F474258

General Info

Members Datasets Scaffolds Average Seq Length
672 452 1344 410

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0213367|Ga0496115_0213367_30_1214
Length 394
Sequence MLSGAAYAQETVKIGYIDPLSGGGASVGEGGLKTFQYLADELNAKGGILGHKVEILPLDNKTNPQESLIQAQKAIDAGAHYITQGNGSSVGAALADFVTKHNTRNPGKEVLYFNYAAVDPSMTNEKCSFWHFRWDANSDIKMEALTNYMKDHESIKKVYQDYSFGQSVRTQARKMLGDKRPDVQIVGDELHPLLKITDFSPYIAKIKASGADSVVTGNWGQDFALLLKAAADAGLKVNWYTYYAGGAGGPTAIKQTNLDHQVFQISEGIPNSDNPAAMEFEKAFRAKVGLSLWYPRAVNEMRMFKAAAEKANSIDPVKVAAALEDLKFDVLDGGSGVMRKDDHQFLQPIYISSFGARSEKEPFDEENTGWGWRLVAKVDTPQTVLPTTCKMTRP

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
71 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
100 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
101 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
102 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
103 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
153 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
154 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
155 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
263 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
307 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
308 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
309 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
310 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
311 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
312 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
313 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
314 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
315 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
316 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
317 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
318 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
319 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
320 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
321 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
322 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
323 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
324 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
325 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
326 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
327 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
328 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
329 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
330 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
331 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
332 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
333 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
334 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
335 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
338 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
339 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
340 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
341 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
342 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
343 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
344 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
345 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
346 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
347 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
348 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
349 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
350 2643221651 Afipia sp. Root123D2 Isolate Unclassified
351 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
352 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
353 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
354 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
355 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
356 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
357 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
358 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
359 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
360 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
361 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
362 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
363 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
364 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
365 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
366 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
367 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
368 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
369 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
370 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
371 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
372 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
373 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
374 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
375 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
376 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
377 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
378 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
379 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
380 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
381 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
382 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
383 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
384 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
385 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
386 2906610324
387 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
388 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
389 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
390 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
391 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
392 2922368715
393 2922425934
394 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
395 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
396 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
397 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
398 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
399 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
400 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
401 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
402 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
403 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
404 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
405 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
406 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
407 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
408 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
409 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
410 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
411 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
412 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
413 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
414 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
415 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
416 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
417 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
418 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
419 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
420 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
421 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
422 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
423 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
424 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
425 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
426 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
427 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
428 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
429 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
430 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
431 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
432 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
433 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
434 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
435 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
436 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
437 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
438 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
439 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
440 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
441 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
442 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
443 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
444 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
445 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
446 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
447 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
448 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
449 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
450 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
451 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
452 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.81
Metatranscriptomes 0.3
Isolates 16.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.78
Nodule 12.8
Rhizoplane 9.38
Rhizosphere 58.33
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0213367 3300048918 Bacteria 1594
2 JGI24744J21845_10008041 3300002077 Bacteria 2177
3 JGI24742J22300_10000509 3300002244 Bacteria 5791
4 JGI25406J46586_10000014 3300003203 Bacteria 93855
5 JGI25153J46596_10038702 3300003215 Bacteria 1499
6 JGI25160J50197_1001954 3300003354 Bacteria 9837
7 JGI25160J50197_1011003 3300003354 Bacteria 3237
8 Ga0007429J51699_1095660 3300003579 Bacteria 1383
9 JGI25404J52841_10000057 3300003659 Bacteria 9569
10 Ga0065165_1000054 3300005262 Bacteria 187351
11 Ga0065165_1003837 3300005262 Bacteria 10008
12 Ga0065704_10110842 3300005289 Bacteria 1971
13 Ga0065707_10004110 3300005295 Bacteria 5458
14 Ga0070658_10039816 3300005327 Bacteria 3792
15 Ga0070658_10055874 3300005327 Bacteria 3208
16 Ga0070676_10008312 3300005328 Bacteria 5591
17 Ga0070676_10032947 3300005328 Bacteria 2971
18 Ga0070690_100002327 3300005330 Bacteria 10210
19 Ga0070680_100093318 3300005336 Bacteria 2494
20 Ga0070660_100041577 3300005339 Bacteria 3504
21 Ga0070660_100091512 3300005339 Bacteria 2399
22 Ga0070661_100116406 3300005344 Bacteria 1999
23 Ga0070668_100015142 3300005347 Bacteria 5762
24 Ga0070669_100011384 3300005353 Bacteria 6316
25 Ga0070675_100090215 3300005354 Bacteria 2567
26 Ga0070674_100000485 3300005356 Bacteria 19967
27 Ga0070673_100028812 3300005364 Bacteria 4135
28 Ga0070659_100261343 3300005366 Bacteria 1436
29 Ga0070667_100081235 3300005367 Bacteria 2774
30 Ga0070714_100022799 3300005435 Bacteria 5136
31 Ga0070713_100128209 3300005436 Bacteria 2235
32 Ga0070710_10006621 3300005437 Bacteria 5571
33 Ga0070701_10035060 3300005438 Bacteria 2518
34 Ga0070700_100003300 3300005441 Bacteria 8321
35 Ga0070700_100033409 3300005441 Bacteria 3098
36 Ga0070663_100023267 3300005455 Bacteria 4150
37 Ga0070663_100051334 3300005455 Bacteria 2937
38 Ga0070678_100060893 3300005456 Bacteria 2780
39 Ga0070662_100022601 3300005457 Bacteria 4308
40 Ga0068867_100004714 3300005459 Bacteria 9597
41 Ga0070685_10014233 3300005466 Bacteria 4209
42 Ga0070707_100103748 3300005468 Bacteria 2756
43 Ga0070699_100022502 3300005518 Bacteria 5433
44 Ga0070679_100064934 3300005530 Bacteria 3638
45 Ga0070697_100102688 3300005536 Bacteria 2376
46 Ga0070672_100077955 3300005543 Bacteria 2651
47 Ga0070686_100006029 3300005544 Bacteria 6726
48 Ga0070695_100001037 3300005545 Bacteria 15205
49 Ga0070665_100007932 3300005548 Bacteria 10762
50 Ga0070704_100066334 3300005549 Bacteria 2602
51 Ga0068855_100080870 3300005563 Bacteria 3767
52 Ga0068855_100115745 3300005563 Bacteria 3073
53 Ga0070664_100058436 3300005564 Unclassified 3280
54 Ga0068854_100003638 3300005578 Bacteria 9648
55 Ga0068856_100000560 3300005614 Bacteria 40848
56 Ga0068856_100095555 3300005614 Bacteria 2960
57 Ga0070702_100021652 3300005615 Bacteria 3387
58 Ga0068852_100163403 3300005616 Bacteria 2081
59 Ga0068866_10002087 3300005718 Bacteria 8310
60 Ga0068861_100011596 3300005719 Bacteria 6132
61 Ga0068870_10085315 3300005840 Bacteria 1755
62 Ga0068858_100027398 3300005842 Bacteria 5294
63 Ga0068858_100193876 3300005842 Bacteria 1920
64 Ga0068860_100011821 3300005843 Bacteria 8603
65 Ga0068862_100016806 3300005844 Bacteria 6092
66 Ga0068862_100018037 3300005844 Bacteria 5879
67 Ga0081455_10003143 3300005937 Bacteria 19203
68 Ga0081540_1000370 3300005983 Bacteria 45002
69 Ga0081540_1000371 3300005983 Bacteria 44977
70 Ga0081540_1015080 3300005983 Bacteria 4904
71 Ga0081539_10000008 3300005985 Bacteria 525071
72 Ga0070717_10040726 3300006028 Bacteria 3785
73 Ga0070717_10152489 3300006028 Unclassified 2000
74 Ga0070715_10040732 3300006163 Bacteria 1943
75 Ga0070716_100024268 3300006173 Bacteria 3226
76 Ga0070712_100012336 3300006175 Bacteria 5431
77 Ga0070712_100126315 3300006175 Bacteria 1932
78 Ga0075428_100002097 3300006844 Bacteria 21505
79 Ga0075428_100069782 3300006844 Bacteria 3841
80 Ga0075431_100000059 3300006847 Bacteria 61740
81 Ga0075433_10002766 3300006852 Bacteria 13422
82 Ga0075434_100002045 3300006871 Bacteria 17515
83 Ga0075429_100001315 3300006880 Bacteria 20255
84 Ga0068865_100003839 3300006881 Bacteria 9010
85 Ga0075436_100015484 3300006914 Bacteria 5221
86 Ga0099824_1016218 3300006942 Bacteria 6814
87 Ga0099822_1007626 3300006943 Bacteria 13973
88 Ga0075435_100009873 3300007076 Bacteria 6947
89 Ga0075435_100084285 3300007076 Bacteria 2615
90 Ga0099794_10044444 3300007265 Bacteria 2123
91 Ga0099795_10026058 3300007788 Bacteria 1966
92 Ga0105240_10080600 3300009093 Bacteria 4003
93 Ga0111539_10001296 3300009094 Bacteria 33381
94 Ga0111539_10027399 3300009094 Bacteria 6960
95 Ga0111539_10124052 3300009094 Bacteria 3027
96 Ga0111539_10146002 3300009094 Bacteria 2770
97 Ga0105245_10031810 3300009098 Bacteria 4672
98 Ga0105245_10073745 3300009098 Bacteria 3104
99 Ga0114129_10001483 3300009147 Bacteria 31789
100 Ga0105243_10258730 3300009148 Bacteria 1557
101 Ga0105241_10059531 3300009174 Bacteria 2937
102 Ga0105242_10031596 3300009176 Bacteria 4231
103 Ga0105242_10095018 3300009176 Bacteria 2516
104 Ga0105248_10422605 3300009177 Bacteria 1501
105 Ga0105238_10102762 3300009551 Bacteria 2839
106 Ga0105238_10182664 3300009551 Bacteria 2074
107 Ga0105238_10184941 3300009551 Bacteria 2060
108 Ga0105249_10001730 3300009553 Bacteria 19091
109 Ga0105249_10018210 3300009553 Bacteria 6243
110 Ga0105249_10227807 3300009553 Bacteria 1837
111 Ga0099796_10025130 3300010159 Bacteria 1877
112 Ga0105239_10056173 3300010375 Bacteria 4318
113 Ga0105239_10088243 3300010375 Bacteria 3420
114 Ga0157373_10096779 3300013100 Bacteria 2078
115 Ga0157373_10136218 3300013100 Bacteria 1726
116 Ga0157371_10076826 3300013102 Bacteria 2365
117 Ga0157370_10025911 3300013104 Bacteria 5797
118 Ga0157374_10378168 3300013296 Bacteria 1410
119 Ga0157378_10008838 3300013297 Bacteria 8766
120 Ga0163162_10009472 3300013306 Bacteria 9469
121 Ga0163162_10031313 3300013306 Bacteria 5276
122 Ga0157375_10459051 3300013308 Bacteria 1439
123 Ga0163163_10008715 3300014325 Bacteria 9022
124 Ga0163163_10064017 3300014325 Unclassified 3648
125 Ga0163163_10066025 3300014325 Bacteria 3593
126 Ga0163163_10109568 3300014325 Bacteria 2789
127 Ga0163163_10254404 3300014325 Bacteria 1807
128 Ga0157380_10104532 3300014326 Bacteria 2365
129 Ga0157379_10019649 3300014968 Bacteria 5969
130 Ga0157379_10139631 3300014968 Bacteria 2184
131 Ga0157376_10015348 3300014969 Bacteria 5784
132 Ga0157376_10125653 3300014969 Bacteria 2281
133 Ga0163161_10001515 3300017792 Bacteria 17196
134 Ga0214544_1014838 3300021320 Bacteria 8469
135 Ga0214542_1014570 3300021321 Bacteria 8700
136 Ga0214545_1014326 3300021324 Bacteria 9276
137 Ga0214543_1015412 3300021327 Bacteria 8466
138 Ga0213873_10015801 3300021358 Bacteria 1698
139 Ga0213875_10045581 3300021388 Bacteria 2058
140 Ga0209563_101910 3300025230 Bacteria 5038
141 Ga0209677_101648 3300025253 Bacteria 9393
142 Ga0209677_103715 3300025253 Bacteria 4776
143 Ga0209148_1008198 3300025254 Bacteria 2113
144 Ga0209233_1000794 3300025261 Bacteria 14173
145 Ga0209233_1002869 3300025261 Bacteria 6174
146 Ga0209233_1009444 3300025261 Bacteria 2968
147 Ga0209455_1002569 3300025272 Bacteria 6929
148 Ga0209455_1008997 3300025272 Bacteria 2658
149 Ga0209564_1014386 3300025295 Bacteria 3296
150 Ga0209758_1009026 3300025297 Bacteria 6301
151 Ga0209758_1010412 3300025297 Bacteria 5567
152 Ga0209758_1022843 3300025297 Bacteria 2851
153 Ga0209758_1033486 3300025297 Bacteria 2061
154 Ga0207426_1002185 3300025302 Bacteria 13211
155 Ga0207426_1004331 3300025302 Bacteria 6992
156 Ga0207426_1015910 3300025302 Bacteria 2716
157 Ga0207697_10005623 3300025315 Bacteria 5794
158 Ga0207647_10043910 3300025904 Bacteria 2794
159 Ga0207647_10068296 3300025904 Bacteria 2152
160 Ga0207685_10004384 3300025905 Bacteria 3581
161 Ga0207699_10023803 3300025906 Bacteria 3338
162 Ga0207645_10027154 3300025907 Bacteria 3698
163 Ga0207645_10042359 3300025907 Bacteria 2913
164 Ga0207705_10071624 3300025909 Bacteria 2513
165 Ga0207705_10087565 3300025909 Bacteria 2277
166 Ga0207654_10110763 3300025911 Bacteria 1708
167 Ga0207695_10062132 3300025913 Bacteria 3858
168 Ga0207671_10126548 3300025914 Bacteria 1958
169 Ga0207693_10001764 3300025915 Bacteria 18977
170 Ga0207663_10003842 3300025916 Bacteria 7414
171 Ga0207663_10006336 3300025916 Bacteria 6047
172 Ga0207663_10032363 3300025916 Bacteria 3103
173 Ga0207657_10012891 3300025919 Bacteria 8220
174 Ga0207657_10041949 3300025919 Bacteria 4041
175 Ga0207652_10259920 3300025921 Bacteria 1566
176 Ga0207681_10021473 3300025923 Bacteria 4104
177 Ga0207694_10280679 3300025924 Bacteria 1368
178 Ga0207650_10051893 3300025925 Bacteria 3036
179 Ga0207687_10056044 3300025927 Bacteria 2764
180 Ga0207700_10093042 3300025928 Bacteria 2385
181 Ga0207700_10117579 3300025928 Bacteria 2150
182 Ga0207664_10045707 3300025929 Bacteria 3434
183 Ga0207664_10047126 3300025929 Bacteria 3385
184 Ga0207706_10001763 3300025933 Bacteria 21239
185 Ga0207706_10114790 3300025933 Bacteria 2369
186 Ga0207686_10048052 3300025934 Bacteria 2641
187 Ga0207709_10006083 3300025935 Bacteria 6803
188 Ga0207669_10006404 3300025937 Bacteria 5378
189 Ga0207704_10009774 3300025938 Bacteria 4645
190 Ga0207665_10012045 3300025939 Bacteria 5677
191 Ga0207665_10220773 3300025939 Bacteria 1389
192 Ga0207691_10011336 3300025940 Bacteria 8555
193 Ga0207691_10075120 3300025940 Bacteria 3048
194 Ga0207711_10048746 3300025941 Bacteria 3624
195 Ga0207651_10008687 3300025960 Bacteria 5505
196 Ga0207651_10016646 3300025960 Bacteria 4315
197 Ga0207712_10037133 3300025961 Bacteria 3322
198 Ga0207712_10148937 3300025961 Bacteria 1806
199 Ga0207668_10002534 3300025972 Bacteria 10671
200 Ga0207640_10008142 3300025981 Bacteria 5807
201 Ga0207703_10176745 3300026035 Bacteria 1881
202 Ga0207678_10004912 3300026067 Bacteria 12012
203 Ga0207678_10037942 3300026067 Bacteria 4188
204 Ga0207708_10004920 3300026075 Bacteria 9851
205 Ga0207702_10000101 3300026078 Bacteria 99845
206 Ga0207702_10151066 3300026078 Bacteria 2113
207 Ga0207702_10162401 3300026078 Bacteria 2041
208 Ga0207648_10006487 3300026089 Bacteria 11621
209 Ga0207648_10271244 3300026089 Bacteria 1516
210 Ga0207675_100054595 3300026118 Bacteria 3727
211 Ga0207683_10014299 3300026121 Bacteria 6761
212 Ga0207698_10016038 3300026142 Bacteria 5038
213 Ga0207698_10112487 3300026142 Bacteria 2285
214 Ga0209589_1000005 3300027357 Bacteria 530958
215 Ga0209489_100005 3300027361 Bacteria 530958
216 Ga0209700_100006 3300027363 Bacteria 530958
217 Ga0209588_1040481 3300027671 Bacteria 1504
218 Ga0207428_10020197 3300027907 Bacteria 5663
219 Ga0207428_10075775 3300027907 Bacteria 2636
220 Ga0268266_10109475 3300028379 Bacteria 2446
221 Ga0268265_10040171 3300028380 Bacteria 3453
222 Ga0268265_10056168 3300028380 Bacteria 2994
223 Ga0268264_10232828 3300028381 Bacteria 1702
224 Ga0265330_10043124 3300031235 Bacteria 1997
225 Ga0265340_10029973 3300031247 Bacteria 2730
226 Ga0265339_10008632 3300031249 Bacteria 6466
227 Ga0265316_10064870 3300031344 Bacteria 2829
228 Ga0307513_10169321 3300031456 Bacteria 2064
229 Ga0307408_100067541 3300031548 Bacteria 2630
230 Ga0265314_10013066 3300031711 Bacteria 6734
231 Ga0307510_10000928 3300033180 Bacteria 31078
232 Ga0315911_1000005 3300033442 Bacteria 426255
233 Ga0373934_0026456 3300035086 Bacteria 2251
234 Ga0373939_0041104 3300035114 Bacteria 1392
235 Ga0373956_0032329 3300035119 Bacteria 2295
236 Ga0373957_0006832 3300035120 Bacteria 3617
237 Ga0373955_0032409 3300035172 Bacteria 2742
238 Ga0373962_0015111 3300035242 Bacteria 1975
239 Ga0373931_0007660 3300035691 Bacteria 5093
240 Ga0373935_0001026 3300035692 Bacteria 15187
241 Ga0373927_0002601 3300035695 Bacteria 13156
242 Ga0373927_0006364 3300035695 Bacteria 8045
243 Ga0373947_0013236 3300035725 Bacteria 4728
244 Ga0373937_0060793 3300036401 Bacteria 3472
245 Ga0373937_0074985 3300036401 Bacteria 3123
246 Ga0373937_0201078 3300036401 Bacteria 1873
247 Ga0373937_0334996 3300036401 Bacteria 1432
248 Ga0373925_0021692 3300037068 Bacteria 4681
249 Ga0395900_0009417 3300037418 Bacteria 10014
250 Ga0395898_0010330 3300037466 Bacteria 9767
251 Ga0436364_0718622 3300037853 Bacteria 2862
252 Ga0436364_1447887 3300037853 Bacteria 2428
253 Ga0395901_0013474 3300038443 Bacteria 8313
254 Ga0436365_1039966 3300039437 Bacteria 3205
255 Ga0436360_0127194 3300039438 Bacteria 7015
256 Ga0436361_0171734 3300039447 Bacteria 7756
257 Ga0436361_0436460 3300039447 Bacteria 4680
258 Ga0436361_0516035 3300039447 Bacteria 1732
259 Ga0466965_0017517 3300044683 Bacteria 3425
260 Ga0466966_0012155 3300044684 Bacteria 5703
261 Ga0466961_0000528 3300044693 Bacteria 24250
262 Ga0466957_0070987 3300044842 Bacteria 2153
263 Ga0466959_0006894 3300045049 Bacteria 7931
264 Ga0466967_0066335 3300045976 Bacteria 3216
265 Ga0495592_0037547 3300046454 Bacteria 3647
266 Ga0495603_0001156 3300046455 Bacteria 15378
267 Ga0495629_0007329 3300046459 Bacteria 8129
268 Ga0495629_0020961 3300046459 Bacteria 4665
269 Ga0495629_0122769 3300046459 Bacteria 1809
270 Ga0495629_0208273 3300046459 Bacteria 1351
271 Ga0495638_0003384 3300046460 Bacteria 12564
272 Ga0495651_0005551 3300046462 Bacteria 9619
273 Ga0495651_0009663 3300046462 Bacteria 7417
274 Ga0495651_0074760 3300046462 Bacteria 2570
275 Ga0495653_0012628 3300046463 Bacteria 6899
276 Ga0495653_0066838 3300046463 Bacteria 2702
277 Ga0495582_0003642 3300046473 Bacteria 8675
278 Ga0495639_0001339 3300046475 Bacteria 11056
279 Ga0495662_0002101 3300046476 Bacteria 9986
280 Ga0495664_0014611 3300046477 Bacteria 4453
281 Ga0495664_0047664 3300046477 Bacteria 2543
282 Ga0495606_0001096 3300046507 Bacteria 38817
283 Ga0495610_0093762 3300046512 Bacteria 1356
284 Ga0495618_0017747 3300046514 Bacteria 4367
285 Ga0495618_0046041 3300046514 Bacteria 2753
286 Ga0495628_0166628 3300046516 Bacteria 1672
287 Ga0495630_0034020 3300046517 Bacteria 3802
288 Ga0495630_0064323 3300046517 Bacteria 2756
289 Ga0495630_0089315 3300046517 Bacteria 2328
290 Ga0495637_0045528 3300046520 Bacteria 1861
291 Ga0495643_0087506 3300046522 Bacteria 1612
292 Ga0495666_0037853 3300046526 Bacteria 2346
293 Ga0495652_0002553 3300046529 Bacteria 18651
294 Ga0495652_0019981 3300046529 Bacteria 5957
295 Ga0495665_0005946 3300046531 Bacteria 6572
296 Ga0495640_0042702 3300046533 Bacteria 3161
297 Ga0495587_0001810 3300046536 Bacteria 14259
298 Ga0495587_0016248 3300046536 Bacteria 4634
299 Ga0495587_0018343 3300046536 Bacteria 4340
300 Ga0495609_0057831 3300046538 Bacteria 1716
301 Ga0495645_0010090 3300046543 Bacteria 6617
302 Ga0495645_0044294 3300046543 Bacteria 3246
303 Ga0495645_0104685 3300046543 Bacteria 2009
304 Ga0495645_0110659 3300046543 Bacteria 1944
305 Ga0495622_0002979 3300046557 Bacteria 8050
306 Ga0495622_0027566 3300046557 Bacteria 2651
307 Ga0495622_0050711 3300046557 Bacteria 1925
308 Ga0495667_0158588 3300046559 Bacteria 1455
309 Ga0495656_0014767 3300046615 Bacteria 2935
310 Ga0495668_0028463 3300046616 Bacteria 3160
311 Ga0495634_0010428 3300046642 Bacteria 6808
312 Ga0495634_0013199 3300046642 Bacteria 5971
313 Ga0495634_0058285 3300046642 Bacteria 2574
314 Ga0495625_0026215 3300046660 Bacteria 4407
315 Ga0495635_0016026 3300046663 Bacteria 5234
316 Ga0495635_0017508 3300046663 Bacteria 5003
317 Ga0495635_0020906 3300046663 Bacteria 4560
318 Ga0495635_0055049 3300046663 Bacteria 2740
319 Ga0495635_0166509 3300046663 Bacteria 1500
320 Ga0495661_0111234 3300046665 Bacteria 1526
321 Ga0495588_0000856 3300046674 Bacteria 13487
322 Ga0495657_0006245 3300046675 Bacteria 9343
323 Ga0495657_0121133 3300046675 Bacteria 1647
324 Ga0495623_0024653 3300046679 Bacteria 3873
325 Ga0495623_0047849 3300046679 Bacteria 2714
326 Ga0495646_0008841 3300046680 Bacteria 6396
327 Ga0495646_0024264 3300046680 Bacteria 3819
328 Ga0495646_0114377 3300046680 Bacteria 1533
329 Ga0495646_0127115 3300046680 Bacteria 1437
330 Ga0495647_0023164 3300046681 Bacteria 2250
331 Ga0495669_0007372 3300046684 Bacteria 4611
332 Ga0495669_0072861 3300046684 Bacteria 1568
333 Ga0495613_0161163 3300046689 Bacteria 1596
334 Ga0495613_0165111 3300046689 Bacteria 1573
335 Ga0495624_0005387 3300046690 Bacteria 9229
336 Ga0495671_0035040 3300046692 Bacteria 2551
337 Ga0495649_0054242 3300046694 Bacteria 2168
338 Ga0495600_0006953 3300046809 Bacteria 6901
339 Ga0495600_0038790 3300046809 Bacteria 3101
340 Ga0495600_0060206 3300046809 Bacteria 2479
341 Ga0495581_0004974 3300047315 Bacteria 7692
342 Ga0495604_0005799 3300047317 Bacteria 9797
343 Ga0495604_0025841 3300047317 Bacteria 4676
344 Ga0495604_0036801 3300047317 Bacteria 3857
345 Ga0495604_0054723 3300047317 Bacteria 3078
346 Ga0495604_0083370 3300047317 Bacteria 2389
347 Ga0495604_0112144 3300047317 Bacteria 1987
348 Ga0495674_0003716 3300047319 Bacteria 14839
349 Ga0495674_0010575 3300047319 Bacteria 8734
350 Ga0495674_0015066 3300047319 Bacteria 7236
351 Ga0495674_0060065 3300047319 Bacteria 3318
352 Ga0495672_0044824 3300047320 Bacteria 2650
353 Ga0495672_0055278 3300047320 Bacteria 2317
354 Ga0495676_0016703 3300047321 Bacteria 6500
355 Ga0495676_0076004 3300047321 Bacteria 2566
356 Ga0495676_0095338 3300047321 Bacteria 2214
357 Ga0495680_0002657 3300047322 Bacteria 18096
358 Ga0495680_0028899 3300047322 Bacteria 4543
359 Ga0495680_0047336 3300047322 Bacteria 3383
360 Ga0495675_0112860 3300047444 Bacteria 1695
361 Ga0495684_0011768 3300047471 Bacteria 6751
362 Ga0495684_0091269 3300047471 Bacteria 2307
363 Ga0495686_0111169 3300047472 Bacteria 1643
364 Ga0495593_0004447 3300047673 Bacteria 8326
365 Ga0495593_0046164 3300047673 Bacteria 2323
366 Ga0495602_0004838 3300048088 Bacteria 14088
367 Ga0495602_0005315 3300048088 Bacteria 13515
368 Ga0495602_0039952 3300048088 Bacteria 4312
369 Ga0495602_0115252 3300048088 Bacteria 2174
370 Ga0496101_0028077 3300048904 Bacteria 3926
371 Ga0496101_0056378 3300048904 Bacteria 2841
372 Ga0496101_0177223 3300048904 Bacteria 1640
373 Ga0496102_0211291 3300048905 Bacteria 1829
374 Ga0496104_0006383 3300048907 Bacteria 10368
375 Ga0496104_0008771 3300048907 Bacteria 8990
376 Ga0496104_0009093 3300048907 Bacteria 8836
377 Ga0496104_0011052 3300048907 Bacteria 8078
378 Ga0496104_0016813 3300048907 Bacteria 6648
379 Ga0496104_0019057 3300048907 Bacteria 6270
380 Ga0496104_0019891 3300048907 Bacteria 6148
381 Ga0496104_0037785 3300048907 Bacteria 4514
382 Ga0496104_0101045 3300048907 Bacteria 2761
383 Ga0496104_0141974 3300048907 Bacteria 2307
384 Ga0496105_0004710 3300048908 Bacteria 10290
385 Ga0496105_0006043 3300048908 Bacteria 9260
386 Ga0496105_0029844 3300048908 Bacteria 4465
387 Ga0496105_0029961 3300048908 Bacteria 4456
388 Ga0496105_0052643 3300048908 Bacteria 3362
389 Ga0496105_0079787 3300048908 Bacteria 2703
390 Ga0496106_0063814 3300048909 Bacteria 2800
391 Ga0496107_0171948 3300048910 Bacteria 1608
392 Ga0496108_0000684 3300048911 Bacteria 26239
393 Ga0496108_0014365 3300048911 Bacteria 6465
394 Ga0496108_0022159 3300048911 Bacteria 5222
395 Ga0496108_0022357 3300048911 Bacteria 5199
396 Ga0496108_0023629 3300048911 Bacteria 5059
397 Ga0496108_0214454 3300048911 Bacteria 1671
398 Ga0496109_0003041 3300048912 Bacteria 13980
399 Ga0496109_0008138 3300048912 Bacteria 8891
400 Ga0496109_0020657 3300048912 Bacteria 5817
401 Ga0496109_0030071 3300048912 Bacteria 4867
402 Ga0496109_0033235 3300048912 Bacteria 4640
403 Ga0496110_0017354 3300048913 Bacteria 6020
404 Ga0496110_0018064 3300048913 Bacteria 5907
405 Ga0496110_0034774 3300048913 Bacteria 4368
406 Ga0496110_0058186 3300048913 Bacteria 3404
407 Ga0496110_0067116 3300048913 Bacteria 3173
408 Ga0496110_0087033 3300048913 Bacteria 2790
409 Ga0496111_0003992 3300048914 Bacteria 9258
410 Ga0496111_0016232 3300048914 Bacteria 5131
411 Ga0496111_0021209 3300048914 Bacteria 4533
412 Ga0496111_0060491 3300048914 Bacteria 2745
413 Ga0496111_0090142 3300048914 Unclassified 2246
414 Ga0496112_0000008 3300048915 Bacteria 310323
415 Ga0496112_0005031 3300048915 Bacteria 11350
416 Ga0496112_0009344 3300048915 Bacteria 8825
417 Ga0496112_0022886 3300048915 Bacteria 5961
418 Ga0496112_0025283 3300048915 Bacteria 5701
419 Ga0496112_0035694 3300048915 Bacteria 4846
420 Ga0496112_0068510 3300048915 Bacteria 3504
421 Ga0496113_0005682 3300048916 Bacteria 7813
422 Ga0496113_0007895 3300048916 Bacteria 6884
423 Ga0496113_0013688 3300048916 Bacteria 5508
424 Ga0496113_0035430 3300048916 Bacteria 3649
425 Ga0496113_0039673 3300048916 Bacteria 3467
426 Ga0496113_0058773 3300048916 Unclassified 2894
427 Ga0496115_0049809 3300048918 Bacteria 3354
428 Ga0496115_0083572 3300048918 Bacteria 2603
429 Ga0496115_0263974 3300048918 Bacteria 1416
430 Ga0496116_0039775 3300048919 Bacteria 3246
431 Ga0496118_0011588 3300048921 Bacteria 8585
432 Ga0496118_0053761 3300048921 Bacteria 3057
433 Ga0496118_0057863 3300048921 Bacteria 2902
434 Ga0496118_0104305 3300048921 Bacteria 1904
435 Ga0496118_0142342 3300048921 Bacteria 1517
436 Ga0496119_0015262 3300048922 Bacteria 5933
437 Ga0496120_0016389 3300048923 Bacteria 4843
438 Ga0496121_0000774 3300048924 Bacteria 58528
439 Ga0496121_0001681 3300048924 Bacteria 36391
440 Ga0496121_0004204 3300048924 Bacteria 19648
441 Ga0496121_0031816 3300048924 Bacteria 4811
442 Ga0496121_0058085 3300048924 Bacteria 3201
443 Ga0496121_0084150 3300048924 Bacteria 2509
444 Ga0496121_0134213 3300048924 Bacteria 1846
445 Ga0496123_0081115 3300048926 Bacteria 1973
446 Ga0496124_0072981 3300048927 Bacteria 2841
447 Ga0496125_0000063 3300048928 Bacteria 250260
448 Ga0496125_0020683 3300048928 Bacteria 6171
449 Ga0496125_0021892 3300048928 Bacteria 5948
450 Ga0496125_0035456 3300048928 Bacteria 4374
451 Ga0496126_0003851 3300048929 Bacteria 18556
452 Ga0496126_0004139 3300048929 Bacteria 17539
453 Ga0496126_0017838 3300048929 Bacteria 7063
454 Ga0496126_0026816 3300048929 Bacteria 5516
455 Ga0496126_0046515 3300048929 Bacteria 3979
456 Ga0496126_0072722 3300048929 Bacteria 3058
457 Ga0496126_0134983 3300048929 Bacteria 2129
458 Ga0501031_0011778 3300049568 Bacteria 5705
459 Ga0501032_0000030 3300049569 Bacteria 130405
460 Ga0501032_0128828 3300049569 Bacteria 1670
461 Ga0501033_0000111 3300049570 Bacteria 78688
462 Ga0501034_0000072 3300049571 Bacteria 179824
463 Ga0501036_0000033 3300049572 Bacteria 88546
464 Ga0501036_0128260 3300049572 Bacteria 2142
465 Ga0501036_0139834 3300049572 Bacteria 2043
466 Ga0501037_0000090 3300049573 Bacteria 85021
467 Ga0501037_0018343 3300049573 Bacteria 5157
468 Ga0501038_0000060 3300049574 Bacteria 92314
469 Ga0501038_0044937 3300049574 Bacteria 3835
470 Ga0501039_0001633 3300049575 Bacteria 16530
471 Ga0501043_0000258 3300049579 Bacteria 48131
472 Ga0501043_0063609 3300049579 Bacteria 2897
473 Ga0501043_0136863 3300049579 Bacteria 1918
474 Ga0501046_0000078 3300049580 Bacteria 102826
475 Ga0501046_0028253 3300049580 Bacteria 4570
476 Ga0501047_0000140 3300049581 Bacteria 88265
477 Ga0501047_0035648 3300049581 Bacteria 4806
478 Ga0501067_0000150 3300049583 Bacteria 38434
479 Ga0501068_0000292 3300049584 Bacteria 24928
480 Ga0501070_0062674 3300049586 Bacteria 3080
481 Ga0501070_0080128 3300049586 Bacteria 2702
482 Ga0501072_0000476 3300049588 Bacteria 28786
483 Ga0501073_0000009 3300049589 Bacteria 195649
484 Ga0501074_0000100 3300049590 Bacteria 41920
485 Ga0501079_0002676 3300049741 Bacteria 12956
486 Ga0501080_0000088 3300049742 Bacteria 61753
487 Ga0501035_0000302 3300049822 Bacteria 58095
488 Ga0501035_0055116 3300049822 Bacteria 3550
489 Ga0501035_0207527 3300049822 Bacteria 1677
490 Ga0501035_0252120 3300049822 Bacteria 1498
491 Ga0501044_0000438 3300049823 Bacteria 51173
492 Ga0501044_0059192 3300049823 Bacteria 3926
493 Ga0501045_0002548 3300049824 Bacteria 12424
494 nmdc:mga0yw44_4052_c1 3300050492 Bacteria 6632
495 nmdc:mga0yw44_72733_c1 3300050492 Bacteria 2138
496 nmdc:mga07m45_56664_c1 3300050496 Bacteria 2215
497 nmdc:mga05p37_285_c1 3300050507 Bacteria 52916
498 nmdc:mga09592_664_c1 3300050508 Bacteria 24142
499 nmdc:mga0qj67_22598_c1 3300050509 Bacteria 4831
500 nmdc:mga0qj67_296904_c1 3300050509 Bacteria 1309
501 nmdc:mga06r32_118_c1 3300050510 Bacteria 56778
502 nmdc:mga08y16_28203_c1 3300050511 Bacteria 5918
503 nmdc:mga08y16_87820_c1 3300050511 Bacteria 3240
504 nmdc:mga08y16_89_c1 3300050511 Bacteria 76793
505 nmdc:mga0n895_361601_c1 3300050512 Bacteria 1469
506 nmdc:mga0n895_7091_c1 3300050512 Bacteria 9579
507 nmdc:mga0rr50_68429_c1 3300050513 Bacteria 2700
508 nmdc:mga08x19_35_c1 3300050514 Bacteria 185171
509 nmdc:mga0a205_17237_c1 3300050515 Bacteria 6766
510 Ga0495601_0075102 3300053077 Bacteria 2163
511 Ga0495601_0116640 3300053077 Bacteria 1732
512 Ga0495612_0002674 3300053078 Bacteria 7356
513 Ga0495612_0008890 3300053078 Bacteria 4070
514 Ga0495612_0009604 3300053078 Bacteria 3918
515 Ga0495595_0025822 3300053084 Bacteria 2605
516 Ga0495619_0001881 3300053085 Bacteria 13975
517 Ga0495619_0012259 3300053085 Bacteria 5393
518 Ga0495619_0014546 3300053085 Bacteria 4971
519 Ga0495619_0022363 3300053085 Bacteria 4046
520 Ga0500578_0075375 3300053086 Bacteria 2149
521 Ga0500581_067905 3300053089 Bacteria 1797
522 Ga0500646_0009652 3300053090 Bacteria 2470
523 Ga0500651_0107527 3300053093 Bacteria 1705
524 Ga0500566_0034377 3300053094 Bacteria 2949
525 Ga0500641_0043983 3300053096 Bacteria 1815
526 Ga0500650_0014918 3300053098 Bacteria 3299
527 Ga0500554_002276 3300053102 Bacteria 3753
528 Ga0500556_0001087 3300053104 Bacteria 13707
529 Ga0500562_035914 3300053108 Bacteria 1313
530 Ga0500572_000168 3300053111 Bacteria 22927
531 Ga0500595_001683 3300053119 Bacteria 11615
532 Ga0500595_006519 3300053119 Bacteria 4941
533 Ga0500595_011091 3300053119 Bacteria 3546
534 Ga0500595_023075 3300053119 Bacteria 2191
535 Ga0500642_0000026 3300053130 Bacteria 127731
536 Ga0500652_000882 3300053131 Bacteria 9939
537 Ga0500658_0016838 3300053134 Bacteria 2726
538 Ga0500559_0001562 3300053136 Bacteria 12815
539 Ga0500559_0002898 3300053136 Bacteria 8636
540 Ga0500568_0002271 3300053139 Bacteria 11457
541 Ga0500577_0000744 3300053142 Bacteria 8361
542 Ga0500588_0048594 3300053146 Bacteria 1313
543 Ga0500603_001339 3300053150 Bacteria 5643
544 Ga0500604_0001713 3300053151 Bacteria 6145
545 Ga0500616_0000031 3300053153 Bacteria 415013
546 Ga0500616_0000034 3300053153 Bacteria 396651
547 Ga0500622_0000112 3300053156 Bacteria 83558
548 Ga0500634_0040622 3300053161 Bacteria 2528
549 Ga0500639_029111 3300053163 Bacteria 2919
550 Ga0500636_0005679 3300053177 Bacteria 7134
551 Ga0500636_0041200 3300053177 Bacteria 2731
552 Ga0500637_0003548 3300053178 Bacteria 7231
553 Ga0500601_000034 3300053737 Bacteria 28953
554 Ga0501084_0005330 3300054114 Bacteria 10530
555 Ga0587072_009788 3300059643 Bacteria 1537
556 Ga0501082_0206809 3300060353 Bacteria 1708
557 2509149950 2508501128 Bacteria 8613869
558 2513641448 2513237094 Bacteria 8789602
559 2513655466 2513237096 Bacteria 8722461
560 2513678534 2513237098 Bacteria 9902361
561 2513859984 2513237137 Bacteria 9558895
562 2513889590 2513237141 Bacteria 8496279
563 2513916456 2513237145 Bacteria 8979722
564 2517889933 2517572143 Bacteria 9484767
565 2524468842 2524023210 Bacteria 9029266
566 2524535023 2524023228 Bacteria 10118060
567 2528852185 2528768022 Bacteria 10457665
568 2603861332 2602042107 Bacteria 6226103
569 2617372525 2617270741 Bacteria 8201522
570 2644287521 2643221651 Bacteria 4798932
571 2671121039 2667528175 Bacteria 7532676
572 2723847412 2721755755 Bacteria 8322773
573 2728749161 2728368998 Bacteria 8720350
574 2793068113 2791355197 Bacteria 8420563
575 2824602043 2824600985 Bacteria 8488197
576 2824610031 2824609381 Bacteria 8672835
577 2824620287 2824617872 Bacteria 8814715
578 2824629552 2824626560 Bacteria 8813858
579 2824635872 2824635225 Bacteria 8785348
580 2824646174 2824644064 Bacteria 8743947
581 2824654887 2824653114 Bacteria 8493680
582 2824665503 2824661429 Bacteria 9877870
583 2824710823 2824704595 Bacteria 9667483
584 2824721325 2824714736 Bacteria 8717648
585 2824731300 2824723954 Bacteria 8758240
586 2824738992 2824732956 Bacteria 7810675
587 2824747045 2824746037 Bacteria 7911610
588 2824757539 2824753945 Bacteria 9787441
589 2824764129 2824763712 Bacteria 9792355
590 2841959490 2841957949 Bacteria 8652217
591 2849077545 2849076700 Bacteria 7039503
592 2857510161 2857509624 Bacteria 7472071
593 2857530099 2857524615 Bacteria 6615449
594 2879106235 2879099564 Bacteria 10442239
595 2881365211 2881364244 Bacteria 7710352
596 2885376530 2885374607 Bacteria 8927485
597 2885387149 2885383462 Bacteria 9473874
598 2885410679 2885409591 Bacteria 9235467
599 2888392067 2888388044 Bacteria 7304136
600 2888423224 2888419890 Bacteria 7857137
601 2889037458 2889033259 Bacteria 9099371
602 2893071700 2893066018 Bacteria 6158120
603 2903755358 2903748898 Bacteria 9972761
604 2903772023 2903768456 Bacteria 9749579
605 2904713356 2904711408 Bacteria 9771557
606 2906612319
607 2906638344 2906635258 Bacteria 8601019
608 2906663371 2906660503 Bacteria 8595048
609 2908739805 2908739725 Bacteria 8628932
610 2908780972 2908775508 Bacteria 8092255
611 2919076895 2919073203 Bacteria 6531949
612 2922376830
613 2922426980
614 2929621486 2929615660 Bacteria 9193770
615 2929631699 2929624759 Bacteria 9339455
616 2932790211 2932784394 Bacteria 9704911
617 2932798723 2932794094 Bacteria 7915132
618 2932806625 2932801729 Bacteria 7987968
619 2932815883 2932809354 Bacteria 9135765
620 2932824771 2932818245 Bacteria 9955613
621 2932833330 2932828146 Bacteria 9745859
622 2933583489 2933577622 Bacteria 9116884
623 2935621395 2935616580 Bacteria 9032984
624 2935633129 2935630451 Bacteria 8169952
625 2935644745 2935638405 Bacteria 10015038
626 2935672349 2935665750 Bacteria 9571747
627 2935682788 2935675223 Bacteria 9928132
628 2935693305 2935684952 Bacteria 9590419
629 2935702193 2935694250 Bacteria 9291695
630 2935710888 2935703347 Bacteria 10242284
631 2935720906 2935713505 Bacteria 9608509
632 2935730607 2935722832 Bacteria 9608746
633 2935740628 2935732158 Bacteria 9706831
634 2935749898 2935741537 Bacteria 9707219
635 2935759282 2935750917 Bacteria 9590372
636 2935767268 2935760218 Bacteria 9817913
637 2935808838 2935801545 Bacteria 9301974
638 2935817635 2935810662 Bacteria 9401221
639 2935833995 2935827899 Bacteria 10038562
640 2935845514 2935837841 Bacteria 9454360
641 2935859412 2935855204 Bacteria 9035059
642 2935869945 2935864058 Bacteria 9784707
643 2935880907 2935873716 Bacteria 9632195
644 2935889411 2935883170 Bacteria 7964738
645 2935964730 2935959822 Bacteria 7869783
646 2935998318 2935992306 Bacteria 9802711
647 2936009219 2936002035 Bacteria 9362176
648 2936044464 2936037263 Bacteria 9446081
649 2940565192 2940556831 Bacteria 9590747
650 2941509569 2941507105 Bacteria 8166816
651 2941517398 2941515067 Bacteria 8166720
652 2941526649 2941523033 Bacteria 8169134
653 2941536620 2941531003 Bacteria 7653939
654 2941542882 2941538514 Bacteria 9402094
655 3005476162 3005474847 Bacteria 9259049
656 3005601136 3005594810 Bacteria 8716512
657 3005716596 3005710791 Bacteria 7622528
658 8006937467 8006933436 Bacteria 10410654
659 8006977496 8006973647 Bacteria 10679141
660 8006990484 8006984368 Bacteria 9651211
661 8016519773 8016511872 Bacteria 9921665
662 8017065765 8017057580 Bacteria 10023680
663 8019561154 8019555841 Bacteria 9642137
664 8019571241 8019565922 Bacteria 9639779
665 8019585196 8019576017 Bacteria 10049540
666 8019593167 8019586578 Bacteria 10212056
667 8019598298 8019597564 Bacteria 10041141
668 8019610080 8019608314 Bacteria 10042931
669 8019655177 8019648815 Bacteria 10014479
670 8055744311 8055742211 Bacteria 9226248
671 8056682342 8056681323 Bacteria 8472857
672 8056691959 8056689827 Bacteria 6712655
673 Ga0496115_0213367
674 JGI24744J21845_10008041
675 JGI24742J22300_10000509
676 JGI25406J46586_10000014
677 JGI25153J46596_10038702
678 JGI25160J50197_1001954
679 JGI25160J50197_1011003
680 Ga0007429J51699_1095660
681 JGI25404J52841_10000057
682 Ga0065165_1000054
683 Ga0065165_1003837
684 Ga0065704_10110842
685 Ga0065707_10004110
686 Ga0070658_10039816
687 Ga0070658_10055874
688 Ga0070676_10008312
689 Ga0070676_10032947
690 Ga0070690_100002327
691 Ga0070680_100093318
692 Ga0070660_100041577
693 Ga0070660_100091512
694 Ga0070661_100116406
695 Ga0070668_100015142
696 Ga0070669_100011384
697 Ga0070675_100090215
698 Ga0070674_100000485
699 Ga0070673_100028812
700 Ga0070659_100261343
701 Ga0070667_100081235
702 Ga0070714_100022799
703 Ga0070713_100128209
704 Ga0070710_10006621
705 Ga0070701_10035060
706 Ga0070700_100003300
707 Ga0070700_100033409
708 Ga0070663_100023267
709 Ga0070663_100051334
710 Ga0070678_100060893
711 Ga0070662_100022601
712 Ga0068867_100004714
713 Ga0070685_10014233
714 Ga0070707_100103748
715 Ga0070699_100022502
716 Ga0070679_100064934
717 Ga0070697_100102688
718 Ga0070672_100077955
719 Ga0070686_100006029
720 Ga0070695_100001037
721 Ga0070665_100007932
722 Ga0070704_100066334
723 Ga0068855_100080870
724 Ga0068855_100115745
725 Ga0070664_100058436
726 Ga0068854_100003638
727 Ga0068856_100000560
728 Ga0068856_100095555
729 Ga0070702_100021652
730 Ga0068852_100163403
731 Ga0068866_10002087
732 Ga0068861_100011596
733 Ga0068870_10085315
734 Ga0068858_100027398
735 Ga0068858_100193876
736 Ga0068860_100011821
737 Ga0068862_100016806
738 Ga0068862_100018037
739 Ga0081455_10003143
740 Ga0081540_1000370
741 Ga0081540_1000371
742 Ga0081540_1015080
743 Ga0081539_10000008
744 Ga0070717_10040726
745 Ga0070717_10152489
746 Ga0070715_10040732
747 Ga0070716_100024268
748 Ga0070712_100012336
749 Ga0070712_100126315
750 Ga0075428_100002097
751 Ga0075428_100069782
752 Ga0075431_100000059
753 Ga0075433_10002766
754 Ga0075434_100002045
755 Ga0075429_100001315
756 Ga0068865_100003839
757 Ga0075436_100015484
758 Ga0099824_1016218
759 Ga0099822_1007626
760 Ga0075435_100009873
761 Ga0075435_100084285
762 Ga0099794_10044444
763 Ga0099795_10026058
764 Ga0105240_10080600
765 Ga0111539_10001296
766 Ga0111539_10027399
767 Ga0111539_10124052
768 Ga0111539_10146002
769 Ga0105245_10031810
770 Ga0105245_10073745
771 Ga0114129_10001483
772 Ga0105243_10258730
773 Ga0105241_10059531
774 Ga0105242_10031596
775 Ga0105242_10095018
776 Ga0105248_10422605
777 Ga0105238_10102762
778 Ga0105238_10182664
779 Ga0105238_10184941
780 Ga0105249_10001730
781 Ga0105249_10018210
782 Ga0105249_10227807
783 Ga0099796_10025130
784 Ga0105239_10056173
785 Ga0105239_10088243
786 Ga0157373_10096779
787 Ga0157373_10136218
788 Ga0157371_10076826
789 Ga0157370_10025911
790 Ga0157374_10378168
791 Ga0157378_10008838
792 Ga0163162_10009472
793 Ga0163162_10031313
794 Ga0157375_10459051
795 Ga0163163_10008715
796 Ga0163163_10064017
797 Ga0163163_10066025
798 Ga0163163_10109568
799 Ga0163163_10254404
800 Ga0157380_10104532
801 Ga0157379_10019649
802 Ga0157379_10139631
803 Ga0157376_10015348
804 Ga0157376_10125653
805 Ga0163161_10001515
806 Ga0214544_1014838
807 Ga0214542_1014570
808 Ga0214545_1014326
809 Ga0214543_1015412
810 Ga0213873_10015801
811 Ga0213875_10045581
812 Ga0209563_101910
813 Ga0209677_101648
814 Ga0209677_103715
815 Ga0209148_1008198
816 Ga0209233_1000794
817 Ga0209233_1002869
818 Ga0209233_1009444
819 Ga0209455_1002569
820 Ga0209455_1008997
821 Ga0209564_1014386
822 Ga0209758_1009026
823 Ga0209758_1010412
824 Ga0209758_1022843
825 Ga0209758_1033486
826 Ga0207426_1002185
827 Ga0207426_1004331
828 Ga0207426_1015910
829 Ga0207697_10005623
830 Ga0207647_10043910
831 Ga0207647_10068296
832 Ga0207685_10004384
833 Ga0207699_10023803
834 Ga0207645_10027154
835 Ga0207645_10042359
836 Ga0207705_10071624
837 Ga0207705_10087565
838 Ga0207654_10110763
839 Ga0207695_10062132
840 Ga0207671_10126548
841 Ga0207693_10001764
842 Ga0207663_10003842
843 Ga0207663_10006336
844 Ga0207663_10032363
845 Ga0207657_10012891
846 Ga0207657_10041949
847 Ga0207652_10259920
848 Ga0207681_10021473
849 Ga0207694_10280679
850 Ga0207650_10051893
851 Ga0207687_10056044
852 Ga0207700_10093042
853 Ga0207700_10117579
854 Ga0207664_10045707
855 Ga0207664_10047126
856 Ga0207706_10001763
857 Ga0207706_10114790
858 Ga0207686_10048052
859 Ga0207709_10006083
860 Ga0207669_10006404
861 Ga0207704_10009774
862 Ga0207665_10012045
863 Ga0207665_10220773
864 Ga0207691_10011336
865 Ga0207691_10075120
866 Ga0207711_10048746
867 Ga0207651_10008687
868 Ga0207651_10016646
869 Ga0207712_10037133
870 Ga0207712_10148937
871 Ga0207668_10002534
872 Ga0207640_10008142
873 Ga0207703_10176745
874 Ga0207678_10004912
875 Ga0207678_10037942
876 Ga0207708_10004920
877 Ga0207702_10000101
878 Ga0207702_10151066
879 Ga0207702_10162401
880 Ga0207648_10006487
881 Ga0207648_10271244
882 Ga0207675_100054595
883 Ga0207683_10014299
884 Ga0207698_10016038
885 Ga0207698_10112487
886 Ga0209589_1000005
887 Ga0209489_100005
888 Ga0209700_100006
889 Ga0209588_1040481
890 Ga0207428_10020197
891 Ga0207428_10075775
892 Ga0268266_10109475
893 Ga0268265_10040171
894 Ga0268265_10056168
895 Ga0268264_10232828
896 Ga0265330_10043124
897 Ga0265340_10029973
898 Ga0265339_10008632
899 Ga0265316_10064870
900 Ga0307513_10169321
901 Ga0307408_100067541
902 Ga0265314_10013066
903 Ga0307510_10000928
904 Ga0315911_1000005
905 Ga0373934_0026456
906 Ga0373939_0041104
907 Ga0373956_0032329
908 Ga0373957_0006832
909 Ga0373955_0032409
910 Ga0373962_0015111
911 Ga0373931_0007660
912 Ga0373935_0001026
913 Ga0373927_0002601
914 Ga0373927_0006364
915 Ga0373947_0013236
916 Ga0373937_0060793
917 Ga0373937_0074985
918 Ga0373937_0201078
919 Ga0373937_0334996
920 Ga0373925_0021692
921 Ga0395900_0009417
922 Ga0395898_0010330
923 Ga0436364_0718622
924 Ga0436364_1447887
925 Ga0395901_0013474
926 Ga0436365_1039966
927 Ga0436360_0127194
928 Ga0436361_0171734
929 Ga0436361_0436460
930 Ga0436361_0516035
931 Ga0466965_0017517
932 Ga0466966_0012155
933 Ga0466961_0000528
934 Ga0466957_0070987
935 Ga0466959_0006894
936 Ga0466967_0066335
937 Ga0495592_0037547
938 Ga0495603_0001156
939 Ga0495629_0007329
940 Ga0495629_0020961
941 Ga0495629_0122769
942 Ga0495629_0208273
943 Ga0495638_0003384
944 Ga0495651_0005551
945 Ga0495651_0009663
946 Ga0495651_0074760
947 Ga0495653_0012628
948 Ga0495653_0066838
949 Ga0495582_0003642
950 Ga0495639_0001339
951 Ga0495662_0002101
952 Ga0495664_0014611
953 Ga0495664_0047664
954 Ga0495606_0001096
955 Ga0495610_0093762
956 Ga0495618_0017747
957 Ga0495618_0046041
958 Ga0495628_0166628
959 Ga0495630_0034020
960 Ga0495630_0064323
961 Ga0495630_0089315
962 Ga0495637_0045528
963 Ga0495643_0087506
964 Ga0495666_0037853
965 Ga0495652_0002553
966 Ga0495652_0019981
967 Ga0495665_0005946
968 Ga0495640_0042702
969 Ga0495587_0001810
970 Ga0495587_0016248
971 Ga0495587_0018343
972 Ga0495609_0057831
973 Ga0495645_0010090
974 Ga0495645_0044294
975 Ga0495645_0104685
976 Ga0495645_0110659
977 Ga0495622_0002979
978 Ga0495622_0027566
979 Ga0495622_0050711
980 Ga0495667_0158588
981 Ga0495656_0014767
982 Ga0495668_0028463
983 Ga0495634_0010428
984 Ga0495634_0013199
985 Ga0495634_0058285
986 Ga0495625_0026215
987 Ga0495635_0016026
988 Ga0495635_0017508
989 Ga0495635_0020906
990 Ga0495635_0055049
991 Ga0495635_0166509
992 Ga0495661_0111234
993 Ga0495588_0000856
994 Ga0495657_0006245
995 Ga0495657_0121133
996 Ga0495623_0024653
997 Ga0495623_0047849
998 Ga0495646_0008841
999 Ga0495646_0024264
1000 Ga0495646_0114377
1001 Ga0495646_0127115
1002 Ga0495647_0023164
1003 Ga0495669_0007372
1004 Ga0495669_0072861
1005 Ga0495613_0161163
1006 Ga0495613_0165111
1007 Ga0495624_0005387
1008 Ga0495671_0035040
1009 Ga0495649_0054242
1010 Ga0495600_0006953
1011 Ga0495600_0038790
1012 Ga0495600_0060206
1013 Ga0495581_0004974
1014 Ga0495604_0005799
1015 Ga0495604_0025841
1016 Ga0495604_0036801
1017 Ga0495604_0054723
1018 Ga0495604_0083370
1019 Ga0495604_0112144
1020 Ga0495674_0003716
1021 Ga0495674_0010575
1022 Ga0495674_0015066
1023 Ga0495674_0060065
1024 Ga0495672_0044824
1025 Ga0495672_0055278
1026 Ga0495676_0016703
1027 Ga0495676_0076004
1028 Ga0495676_0095338
1029 Ga0495680_0002657
1030 Ga0495680_0028899
1031 Ga0495680_0047336
1032 Ga0495675_0112860
1033 Ga0495684_0011768
1034 Ga0495684_0091269
1035 Ga0495686_0111169
1036 Ga0495593_0004447
1037 Ga0495593_0046164
1038 Ga0495602_0004838
1039 Ga0495602_0005315
1040 Ga0495602_0039952
1041 Ga0495602_0115252
1042 Ga0496101_0028077
1043 Ga0496101_0056378
1044 Ga0496101_0177223
1045 Ga0496102_0211291
1046 Ga0496104_0006383
1047 Ga0496104_0008771
1048 Ga0496104_0009093
1049 Ga0496104_0011052
1050 Ga0496104_0016813
1051 Ga0496104_0019057
1052 Ga0496104_0019891
1053 Ga0496104_0037785
1054 Ga0496104_0101045
1055 Ga0496104_0141974
1056 Ga0496105_0004710
1057 Ga0496105_0006043
1058 Ga0496105_0029844
1059 Ga0496105_0029961
1060 Ga0496105_0052643
1061 Ga0496105_0079787
1062 Ga0496106_0063814
1063 Ga0496107_0171948
1064 Ga0496108_0000684
1065 Ga0496108_0014365
1066 Ga0496108_0022159
1067 Ga0496108_0022357
1068 Ga0496108_0023629
1069 Ga0496108_0214454
1070 Ga0496109_0003041
1071 Ga0496109_0008138
1072 Ga0496109_0020657
1073 Ga0496109_0030071
1074 Ga0496109_0033235
1075 Ga0496110_0017354
1076 Ga0496110_0018064
1077 Ga0496110_0034774
1078 Ga0496110_0058186
1079 Ga0496110_0067116
1080 Ga0496110_0087033
1081 Ga0496111_0003992
1082 Ga0496111_0016232
1083 Ga0496111_0021209
1084 Ga0496111_0060491
1085 Ga0496111_0090142
1086 Ga0496112_0000008
1087 Ga0496112_0005031
1088 Ga0496112_0009344
1089 Ga0496112_0022886
1090 Ga0496112_0025283
1091 Ga0496112_0035694
1092 Ga0496112_0068510
1093 Ga0496113_0005682
1094 Ga0496113_0007895
1095 Ga0496113_0013688
1096 Ga0496113_0035430
1097 Ga0496113_0039673
1098 Ga0496113_0058773
1099 Ga0496115_0049809
1100 Ga0496115_0083572
1101 Ga0496115_0263974
1102 Ga0496116_0039775
1103 Ga0496118_0011588
1104 Ga0496118_0053761
1105 Ga0496118_0057863
1106 Ga0496118_0104305
1107 Ga0496118_0142342
1108 Ga0496119_0015262
1109 Ga0496120_0016389
1110 Ga0496121_0000774
1111 Ga0496121_0001681
1112 Ga0496121_0004204
1113 Ga0496121_0031816
1114 Ga0496121_0058085
1115 Ga0496121_0084150
1116 Ga0496121_0134213
1117 Ga0496123_0081115
1118 Ga0496124_0072981
1119 Ga0496125_0000063
1120 Ga0496125_0020683
1121 Ga0496125_0021892
1122 Ga0496125_0035456
1123 Ga0496126_0003851
1124 Ga0496126_0004139
1125 Ga0496126_0017838
1126 Ga0496126_0026816
1127 Ga0496126_0046515
1128 Ga0496126_0072722
1129 Ga0496126_0134983
1130 Ga0501031_0011778
1131 Ga0501032_0000030
1132 Ga0501032_0128828
1133 Ga0501033_0000111
1134 Ga0501034_0000072
1135 Ga0501036_0000033
1136 Ga0501036_0128260
1137 Ga0501036_0139834
1138 Ga0501037_0000090
1139 Ga0501037_0018343
1140 Ga0501038_0000060
1141 Ga0501038_0044937
1142 Ga0501039_0001633
1143 Ga0501043_0000258
1144 Ga0501043_0063609
1145 Ga0501043_0136863
1146 Ga0501046_0000078
1147 Ga0501046_0028253
1148 Ga0501047_0000140
1149 Ga0501047_0035648
1150 Ga0501067_0000150
1151 Ga0501068_0000292
1152 Ga0501070_0062674
1153 Ga0501070_0080128
1154 Ga0501072_0000476
1155 Ga0501073_0000009
1156 Ga0501074_0000100
1157 Ga0501079_0002676
1158 Ga0501080_0000088
1159 Ga0501035_0000302
1160 Ga0501035_0055116
1161 Ga0501035_0207527
1162 Ga0501035_0252120
1163 Ga0501044_0000438
1164 Ga0501044_0059192
1165 Ga0501045_0002548
1166 nmdc:mga0yw44_4052_c1
1167 nmdc:mga0yw44_72733_c1
1168 nmdc:mga07m45_56664_c1
1169 nmdc:mga05p37_285_c1
1170 nmdc:mga09592_664_c1
1171 nmdc:mga0qj67_22598_c1
1172 nmdc:mga0qj67_296904_c1
1173 nmdc:mga06r32_118_c1
1174 nmdc:mga08y16_28203_c1
1175 nmdc:mga08y16_87820_c1
1176 nmdc:mga08y16_89_c1
1177 nmdc:mga0n895_361601_c1
1178 nmdc:mga0n895_7091_c1
1179 nmdc:mga0rr50_68429_c1
1180 nmdc:mga08x19_35_c1
1181 nmdc:mga0a205_17237_c1
1182 Ga0495601_0075102
1183 Ga0495601_0116640
1184 Ga0495612_0002674
1185 Ga0495612_0008890
1186 Ga0495612_0009604
1187 Ga0495595_0025822
1188 Ga0495619_0001881
1189 Ga0495619_0012259
1190 Ga0495619_0014546
1191 Ga0495619_0022363
1192 Ga0500578_0075375
1193 Ga0500581_067905
1194 Ga0500646_0009652
1195 Ga0500651_0107527
1196 Ga0500566_0034377
1197 Ga0500641_0043983
1198 Ga0500650_0014918
1199 Ga0500554_002276
1200 Ga0500556_0001087
1201 Ga0500562_035914
1202 Ga0500572_000168
1203 Ga0500595_001683
1204 Ga0500595_006519
1205 Ga0500595_011091
1206 Ga0500595_023075
1207 Ga0500642_0000026
1208 Ga0500652_000882
1209 Ga0500658_0016838
1210 Ga0500559_0001562
1211 Ga0500559_0002898
1212 Ga0500568_0002271
1213 Ga0500577_0000744
1214 Ga0500588_0048594
1215 Ga0500603_001339
1216 Ga0500604_0001713
1217 Ga0500616_0000031
1218 Ga0500616_0000034
1219 Ga0500622_0000112
1220 Ga0500634_0040622
1221 Ga0500639_029111
1222 Ga0500636_0005679
1223 Ga0500636_0041200
1224 Ga0500637_0003548
1225 Ga0500601_000034
1226 Ga0501084_0005330
1227 Ga0587072_009788
1228 Ga0501082_0206809
1229 2509149950
1230 2513641448
1231 2513655466
1232 2513678534
1233 2513859984
1234 2513889590
1235 2513916456
1236 2517889933
1237 2524468842
1238 2524535023
1239 2528852185
1240 2603861332
1241 2617372525
1242 2644287521
1243 2671121039
1244 2723847412
1245 2728749161
1246 2793068113
1247 2824602043
1248 2824610031
1249 2824620287
1250 2824629552
1251 2824635872
1252 2824646174
1253 2824654887
1254 2824665503
1255 2824710823
1256 2824721325
1257 2824731300
1258 2824738992
1259 2824747045
1260 2824757539
1261 2824764129
1262 2841959490
1263 2849077545
1264 2857510161
1265 2857530099
1266 2879106235
1267 2881365211
1268 2885376530
1269 2885387149
1270 2885410679
1271 2888392067
1272 2888423224
1273 2889037458
1274 2893071700
1275 2903755358
1276 2903772023
1277 2904713356
1278 2906612319
1279 2906638344
1280 2906663371
1281 2908739805
1282 2908780972
1283 2919076895
1284 2922376830
1285 2922426980
1286 2929621486
1287 2929631699
1288 2932790211
1289 2932798723
1290 2932806625
1291 2932815883
1292 2932824771
1293 2932833330
1294 2933583489
1295 2935621395
1296 2935633129
1297 2935644745
1298 2935672349
1299 2935682788
1300 2935693305
1301 2935702193
1302 2935710888
1303 2935720906
1304 2935730607
1305 2935740628
1306 2935749898
1307 2935759282
1308 2935767268
1309 2935808838
1310 2935817635
1311 2935833995
1312 2935845514
1313 2935859412
1314 2935869945
1315 2935880907
1316 2935889411
1317 2935964730
1318 2935998318
1319 2936009219
1320 2936044464
1321 2940565192
1322 2941509569
1323 2941517398
1324 2941526649
1325 2941536620
1326 2941542882
1327 3005476162
1328 3005601136
1329 3005716596
1330 8006937467
1331 8006977496
1332 8006990484
1333 8016519773
1334 8017065765
1335 8019561154
1336 8019571241
1337 8019585196
1338 8019593167
1339 8019598298
1340 8019610080
1341 8019655177
1342 8055744311
1343 8056682342
1344 8056691959

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

11

358

0.92

PF13433

Peripla_BP_5

Periplasmic binding protein domain

135

365

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jfn-assembly1.cif.gz_A crystal structure of leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein from brucella ovis, closed conformation 0.9133 22 409
7jfn-assembly1.cif.gz_A crystal structure of leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein from brucella ovis, closed conformation 0.9066 22 409
1z18-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8757 22 368
3ip9-assembly1.cif.gz_A structure of atu2422-gaba receptor in complex with gaba 0.8721 23 389
4evr-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0668) in complex with benzoate 0.8683 23 395
ID Description Score Start End Superfamily
3i45A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9067 149 260 3.40.50.2300
3i45A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.894 22 360 3.40.50.2300
3i45A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8727 22 360 3.40.50.2300
af_P04816_25_358_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8675 24 360 3.40.190.10
af_Q69NA5_27_147_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8662 23 149 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1F3YBG4-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9702 40 409
AF-A0A315BBB9-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9619 33 410
AF-A0A4Q3J205-F1-model_v4 deleted 0.9539 275 408
AF-A0A1F3YBG4-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9475 40 409
AF-A0A3S0G2G8-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9474 5 399 GO:0006865

Map