga0496125_0126119 | |||
| 1286 | Ga0496126_0094685 | |||
| 1287 | Ga0496126_0162934 | |||
| 1288 | Ga0495678_000027 | |||
| 1289 | Ga0495678_001082 | |||
| 1290 | Ga0495678_001136 | |||
| 1291 | Ga0495678_001459 | |||
| 1292 | Ga0495678_002154 | |||
| 1293 | Ga0495678_004343 | |||
| 1294 | Ga0495678_006992 | |||
| 1295 | Ga0495678_012018 | |||
| 1296 | Ga0495678_012665 | |||
| 1297 | Ga0495678_023500 | |||
| 1298 | Ga0495682_0001880 | |||
| 1299 | Ga0495682_0004649 | |||
| 1300 | Ga0495682_0007972 | |||
| 1301 | Ga0495682_0017797 | |||
| 1302 | Ga0501034_0145341 | |||
| 1303 | Ga0501269_000385 | |||
| 1304 | Ga0501279_000681 | |||
| 1305 | Ga0501035_0009455 | |||
| 1306 | Ga0500594_0003545 | |||
| 1307 | Ga0500595_000862 | |||
| 1308 | Ga0500618_018130 | |||
| 1309 | Ga0500574_000191 | |||
| 1310 | Ga0500586_000619 | |||
| 1311 | Ga0500586_049295 | |||
| 1312 | Ga0500619_000200 | |||
| 1313 | Ga0587068_002129 | |||
| 1314 | Ga0466962_0039282 | |||
| 1315 | 2601666987 | |||
| 1316 | 2643801145 | |||
| 1317 | 2644029885 | |||
| 1318 | 2644214235 | |||
| 1319 | 2644251734 | |||
| 1320 | 2644356090 | |||
| 1321 | 2644471863 | |||
| 1322 | 2738742650 | |||
| 1323 | 2738826022 | |||
| 1324 | 2738842336 | |||
| 1325 | 2739149819 | |||
| 1326 | 2739191738 | |||
| 1327 | 2739273090 | |||
| 1328 | 2739318215 | |||
| 1329 | 2739336456 | |||
| 1330 | 2739342134 | |||
| 1331 | 2809146554 | |||
| 1332 | 2819542260 | |||
| 1333 | 2821136357 | |||
| 1334 | 2842717660 | |||
| 1335 | 2857552881 | |||
| 1336 | 2857558089 | |||
| 1337 | 2857563437 | |||
| 1338 | 2857570406 | |||
| 1339 | 2885083899 | |||
| 1340 | 2904428541 | |||
| 1341 | 2919476305 | |||
| 1342 | 2932415543 | |||
| 1343 | 2932421533 | |||
| 1344 | 8047675460 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wtf-assembly2.cif.gz_B | structure of radical s-adenosylmethionine methyltransferase, tsrm, from kitasatospora setae with tryptophan substrate and sam analog (aza-sam) bound | 0.7636 | 2 | 359 |
| 6wte-assembly2.cif.gz_B | structure of radical s-adenosylmethionine methyltransferase, tsrm, from kitasatospora setae with cobalamin and [4fe-4s] cluster bound | 0.7595 | 1 | 365 |
| 6b4c-assembly10.cif.gz_J | structure of viperin from trichoderma virens | 0.7562 | 195 | 348 |
| 2qgq-assembly1.cif.gz_A | crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 | 0.7512 | 168 | 351 |
| 6wte-assembly1.cif.gz_A | structure of radical s-adenosylmethionine methyltransferase, tsrm, from kitasatospora setae with cobalamin and [4fe-4s] cluster bound | 0.7506 | 1 | 372 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6JM25_181_293_3.30.750.200 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; | 0.881 | 277 | 359 | 3.30.750.200 |
| af_A4IGH2_157_284_3.30.750.200 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; | 0.8562 | 276 | 365 | 3.30.750.200 |
| 4jc0B03 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; | 0.8103 | 276 | 359 | 3.30.750.200 |
| af_Q4CUJ9_220_394_3.30.750.200 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; | 0.8066 | 235 | 365 | 3.30.750.200 |
| af_P96395_5_123_3.40.50.280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.8034 | 41 | 131 | 3.40.50.280 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Z5I5E2-F1-model_v4 | deleted | 0.9744 | 286 | 401 |
|
| AF-A0A6S6RTR1-F1-model_v4 | Mg-protoporphyrin IX monomethyl ester oxidative cyclase | 0.9632 | 3 | 455 |
GO:0003824
GO:0005829 GO:0031419 GO:0046872 GO:0051536 |
| AF-A0A1F9LJS9-F1-model_v4 | Uncharacterized protein | 0.9543 | 1 | 471 |
GO:0003824
GO:0005829 GO:0031419 GO:0046872 GO:0051536 |
| AF-A0A356ULS6-F1-model_v4 | deleted | 0.9523 | 250 | 471 |
|
| AF-A0A7C5CTK3-F1-model_v4 | DUF4080 domain-containing protein | 0.9509 | 1 | 471 |
GO:0003824
GO:0005829 GO:0031419 GO:0046872 GO:0051536 |