F474267

General Info

Members Datasets Scaffolds Average Seq Length
672 505 1344 327

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919119836|2919124820
Length 376
Sequence RHLLLASTVAVAFGSFGLARADDLKITIGYQTVVEPSKIPQADGTYETATGSKIDWRKFDSGADVIAAVASGSVDIGYVGSSPLAAAASRELPIQTIFVVGLIGESEALVARNGANVTTIADLAGKKVAVPFVSTTHYSLLAALKHEKVDPKTVEILNLRPPEIAAAWERGDIDAAYVWDPALGQIRTSGKIIADSARVAAWGPPTFDAWIVRTQFAEAHPDAVRDFVKVTGKAYADYLDEPDAWSASSVQAETISRLTGAKVEEVPALLKGYVFPTLNEQASSKFLGGDTVKAIAATSEFLKEQGKIDGVLTDYSKYVPHIAIEADLGRFKEAQRQGHTIVHGDAAHRRILSAAGLAKARLVIITFDGTPPSKES

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
46 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
47 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
48 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
49 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
50 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
51 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
82 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
102 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
103 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
106 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
107 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
108 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
109 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
133 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
157 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
158 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
161 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
165 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
166 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
167 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
168 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
169 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
170 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
171 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
172 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
173 2512875024
174 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
175 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
176 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
177 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
178 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
179 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
180 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
181 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
182 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
183 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
184 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
185 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
186 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
187 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
188 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
189 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
190 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
191 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
192 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
193 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
194 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
195 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
196 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
197 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
198 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
199 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
200 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
201 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
202 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
203 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
204 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
205 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
206 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
207 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
208 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
209 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
210 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
211 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
212 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
213 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
214 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
215 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
216 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
217 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
218 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
219 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
220 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
221 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
222 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
223 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
224 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
225 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
226 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
227 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
228 2636415599 Klebsiella variicola DX120E Isolate Unclassified
229 2643221557 Ensifer sp. Root558 Isolate Unclassified
230 2643221568 Rhizobium sp. Root564 Isolate Unclassified
231 2643221607 Rhizobium sp. Root73 Isolate Unclassified
232 2643221610 Ensifer sp. Root74 Isolate Unclassified
233 2643221618 Ensifer sp. Root231 Isolate Unclassified
234 2643221626 Ensifer sp. Root31 Isolate Unclassified
235 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
236 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
237 2643221655 Ensifer sp. Root1252 Isolate Unclassified
238 2643221659 Ensifer sp. Root127 Isolate Unclassified
239 2643221668 Ensifer sp. Root423 Isolate Unclassified
240 2643221675 Ensifer sp. Root1298 Isolate Unclassified
241 2643221680 Ensifer sp. Root1312 Isolate Unclassified
242 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
243 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
244 2643221698 Ensifer sp. Root142 Isolate Unclassified
245 2643221712 Ensifer sp. Root258 Isolate Unclassified
246 2643221718 Rhizobium sp. Root268 Isolate Unclassified
247 2643221723 Ensifer sp. Root278 Isolate Unclassified
248 2643221726 Ensifer sp. Root954 Isolate Unclassified
249 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
250 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
251 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
252 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
253 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
254 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
255 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
256 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
257 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
258 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
259 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
260 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
261 2751185917 Enterobacter sp. HK169 Isolate Unclassified
262 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
263 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
264 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
265 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
266 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
267 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
268 2775507074 Klebsiella sp. D5A Isolate Unclassified
269 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
270 2821118458 Enterobacter asburiae 609 Isolate Unclassified
271 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
272 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
273 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
274 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
275 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
276 2844163670 Ensifer sp. 1H6 Isolate Unclassified
277 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
278 2847085930 Erwinia persicina B64 Isolate Bulb
279 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
280 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
281 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
282 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
283 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
284 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
285 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
286 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
287 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
288 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
289 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
290 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
291 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
292 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
293 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
294 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
295 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
296 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
297 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
298 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
299 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
300 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
301 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
302 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
303 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
304 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
305 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
306 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
307 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
308 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
309 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
310 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
311 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
312 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
313 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
314 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
315 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
316 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
317 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
318 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
319 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
320 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
321 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
322 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
323 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
324 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
325 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
326 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
327 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
328 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
329 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
330 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
331 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
332 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
333 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
334 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
335 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
336 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
337 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
338 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
339 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
340 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
341 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
342 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
343 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
344 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
345 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
346 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
347 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
348 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
349 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
350 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
351 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
352 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
353 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
354 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
355 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
356 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
357 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
358 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
359 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
360 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
361 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
362 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
363 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
364 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
365 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
366 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
367 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
368 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
369 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
370 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
371 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
372 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
373 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
374 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
375 2932401849 Devosia sp. 2618 Isolate Rhizosphere
376 2937539931 Pantoea sp. LS15 Isolate Unclassified
377 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
378 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
379 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
380 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
381 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
382 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
383 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
384 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
385 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
386 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
387 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
388 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
389 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
390 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
391 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
392 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
393 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
394 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
395 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
396 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
397 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
398 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
399 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
400 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
401 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
402 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
403 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
404 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
405 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
406 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
407 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
408 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
409 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
410 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
411 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
412 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
413 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
414 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
415 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
416 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
417 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
418 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
419 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
420 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
421 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
422 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
423 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
424 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
425 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
426 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
427 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
428 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
429 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
430 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
431 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
432 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
433 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
434 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
435 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
436 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
437 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
438 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
439 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
440 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
441 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
442 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
443 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
444 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
445 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
446 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
447 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
448 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
449 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
450 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
451 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
452 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
453 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
454 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
455 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
456 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
457 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
458 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
459 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
460 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
461 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
462 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
463 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
464 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
465 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
466 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
467 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
468 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
469 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
470 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
471 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
472 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
473 3004167301 Mesorhizobium loti 582 Isolate Unclassified
474 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
475 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
476 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
477 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
478 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
479 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
480 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
481 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
482 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
483 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
484 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
485 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
486 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
487 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
488 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
489 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
490 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
491 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
492 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
493 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
494 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
495 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
496 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
497 8018221730 Enterobacter sp. CM29 Isolate Unclassified
498 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
499 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
500 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
501 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
502 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
503 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
504 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
505 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 49.11
Metatranscriptomes 0
Isolates 50.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0.15
Endosphere 11.31
Nodule 30.51
Rhizoplane 7.74
Rhizosphere 27.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1004068 3300002705 Bacteria 4567
2 JGI25158J39367_1000423 3300002739 Bacteria 8794
3 JGI25158J39367_1006431 3300002739 Bacteria 1682
4 JGI25157J39369_1000879 3300002741 Bacteria 14505
5 JGI25152J39213_1003426 3300002773 Bacteria 5422
6 JGI25150J39212_1001197 3300002774 Bacteria 7688
7 JGI25159J45721_1000563 3300002987 Bacteria 16655
8 JGI25159J45721_1006968 3300002987 Bacteria 3303
9 JGI25151J46595_10003579 3300003187 Bacteria 8518
10 JGI25151J46595_10051658 3300003187 Bacteria 1389
11 JGI25153J46596_10006515 3300003215 Bacteria 5891
12 JGI25153J46596_10007864 3300003215 Bacteria 5175
13 rootH2_10002720 3300003320 Bacteria 4955
14 JGI25160J50197_1000820 3300003354 Bacteria 16655
15 JGI25160J50197_1008401 3300003354 Bacteria 3938
16 JGI25161J50226_1000289 3300003374 Bacteria 28340
17 JGI25161J50226_1004440 3300003374 Bacteria 2935
18 Ga0055542_1001704 3300003762 Bacteria 9531
19 Ga0055526_1001598 3300003771 Bacteria 15895
20 Ga0055526_1004357 3300003771 Bacteria 8548
21 Ga0055524_1002668 3300003775 Bacteria 9035
22 Ga0055536_1001086 3300003781 Bacteria 17117
23 Ga0055528_1018754 3300003790 Bacteria 2330
24 Ga0055530_10012188 3300003791 Bacteria 3017
25 Ga0055540_1009751 3300003792 Bacteria 3277
26 Ga0058692_1000969 3300003856 Bacteria 11289
27 Ga0058692_1017495 3300003856 Bacteria 1572
28 Ga0055543_1000023 3300004625 Bacteria 140513
29 Ga0055543_1000727 3300004625 Bacteria 16693
30 Ga0065165_1002311 3300005262 Bacteria 16693
31 Ga0065165_1014205 3300005262 Bacteria 3106
32 Ga0065704_10000245 3300005289 Bacteria 54286
33 Ga0065704_10001510 3300005289 Bacteria 8367
34 Ga0065704_10005294 3300005289 Bacteria 3190
35 Ga0070659_100037902 3300005366 Bacteria 3759
36 Ga0070707_100308219 3300005468 Bacteria 1539
37 Ga0068853_100011643 3300005539 Bacteria 7149
38 Ga0070665_100000224 3300005548 Bacteria 94266
39 Ga0070665_100235387 3300005548 Bacteria 1832
40 Ga0068857_100001374 3300005577 Bacteria 19191
41 Ga0075365_10020247 3300006038 Bacteria 4121
42 Ga0075365_10027717 3300006038 Bacteria 3607
43 Ga0075363_100040104 3300006048 Bacteria 2467
44 Ga0075363_100204517 3300006048 Bacteria 1129
45 Ga0075364_10001237 3300006051 Bacteria 13698
46 Ga0075364_10003120 3300006051 Bacteria 9376
47 Ga0075364_10064433 3300006051 Bacteria 2405
48 Ga0075370_10044492 3300006353 Bacteria 2510
49 Ga0079104_1000166 3300006946 Bacteria 94027
50 Ga0079104_1000200 3300006946 Bacteria 84123
51 Ga0079104_1000357 3300006946 Bacteria 55345
52 Ga0079104_1000361 3300006946 Bacteria 54642
53 Ga0079104_1000801 3300006946 Bacteria 26565
54 Ga0079104_1000820 3300006946 Bacteria 25957
55 Ga0079104_1005550 3300006946 Bacteria 5015
56 Ga0105251_10000529 3300009011 Bacteria 36039
57 Ga0105251_10006493 3300009011 Bacteria 7436
58 Ga0105251_10020654 3300009011 Bacteria 3457
59 Ga0105251_10020945 3300009011 Bacteria 3424
60 Ga0105251_10022586 3300009011 Bacteria 3263
61 Ga0105251_10035304 3300009011 Bacteria 2468
62 Ga0105251_10058614 3300009011 Bacteria 1818
63 Ga0105251_10123549 3300009011 Bacteria 1175
64 Ga0105244_10000041 3300009036 Bacteria 155525
65 Ga0105244_10000105 3300009036 Bacteria 86528
66 Ga0105244_10000393 3300009036 Bacteria 40595
67 Ga0105244_10001770 3300009036 Bacteria 16977
68 Ga0105244_10002872 3300009036 Bacteria 12752
69 Ga0105244_10014267 3300009036 Bacteria 4601
70 Ga0105244_10059165 3300009036 Bacteria 1932
71 Ga0105250_10000052 3300009092 Bacteria 116382
72 Ga0105250_10000150 3300009092 Bacteria 61428
73 Ga0105250_10002334 3300009092 Bacteria 9604
74 Ga0105250_10013872 3300009092 Bacteria 3319
75 Ga0105250_10070252 3300009092 Bacteria 1414
76 Ga0105240_10298217 3300009093 Bacteria 1845
77 Ga0105241_10118234 3300009174 Bacteria 2131
78 Ga0105237_10120666 3300009545 Bacteria 2616
79 Ga0105238_10258160 3300009551 Bacteria 1722
80 Ga0105239_10012979 3300010375 Bacteria 9268
81 Ga0157373_10153592 3300013100 Bacteria 1619
82 Ga0157371_10009234 3300013102 Bacteria 7779
83 Ga0157370_10010977 3300013104 Bacteria 9502
84 Ga0157369_10037593 3300013105 Bacteria 5300
85 Ga0157369_10107538 3300013105 Bacteria 2967
86 Ga0171463_1016 3300013249 Bacteria 62129
87 Ga0183366_1001 3300015679 Bacteria 2743932
88 Ga0183370_1001 3300015680 Bacteria 2743932
89 Ga0183369_1001 3300015685 Bacteria 2743932
90 Ga0183368_1001 3300015687 Bacteria 2743932
91 Ga0183363_1267 3300015690 Bacteria 8408
92 Ga0209436_100035 3300025208 Bacteria 79010
93 Ga0209436_100712 3300025208 Bacteria 13940
94 Ga0207425_1000968 3300025245 Bacteria 13512
95 Ga0209026_1000141 3300025250 Bacteria 114545
96 Ga0209148_1000111 3300025254 Bacteria 198095
97 Ga0209759_1000354 3300025256 Bacteria 59742
98 Ga0209129_1003607 3300025258 Bacteria 6618
99 Ga0209565_1020783 3300025263 Bacteria 1381
100 Ga0209455_1000206 3300025272 Bacteria 84430
101 Ga0209130_1000031 3300025284 Bacteria 322932
102 Ga0209130_1001334 3300025284 Bacteria 16707
103 Ga0209676_1001434 3300025292 Bacteria 22507
104 Ga0209025_1000121 3300025294 Bacteria 208700
105 Ga0209025_1005690 3300025294 Bacteria 10037
106 Ga0209025_1007351 3300025294 Bacteria 8243
107 Ga0209025_1057570 3300025294 Bacteria 1484
108 Ga0209564_1000081 3300025295 Bacteria 261592
109 Ga0209564_1000826 3300025295 Bacteria 42101
110 Ga0209758_1011158 3300025297 Bacteria 5246
111 Ga0209758_1011779 3300025297 Bacteria 5009
112 Ga0209758_1014158 3300025297 Bacteria 4271
113 Ga0209050_1000852 3300025298 Bacteria 41567
114 Ga0209256_1000639 3300025299 Bacteria 47642
115 Ga0209256_1003364 3300025299 Bacteria 11321
116 Ga0207426_1000042 3300025302 Bacteria 433289
117 Ga0207426_1001728 3300025302 Bacteria 16707
118 Ga0209051_1013148 3300025303 Bacteria 3956
119 Ga0209257_1001851 3300025304 Bacteria 23010
120 Ga0207696_1000003 3300025711 Bacteria 860639
121 Ga0207696_1000007 3300025711 Bacteria 578417
122 Ga0207696_1016740 3300025711 Bacteria 2445
123 Ga0207655_1000001 3300025728 Bacteria 1866413
124 Ga0207655_1000087 3300025728 Bacteria 205876
125 Ga0207655_1000121 3300025728 Bacteria 155535
126 Ga0207655_1000226 3300025728 Bacteria 94688
127 Ga0207655_1000404 3300025728 Bacteria 59563
128 Ga0207655_1004508 3300025728 Bacteria 9852
129 Ga0207655_1013914 3300025728 Bacteria 4584
130 Ga0207655_1082901 3300025728 Bacteria 1151
131 Ga0207713_1000005 3300025735 Bacteria 649958
132 Ga0207713_1000038 3300025735 Bacteria 247609
133 Ga0207713_1000155 3300025735 Bacteria 102677
134 Ga0207713_1020667 3300025735 Bacteria 3181
135 Ga0207713_1076555 3300025735 Bacteria 1217
136 Ga0207713_1083459 3300025735 Bacteria 1142
137 Ga0207684_10509325 3300025910 Bacteria 1031
138 Ga0207671_10056487 3300025914 Bacteria 2909
139 Ga0207681_10110117 3300025923 Bacteria 2002
140 Ga0207694_10193215 3300025924 Bacteria 1654
141 Ga0207690_10021808 3300025932 Bacteria 3977
142 Ga0207706_10260167 3300025933 Bacteria 1515
143 Ga0207709_10007717 3300025935 Bacteria 5966
144 Ga0207709_10027659 3300025935 Bacteria 3270
145 Ga0207648_10301135 3300026089 Bacteria 1438
146 Ga0207674_10000067 3300026116 Bacteria 107803
147 Ga0207674_10208463 3300026116 Bacteria 1904
148 Ga0209281_1000001 3300027111 Bacteria 1933496
149 Ga0209281_1000021 3300027111 Bacteria 541033
150 Ga0209281_1000075 3300027111 Bacteria 267114
151 Ga0209281_1000100 3300027111 Bacteria 223560
152 Ga0209281_1000205 3300027111 Bacteria 133809
153 Ga0209281_1000232 3300027111 Bacteria 117627
154 Ga0209281_1000630 3300027111 Bacteria 39048
155 Ga0209281_1003662 3300027111 Bacteria 4939
156 Ga0209371_1000001 3300027312 Bacteria 2771503
157 Ga0209371_1000334 3300027312 Bacteria 51398
158 Ga0209371_1000744 3300027312 Bacteria 27167
159 Ga0209371_1001192 3300027312 Bacteria 18823
160 Ga0209371_1005365 3300027312 Bacteria 5125
161 Ga0268266_10000165 3300028379 Bacteria 122830
162 Ga0268266_10376663 3300028379 Bacteria 1338
163 Ga0265318_10016718 3300028577 Bacteria 3023
164 Ga0307515_10022779 3300028794 Bacteria 11022
165 Ga0307515_10024806 3300028794 Bacteria 10418
166 Ga0268256_1000001 3300030500 Bacteria 2771065
167 Ga0268256_1000323 3300030500 Bacteria 47340
168 Ga0268256_1000628 3300030500 Bacteria 27263
169 Ga0268256_1001024 3300030500 Bacteria 18823
170 Ga0268256_1005143 3300030500 Bacteria 5206
171 Ga0265325_10003181 3300031241 Bacteria 10801
172 Ga0265340_10030451 3300031247 Bacteria 2704
173 Ga0265331_10034618 3300031250 Bacteria 2490
174 Ga0265316_10015822 3300031344 Bacteria 6573
175 Ga0307513_10003256 3300031456 Bacteria 22138
176 Ga0307513_10024760 3300031456 Bacteria 6977
177 Ga0265313_10000523 3300031595 Bacteria 40161
178 Ga0265313_10009489 3300031595 Bacteria 6313
179 Ga0316579_10092464 3300031691 Bacteria 1445
180 Ga0265314_10053968 3300031711 Bacteria 2784
181 Ga0316578_10022617 3300031728 Bacteria 3508
182 Ga0395899_0047144 3300037312 Bacteria 3209
183 Ga0395900_0000021 3300037418 Bacteria 351144
184 Ga0395900_0096725 3300037418 Bacteria 3034
185 Ga0395898_0002409 3300037466 Bacteria 22197
186 Ga0395905_0000912 3300037471 Bacteria 38176
187 Ga0395905_0025305 3300037471 Bacteria 5597
188 Ga0395901_0014520 3300038443 Bacteria 8009
189 Ga0439438_000798 3300041405 Bacteria 14062
190 Ga0439438_005515 3300041405 Bacteria 4635
191 Ga0439447_001300 3300041407 Bacteria 9089
192 Ga0439465_0057818 3300041413 Bacteria 1280
193 Ga0451853_1811120 3300041512 Bacteria 1716
194 Ga0439432_058161 3300042006 Bacteria 1195
195 Ga0439452_000040 3300042010 Bacteria 143490
196 Ga0439452_000362 3300042010 Bacteria 27827
197 Ga0439452_002414 3300042010 Bacteria 6920
198 Ga0439464_0001188 3300042439 Bacteria 6029
199 Ga0466981_0000011 3300044669 Bacteria 132904
200 Ga0495591_000265 3300046458 Bacteria 49660
201 Ga0495638_0000477 3300046460 Bacteria 48044
202 Ga0495638_0014130 3300046460 Bacteria 5406
203 Ga0495638_0024332 3300046460 Bacteria 3949
204 Ga0495650_0000205 3300046471 Bacteria 128197
205 Ga0495631_0130543 3300046518 Bacteria 1080
206 Ga0495597_0005804 3300046542 Bacteria 6470
207 Ga0495625_0002265 3300046660 Bacteria 21150
208 Ga0495588_0012042 3300046674 Bacteria 4077
209 Ga0495669_0110744 3300046684 Bacteria 1282
210 Ga0495649_0000245 3300046694 Bacteria 47917
211 Ga0495649_0000704 3300046694 Bacteria 27306
212 Ga0495649_0029090 3300046694 Bacteria 3060
213 Ga0495672_0000049 3300047320 Bacteria 240851
214 Ga0495679_000031 3300047446 Bacteria 177838
215 Ga0495673_0001407 3300047469 Bacteria 19306
216 Ga0495686_0000045 3300047472 Bacteria 284761
217 Ga0496100_0015040 3300048903 Bacteria 4512
218 Ga0496101_0060363 3300048904 Bacteria 2751
219 Ga0496104_0000172 3300048907 Bacteria 57392
220 Ga0496104_0178715 3300048907 Bacteria 2032
221 Ga0496105_0043401 3300048908 Bacteria 3708
222 Ga0496106_0000401 3300048909 Bacteria 30792
223 Ga0496112_0015340 3300048915 Bacteria 7145
224 Ga0496115_0241670 3300048918 Bacteria 1488
225 Ga0496116_0000233 3300048919 Bacteria 102081
226 Ga0496116_0000348 3300048919 Bacteria 73391
227 Ga0496116_0000411 3300048919 Bacteria 61137
228 Ga0496116_0014444 3300048919 Bacteria 6304
229 Ga0496116_0028703 3300048919 Bacteria 4024
230 Ga0496116_0049751 3300048919 Bacteria 2798
231 Ga0496116_0146218 3300048919 Bacteria 1321
232 Ga0496117_0000517 3300048920 Bacteria 63669
233 Ga0496117_0001239 3300048920 Bacteria 38198
234 Ga0496117_0001463 3300048920 Bacteria 34016
235 Ga0496117_0004405 3300048920 Bacteria 15574
236 Ga0496117_0161810 3300048920 Bacteria 1310
237 Ga0496118_0000428 3300048921 Bacteria 69913
238 Ga0496118_0005623 3300048921 Bacteria 14153
239 Ga0496118_0036064 3300048921 Bacteria 4004
240 Ga0496118_0081093 3300048921 Bacteria 2280
241 Ga0496118_0207172 3300048921 Bacteria 1154
242 Ga0496119_0001022 3300048922 Bacteria 35853
243 Ga0496119_0001255 3300048922 Bacteria 31535
244 Ga0496119_0002170 3300048922 Bacteria 22027
245 Ga0496119_0002577 3300048922 Bacteria 19706
246 Ga0496119_0013643 3300048922 Bacteria 6448
247 Ga0496119_0013740 3300048922 Bacteria 6415
248 Ga0496119_0071340 3300048922 Bacteria 2033
249 Ga0496119_0080904 3300048922 Bacteria 1872
250 Ga0496120_0000460 3300048923 Bacteria 64148
251 Ga0496120_0001060 3300048923 Bacteria 36350
252 Ga0496120_0002784 3300048923 Bacteria 16971
253 Ga0496120_0025656 3300048923 Bacteria 3654
254 Ga0496120_0031078 3300048923 Bacteria 3238
255 Ga0496120_0039729 3300048923 Bacteria 2773
256 Ga0496121_0001841 3300048924 Bacteria 34183
257 Ga0496121_0002570 3300048924 Bacteria 27471
258 Ga0496121_0003887 3300048924 Bacteria 20766
259 Ga0496121_0004704 3300048924 Bacteria 18072
260 Ga0496121_0007775 3300048924 Bacteria 12839
261 Ga0496121_0012649 3300048924 Bacteria 9166
262 Ga0496121_0019222 3300048924 Bacteria 6842
263 Ga0496121_0082770 3300048924 Bacteria 2536
264 Ga0496121_0193149 3300048924 Bacteria 1458
265 Ga0496122_0000145 3300048925 Bacteria 165864
266 Ga0496122_0001329 3300048925 Bacteria 40484
267 Ga0496122_0001768 3300048925 Bacteria 33133
268 Ga0496122_0008279 3300048925 Bacteria 11277
269 Ga0496122_0012045 3300048925 Bacteria 8670
270 Ga0496122_0095550 3300048925 Bacteria 2008
271 Ga0496123_0000018 3300048926 Bacteria 404553
272 Ga0496123_0000281 3300048926 Bacteria 100416
273 Ga0496123_0009633 3300048926 Bacteria 8670
274 Ga0496123_0010152 3300048926 Bacteria 8360
275 Ga0496123_0016959 3300048926 Bacteria 5882
276 Ga0496123_0144231 3300048926 Bacteria 1296
277 Ga0496124_0000217 3300048927 Bacteria 112197
278 Ga0496124_0000940 3300048927 Bacteria 46669
279 Ga0496124_0002532 3300048927 Bacteria 23723
280 Ga0496124_0007281 3300048927 Bacteria 11802
281 Ga0496124_0034576 3300048927 Bacteria 4434
282 Ga0496124_0048669 3300048927 Bacteria 3620
283 Ga0496124_0049742 3300048927 Bacteria 3574
284 Ga0496125_0000161 3300048928 Bacteria 150707
285 Ga0496125_0000221 3300048928 Bacteria 116650
286 Ga0496125_0000413 3300048928 Bacteria 79797
287 Ga0496125_0001224 3300048928 Bacteria 38466
288 Ga0496125_0013279 3300048928 Bacteria 8102
289 Ga0496125_0014109 3300048928 Bacteria 7801
290 Ga0496126_0000212 3300048929 Bacteria 128871
291 Ga0496126_0000457 3300048929 Bacteria 81283
292 Ga0496126_0001037 3300048929 Bacteria 46997
293 Ga0496126_0001379 3300048929 Bacteria 38417
294 Ga0496126_0048574 3300048929 Bacteria 3876
295 Ga0496126_0058691 3300048929 Bacteria 3468
296 Ga0496126_0103806 3300048929 Bacteria 2483
297 Ga0496126_0114648 3300048929 Bacteria 2344
298 Ga0496126_0180806 3300048929 Bacteria 1791
299 Ga0496126_0215147 3300048929 Bacteria 1616
300 Ga0501034_0066095 3300049571 Bacteria 3629
301 Ga0501036_0151551 3300049572 Bacteria 1956
302 Ga0501046_0074604 3300049580 Bacteria 2632
303 Ga0501047_0009665 3300049581 Bacteria 9116
304 Ga0501067_0029936 3300049583 Bacteria 3018
305 Ga0501069_0036367 3300049585 Bacteria 2715
306 Ga0501073_0011570 3300049589 Bacteria 6453
307 Ga0501074_0008060 3300049590 Bacteria 7630
308 Ga0501080_0011770 3300049742 Bacteria 8019
309 Ga0501083_0008142 3300049744 Bacteria 7417
310 Ga0501083_0037673 3300049744 Bacteria 3292
311 Ga0501035_0262151 3300049822 Bacteria 1465
312 Ga0501044_0014820 3300049823 Bacteria 8404
313 nmdc:mga00v17_103000_c1 3300050491 Bacteria 1804
314 nmdc:mga00v17_17091_c1 3300050491 Bacteria 4097
315 nmdc:mga00v17_3353_c1 3300050491 Bacteria 8266
316 nmdc:mga0yw44_13314_c1 3300050492 Bacteria 4326
317 nmdc:mga0yw44_15035_c1 3300050492 Bacteria 4132
318 nmdc:mga0yw44_86236_c1 3300050492 Bacteria 1977
319 nmdc:mga06z11_131522_c1 3300050494 Bacteria 1406
320 nmdc:mga07m45_102151_c1 3300050496 Bacteria 1647
321 Ga0500610_0072085 3300053079 Bacteria 1801
322 Ga0500644_0007122 3300053088 Bacteria 2899
323 Ga0500568_0000004 3300053139 Bacteria 621666
324 Ga0500616_0070862 3300053153 Bacteria 1778
325 Ga0500616_0077995 3300053153 Bacteria 1672
326 Ga0500622_0000343 3300053156 Bacteria 45668
327 Ga0500622_0004607 3300053156 Bacteria 8558
328 Ga0500636_0001782 3300053177 Bacteria 11796
329 Ga0501084_0013748 3300054114 Bacteria 6698
330 Ga0501082_0001003 3300060353 Bacteria 24930
331 2919124820 2919119836 Bacteria 5208557
332 2503198883 2503198000 Bacteria 6884444
333 2509117911 2508501123 Bacteria 6283661
334 2509368893 2509276018 Bacteria 6910194
335 2509393694 2509276022 Bacteria 6200534
336 2510840239 2510461069 Bacteria 5505000
337 2511137278 2510917022 Bacteria 6504556
338 2511389559 2511231027 Bacteria 5013807
339 2512933722 2512875016 Bacteria 6529530
340 2512961887 2512875024 Bacteria 7195110
341 2514035445 2513237164 Bacteria 7563725
342 2514421957 2513237305 Bacteria 7293571
343 2524452000 2524023207 Bacteria 6813453
344 2555259531 2554235234 Bacteria 5762085
345 2585164362 2582581283 Bacteria 6030556
346 2585222312 2582581298 Bacteria 7315509
347 2585264603 2582581306 Bacteria 6450535
348 2585274105 2582581307 Bacteria 6597605
349 2585389971 2582581865 Bacteria 6644329
350 2585544735 2585427529 Bacteria 7395659
351 2585560555 2585427531 Bacteria 6992870
352 2585898767 2585427608 Bacteria 6544331
353 2585903662 2585427609 Bacteria 6667127
354 2587981219 2585428125 Bacteria 6662905
355 2588519805 2588253730 Bacteria 6881675
356 2599412110 2599185169 Bacteria 5441380
357 2600197115 2599185352 Bacteria 7228948
358 2601525288 2600255254 Bacteria 5281859
359 2601530475 2600255255 Bacteria 5282785
360 2601616921 2600255280 Bacteria 5292309
361 2601621732 2600255281 Bacteria 5288753
362 2601644856 2600255287 Bacteria 5210468
363 2601650544 2600255288 Bacteria 5282738
364 2601655056 2600255289 Bacteria 5281907
365 2601660277 2600255290 Bacteria 5282218
366 2601665174 2600255291 Bacteria 5217298
367 2601697789 2600255298 Bacteria 5215185
368 2601703177 2600255299 Bacteria 5218662
369 2601708124 2600255300 Bacteria 5287774
370 2601713217 2600255301 Bacteria 5280532
371 2601718615 2600255302 Bacteria 5288235
372 2601723338 2600255303 Bacteria 5219315
373 2601728152 2600255304 Bacteria 5283973
374 2601733563 2600255305 Bacteria 5282329
375 2601738136 2600255306 Bacteria 5281613
376 2601742259 2600255307 Bacteria 5439064
377 2601753473 2600255309 Bacteria 5431045
378 2602020140 2600255392 Bacteria 5437392
379 2603643681 2602042047 Bacteria 4697674
380 2603661970 2602042052 Bacteria 5215873
381 2603666868 2602042053 Bacteria 5214361
382 2603700262 2602042066 Bacteria 4423871
383 2603704254 2602042067 Bacteria 4863713
384 2603840676 2602042103 Bacteria 5284714
385 2603845662 2602042104 Bacteria 5281639
386 2603850735 2602042105 Bacteria 5282303
387 2603855893 2602042106 Bacteria 5282744
388 2603866416 2602042109 Bacteria 5152801
389 2603873474 2602042110 Bacteria 5283285
390 2603877476 2602042111 Bacteria 5212080
391 2606050564 2603880178 Bacteria 5283018
392 2606071300 2603880184 Bacteria 5217896
393 2606148248 2603880202 Bacteria 5284684
394 2606178543 2603880211 Bacteria 5284226
395 2637226859 2636415599 Bacteria 5718434
396 2643804838 2643221557 Bacteria 7184309
397 2643853946 2643221568 Bacteria 5187270
398 2644051703 2643221607 Bacteria 6314006
399 2644067377 2643221610 Bacteria 7480339
400 2644104273 2643221618 Bacteria 7717186
401 2644148036 2643221626 Bacteria 8069654
402 2644200187 2643221636 Bacteria 6583769
403 2644206992 2643221637 Bacteria 5345260
404 2644310235 2643221655 Bacteria 7722067
405 2644333441 2643221659 Bacteria 7890716
406 2644378857 2643221668 Bacteria 7306521
407 2644418465 2643221675 Bacteria 7473456
408 2644451832 2643221680 Bacteria 7473610
409 2644480571 2643221686 Bacteria 6310811
410 2644498719 2643221689 Bacteria 6042950
411 2644543711 2643221698 Bacteria 7756764
412 2644616780 2643221712 Bacteria 7729434
413 2644650640 2643221718 Bacteria 5345506
414 2644675180 2643221723 Bacteria 7095460
415 2644691005 2643221726 Bacteria 7455827
416 2671102107 2667528172 Bacteria 5170840
417 2671587953 2671180115 Bacteria 5353919
418 2676406990 2675903046 Bacteria 5451247
419 2681996015 2681812866 Bacteria 4552357
420 2682009034 2681812869 Bacteria 5014465
421 2688596155 2687453392 Bacteria 6880454
422 2692318987 2690316117 Bacteria 6800650
423 2694627712 2693429783 Bacteria 7019804
424 2694636826 2693429784 Bacteria 7241525
425 2723573293 2721755686 Bacteria 7343952
426 2739350913 2738543031 Bacteria 5769731
427 2753459285 2751185821 Bacteria 6189929
428 2753854807 2751185917 Bacteria 4551186
429 2756673552 2756170246 Bacteria 7451806
430 2765587672 2765235842 Bacteria 4799256
431 2775541928 2775506706 Bacteria 4873073
432 2776269682 2775506902 Bacteria 6208009
433 2776282611 2775506904 Bacteria 5954060
434 2776916037 2775507049 Bacteria 6284736
435 2777023656 2775507074 Bacteria 5532402
436 2793281446 2791355253 Bacteria 5171699
437 2821118587 2821118458 Bacteria 4714306
438 2823377212 2823373977 Bacteria 4779415
439 2841736551 2841734538 Bacteria 6784580
440 2842510546 2842509118 Bacteria 6850950
441 2842872624 2842871566 Bacteria 4827117
442 2844003280 2844002411 Bacteria 7168230
443 2844165046 2844163670 Bacteria 7266046
444 2844426360 2844425489 Bacteria 4854065
445 2847090179 2847085930 Bacteria 5070450
446 2847422511 2847417321 Bacteria 6913799
447 2848998080 2848992105 Bacteria 6810864
448 2852390980 2852387548 Bacteria 8025568
449 2855875848 2855872281 Bacteria 6964271
450 2856324070 2856320880 Bacteria 7263508
451 2856329437 2856328259 Bacteria 6528202
452 2856335078 2856334872 Bacteria 7037011
453 2856367388 2856364286 Bacteria 6939991
454 2857353095 2857349434 Bacteria 7926032
455 2857373297 2857367948 Bacteria 6965560
456 2869174244 2869169390 Bacteria 6659796
457 2869239198 2869234852 Bacteria 6654993
458 2869246632 2869242130 Bacteria 6609239
459 2869256581 2869249662 Bacteria 6868783
460 2869257584 2869256925 Bacteria 6981691
461 2869270089 2869264136 Bacteria 6880765
462 2869271629 2869271264 Bacteria 6908218
463 2869282405 2869278585 Bacteria 7077053
464 2869288529 2869285874 Bacteria 6901219
465 2871431196 2871429161 Bacteria 6547891
466 2871443382 2871435913 Bacteria 6880295
467 2871452045 2871451962 Bacteria 7336357
468 2871465275 2871459585 Bacteria 6866887
469 2871473467 2871466892 Bacteria 6923287
470 2871478537 2871474448 Bacteria 6806570
471 2871481545 2871481445 Bacteria 6700002
472 2871498816 2871495908 Bacteria 6935695
473 2874114846 2874109183 Bacteria 6517025
474 2874123514 2874116593 Bacteria 6674494
475 2874126290 2874123672 Bacteria 7238285
476 2874134453 2874131515 Bacteria 6820270
477 2874142764 2874139085 Bacteria 7021506
478 2874150571 2874146452 Bacteria 7533118
479 2874158311 2874155637 Bacteria 6724144
480 2874163669 2874162495 Bacteria 6174670
481 2874170524 2874168670 Bacteria 8062617
482 2876364023 2876363079 Bacteria 6544991
483 2876381400 2876377896 Bacteria 6565995
484 2876392590 2876386047 Bacteria 6698674
485 2876399057 2876392853 Bacteria 6660880
486 2876401118 2876399893 Bacteria 6927900
487 2876407899 2876406927 Bacteria 6191900
488 2876416619 2876413966 Bacteria 6831344
489 2876427223 2876420981 Bacteria 6687741
490 2878734941 2878730984 Bacteria 6380721
491 2878739794 2878738818 Bacteria 7136951
492 2878747800 2878745973 Bacteria 6867388
493 2878763034 2878760144 Bacteria 6823465
494 2878770004 2878767105 Bacteria 6898628
495 2878782814 2878781027 Bacteria 6834456
496 2878792915 2878788777 Bacteria 6567085
497 2881148370 2881147464 Bacteria 7779814
498 2881158316 2881155292 Bacteria 6461656
499 2881165153 2881161766 Bacteria 7127907
500 2882635236 2882632389 Bacteria 8154593
501 2884090189 2884086401 Bacteria 5005459
502 2885307032 2885305155 Bacteria 7348390
503 2885329029 2885326080 Bacteria 7134805
504 2885339784 2885334103 Bacteria 7216818
505 2885349263 2885342637 Bacteria 7011821
506 2885357493 2885350715 Bacteria 6787678
507 2888343547 2888337043 Bacteria 6629336
508 2888353369 2888350351 Bacteria 7372807
509 2889015085 2889010040 Bacteria 6749192
510 2889019840 2889016732 Bacteria 6700763
511 2891376953 2891373044 Bacteria 5202277
512 2903453878 2903448605 Bacteria 7357801
513 2903502281 2903492973 Bacteria 13473544
514 2903521373 2903513507 Bacteria 6344008
515 2903525818 2903521522 Bacteria 6525694
516 2903532636 2903528002 Bacteria 6586099
517 2903543618 2903540706 Bacteria 7062119
518 2904515125 2904513164 Bacteria 5476410
519 2904665584 2904659560 Bacteria 6685615
520 2906310973 2906308376 Bacteria 6841989
521 2906323084 2906321335 Bacteria 6579571
522 2906354912 2906354277 Bacteria 6991324
523 2906366351 2906363423 Bacteria 6856682
524 2906374156 2906370794 Bacteria 6881062
525 2906385749 2906378014 Bacteria 6911440
526 2906391744 2906386501 Bacteria 5977019
527 2906394422 2906393657 Bacteria 6790866
528 2906408993 2906408224 Bacteria 6162342
529 2919102878 2919100787 Bacteria 7710546
530 2919109972 2919108558 Bacteria 5897419
531 2922137749 2922130491 Bacteria 7173936
532 2922153578 2922151315 Bacteria 6902399
533 2922182116 2922178524 Bacteria 6025201
534 2922189398 2922185730 Bacteria 7113964
535 2923638223 2923634449 Bacteria 4753480
536 2924740597 2924733363 Bacteria 7574837
537 2924741754 2924741084 Bacteria 6661321
538 2924753115 2924748358 Bacteria 6154725
539 2924768712 2924762789 Bacteria 6561353
540 2924777415 2924776078 Bacteria 7492003
541 2927835341 2927833300 Bacteria 4923934
542 2932405048 2932401849 Bacteria 4262978
543 2937542781 2937539931 Bacteria 4639830
544 2937815510 2937813078 Bacteria 7783518
545 2937822826 2937822353 Bacteria 7290551
546 2937838874 2937836603 Bacteria 6811263
547 2937852719 2937848649 Bacteria 6983481
548 2937864387 2937861824 Bacteria 6660327
549 2937880434 2937877337 Bacteria 7246526
550 2937975768 2937972304 Bacteria 7532020
551 2937997464 2937994558 Bacteria 7036190
552 2938020422 2938014810 Bacteria 6700592
553 2939570829 2939568625 Bacteria 4542555
554 2939574996 2939573065 Bacteria 4926053
555 2939610886 2939607340 Bacteria 4719256
556 2939644935 2939642701 Bacteria 4475280
557 2939671941 2939669807 Bacteria 5028511
558 2941503968 2941499720 Bacteria 7599444
559 2957444698 2957443900 Bacteria 6869977
560 2958038263 2958034702 Bacteria 6989922
561 2958050989 2958041894 Bacteria 13082850
562 2958072329 2958071322 Bacteria 6815895
563 2958087569 2958084443 Bacteria 7312792
564 2958092469 2958092219 Bacteria 6861151
565 2958105007 2958100919 Bacteria 6800575
566 2958116255 2958115193 Bacteria 6923548
567 2958129573 2958122699 Bacteria 7280457
568 2958132931 2958130278 Bacteria 6897202
569 2958149813 2958144490 Bacteria 6677056
570 2958161390 2958158011 Bacteria 6058449
571 2958167938 2958165035 Bacteria 6906348
572 2958178341 2958172287 Bacteria 6716688
573 2958182633 2958179912 Bacteria 6874908
574 2960621127 2960617483 Bacteria 6727748
575 2960630352 2960624210 Bacteria 6875384
576 2960661413 2960660292 Bacteria 7041660
577 2961080481 2961077736 Bacteria 7079850
578 2961120927 2961114664 Bacteria 6680456
579 2961134275 2961127735 Bacteria 7196641
580 2961166406 2961163497 Bacteria 6901077
581 2961187706 2961183825 Bacteria 6688536
582 2963645481 2963644680 Bacteria 6530403
583 2965021225 2965018300 Bacteria 6883036
584 2965026809 2965025482 Bacteria 6532201
585 2965033245 2965032056 Bacteria 6887443
586 2965046120 2965040258 Bacteria 6855979
587 2965053987 2965047637 Bacteria 6623551
588 2965091077 2965089291 Bacteria 6866420
589 2965109662 2965102966 Bacteria 6800987
590 2965114061 2965110997 Bacteria 6693150
591 2965125536 2965119406 Bacteria 6956431
592 2968017403 2968016561 Bacteria 7022047
593 2968085188 2968083720 Bacteria 7351627
594 2968117077 2968110612 Bacteria 6814636
595 2968122499 2968117919 Bacteria 6536078
596 2968174807 2968171901 Bacteria 6894245
597 2969083842 2969079654 Bacteria 5439582
598 2970472447 2970469710 Bacteria 6969209
599 2970493569 2970489779 Bacteria 6517260
600 2970511147 2970510686 Bacteria 7006402
601 2970536322 2970532167 Bacteria 6553173
602 2970550904 2970547951 Bacteria 6931819
603 2970557889 2970554993 Bacteria 6814252
604 2970597014 2970593180 Bacteria 7073582
605 2970622865 2970619444 Bacteria 6986144
606 2970629596 2970627176 Bacteria 6680862
607 2971825313 2971820967 Bacteria 5823634
608 2974313397 2974310843 Bacteria 4947816
609 2977524913 2977523885 Bacteria 6960446
610 2977846725 2977843712 Bacteria 6753583
611 2977853499 2977851361 Bacteria 6694324
612 2977863577 2977858184 Bacteria 6215359
613 2977869311 2977864932 Bacteria 7534097
614 2977876734 2977872689 Bacteria 7270173
615 2977902951 2977898635 Bacteria 6675551
616 2977924742 2977922695 Bacteria 6956781
617 2977935828 2977935797 Bacteria 6252826
618 2977945555 2977942078 Bacteria 7570577
619 2977952145 2977950692 Bacteria 6893264
620 2977979559 2977971508 Bacteria 7472917
621 2978970098 2978969890 Bacteria 5400756
622 2979715333 2979710463 Bacteria 6785254
623 2979768881 2979764755 Bacteria 6610066
624 2979775665 2979772303 Bacteria 6618277
625 2984560946 2984559226 Bacteria 5683096
626 2984587127 2984587000 Bacteria 5263363
627 2984599020 2984595703 Bacteria 5682994
628 2987641687 2987636660 Bacteria 8088555
629 2987646912 2987645492 Bacteria 6117018
630 2987653928 2987652177 Bacteria 6969023
631 2987662414 2987659509 Bacteria 6966464
632 2987667128 2987666974 Bacteria 6509233
633 2987679619 2987673487 Bacteria 6884027
634 2989353811 2989349275 Bacteria 6349068
635 2996314976 2996310559 Bacteria 6357320
636 2996392779 2996386984 Bacteria 6978667
637 3000137546 3000135777 Bacteria 6891109
638 3002141574 3002141150 Bacteria 5254435
639 3003935661 3003930520 Bacteria 5667563
640 3004173471 3004167301 Bacteria 8330599
641 3004191465 3004188549 Bacteria 6952365
642 3004199175 3004195979 Bacteria 6776956
643 3004209501 3004203850 Bacteria 7307914
644 3004218533 3004211236 Bacteria 7417683
645 3004223621 3004218560 Bacteria 7421728
646 3004238286 3004232784 Bacteria 6662140
647 3004273028 3004268573 Bacteria 7043476
648 3004293641 3004289098 Bacteria 6135450
649 637076834 637000159 Bacteria 7596297
650 643823617 643692032 Bacteria 6891900
651 649870715 649633066 Bacteria 6690028
652 8002287303 8002285264 Bacteria 6717907
653 8004305904 8004300914 Bacteria 6132239
654 8004314950 8004312739 Bacteria 7444653
655 8004368351 8004361976 Bacteria 6858373
656 8004390498 8004387939 Bacteria 7049250
657 8004448770 8004445564 Bacteria 6322258
658 8004638940 8004633249 Bacteria 6723080
659 8004641862 8004640170 Bacteria 6723001
660 8004697187 8004695233 Bacteria 6731676
661 8004704751 8004703790 Bacteria 8006957
662 8004717190 8004714634 Bacteria 6776161
663 8004734610 8004727605 Bacteria 6643904
664 8018223714 8018221730 Bacteria 4616064
665 8018406618 8018405270 Bacteria 4978981
666 8054848569 8054844752 Bacteria 4450330
667 8054850139 8054849141 Bacteria 5232694
668 8055090128 8055087960 Bacteria 4784273
669 8055096380 8055092621 Bacteria 4873875
670 8055101445 8055097453 Bacteria 4865496
671 8055698006 8055693939 Bacteria 4772047
672 8057306373 8057304971 Bacteria 4649742
673 JGI25156J39149_1004068
674 JGI25158J39367_1000423
675 JGI25158J39367_1006431
676 JGI25157J39369_1000879
677 JGI25152J39213_1003426
678 JGI25150J39212_1001197
679 JGI25159J45721_1000563
680 JGI25159J45721_1006968
681 JGI25151J46595_10003579
682 JGI25151J46595_10051658
683 JGI25153J46596_10006515
684 JGI25153J46596_10007864
685 rootH2_10002720
686 JGI25160J50197_1000820
687 JGI25160J50197_1008401
688 JGI25161J50226_1000289
689 JGI25161J50226_1004440
690 Ga0055542_1001704
691 Ga0055526_1001598
692 Ga0055526_1004357
693 Ga0055524_1002668
694 Ga0055536_1001086
695 Ga0055528_1018754
696 Ga0055530_10012188
697 Ga0055540_1009751
698 Ga0058692_1000969
699 Ga0058692_1017495
700 Ga0055543_1000023
701 Ga0055543_1000727
702 Ga0065165_1002311
703 Ga0065165_1014205
704 Ga0065704_10000245
705 Ga0065704_10001510
706 Ga0065704_10005294
707 Ga0070659_100037902
708 Ga0070707_100308219
709 Ga0068853_100011643
710 Ga0070665_100000224
711 Ga0070665_100235387
712 Ga0068857_100001374
713 Ga0075365_10020247
714 Ga0075365_10027717
715 Ga0075363_100040104
716 Ga0075363_100204517
717 Ga0075364_10001237
718 Ga0075364_10003120
719 Ga0075364_10064433
720 Ga0075370_10044492
721 Ga0079104_1000166
722 Ga0079104_1000200
723 Ga0079104_1000357
724 Ga0079104_1000361
725 Ga0079104_1000801
726 Ga0079104_1000820
727 Ga0079104_1005550
728 Ga0105251_10000529
729 Ga0105251_10006493
730 Ga0105251_10020654
731 Ga0105251_10020945
732 Ga0105251_10022586
733 Ga0105251_10035304
734 Ga0105251_10058614
735 Ga0105251_10123549
736 Ga0105244_10000041
737 Ga0105244_10000105
738 Ga0105244_10000393
739 Ga0105244_10001770
740 Ga0105244_10002872
741 Ga0105244_10014267
742 Ga0105244_10059165
743 Ga0105250_10000052
744 Ga0105250_10000150
745 Ga0105250_10002334
746 Ga0105250_10013872
747 Ga0105250_10070252
748 Ga0105240_10298217
749 Ga0105241_10118234
750 Ga0105237_10120666
751 Ga0105238_10258160
752 Ga0105239_10012979
753 Ga0157373_10153592
754 Ga0157371_10009234
755 Ga0157370_10010977
756 Ga0157369_10037593
757 Ga0157369_10107538
758 Ga0171463_1016
759 Ga0183366_1001
760 Ga0183370_1001
761 Ga0183369_1001
762 Ga0183368_1001
763 Ga0183363_1267
764 Ga0209436_100035
765 Ga0209436_100712
766 Ga0207425_1000968
767 Ga0209026_1000141
768 Ga0209148_1000111
769 Ga0209759_1000354
770 Ga0209129_1003607
771 Ga0209565_1020783
772 Ga0209455_1000206
773 Ga0209130_1000031
774 Ga0209130_1001334
775 Ga0209676_1001434
776 Ga0209025_1000121
777 Ga0209025_1005690
778 Ga0209025_1007351
779 Ga0209025_1057570
780 Ga0209564_1000081
781 Ga0209564_1000826
782 Ga0209758_1011158
783 Ga0209758_1011779
784 Ga0209758_1014158
785 Ga0209050_1000852
786 Ga0209256_1000639
787 Ga0209256_1003364
788 Ga0207426_1000042
789 Ga0207426_1001728
790 Ga0209051_1013148
791 Ga0209257_1001851
792 Ga0207696_1000003
793 Ga0207696_1000007
794 Ga0207696_1016740
795 Ga0207655_1000001
796 Ga0207655_1000087
797 Ga0207655_1000121
798 Ga0207655_1000226
799 Ga0207655_1000404
800 Ga0207655_1004508
801 Ga0207655_1013914
802 Ga0207655_1082901
803 Ga0207713_1000005
804 Ga0207713_1000038
805 Ga0207713_1000155
806 Ga0207713_1020667
807 Ga0207713_1076555
808 Ga0207713_1083459
809 Ga0207684_10509325
810 Ga0207671_10056487
811 Ga0207681_10110117
812 Ga0207694_10193215
813 Ga0207690_10021808
814 Ga0207706_10260167
815 Ga0207709_10007717
816 Ga0207709_10027659
817 Ga0207648_10301135
818 Ga0207674_10000067
819 Ga0207674_10208463
820 Ga0209281_1000001
821 Ga0209281_1000021
822 Ga0209281_1000075
823 Ga0209281_1000100
824 Ga0209281_1000205
825 Ga0209281_1000232
826 Ga0209281_1000630
827 Ga0209281_1003662
828 Ga0209371_1000001
829 Ga0209371_1000334
830 Ga0209371_1000744
831 Ga0209371_1001192
832 Ga0209371_1005365
833 Ga0268266_10000165
834 Ga0268266_10376663
835 Ga0265318_10016718
836 Ga0307515_10022779
837 Ga0307515_10024806
838 Ga0268256_1000001
839 Ga0268256_1000323
840 Ga0268256_1000628
841 Ga0268256_1001024
842 Ga0268256_1005143
843 Ga0265325_10003181
844 Ga0265340_10030451
845 Ga0265331_10034618
846 Ga0265316_10015822
847 Ga0307513_10003256
848 Ga0307513_10024760
849 Ga0265313_10000523
850 Ga0265313_10009489
851 Ga0316579_10092464
852 Ga0265314_10053968
853 Ga0316578_10022617
854 Ga0395899_0047144
855 Ga0395900_0000021
856 Ga0395900_0096725
857 Ga0395898_0002409
858 Ga0395905_0000912
859 Ga0395905_0025305
860 Ga0395901_0014520
861 Ga0439438_000798
862 Ga0439438_005515
863 Ga0439447_001300
864 Ga0439465_0057818
865 Ga0451853_1811120
866 Ga0439432_058161
867 Ga0439452_000040
868 Ga0439452_000362
869 Ga0439452_002414
870 Ga0439464_0001188
871 Ga0466981_0000011
872 Ga0495591_000265
873 Ga0495638_0000477
874 Ga0495638_0014130
875 Ga0495638_0024332
876 Ga0495650_0000205
877 Ga0495631_0130543
878 Ga0495597_0005804
879 Ga0495625_0002265
880 Ga0495588_0012042
881 Ga0495669_0110744
882 Ga0495649_0000245
883 Ga0495649_0000704
884 Ga0495649_0029090
885 Ga0495672_0000049
886 Ga0495679_000031
887 Ga0495673_0001407
888 Ga0495686_0000045
889 Ga0496100_0015040
890 Ga0496101_0060363
891 Ga0496104_0000172
892 Ga0496104_0178715
893 Ga0496105_0043401
894 Ga0496106_0000401
895 Ga0496112_0015340
896 Ga0496115_0241670
897 Ga0496116_0000233
898 Ga0496116_0000348
899 Ga0496116_0000411
900 Ga0496116_0014444
901 Ga0496116_0028703
902 Ga0496116_0049751
903 Ga0496116_0146218
904 Ga0496117_0000517
905 Ga0496117_0001239
906 Ga0496117_0001463
907 Ga0496117_0004405
908 Ga0496117_0161810
909 Ga0496118_0000428
910 Ga0496118_0005623
911 Ga0496118_0036064
912 Ga0496118_0081093
913 Ga0496118_0207172
914 Ga0496119_0001022
915 Ga0496119_0001255
916 Ga0496119_0002170
917 Ga0496119_0002577
918 Ga0496119_0013643
919 Ga0496119_0013740
920 Ga0496119_0071340
921 Ga0496119_0080904
922 Ga0496120_0000460
923 Ga0496120_0001060
924 Ga0496120_0002784
925 Ga0496120_0025656
926 Ga0496120_0031078
927 Ga0496120_0039729
928 Ga0496121_0001841
929 Ga0496121_0002570
930 Ga0496121_0003887
931 Ga0496121_0004704
932 Ga0496121_0007775
933 Ga0496121_0012649
934 Ga0496121_0019222
935 Ga0496121_0082770
936 Ga0496121_0193149
937 Ga0496122_0000145
938 Ga0496122_0001329
939 Ga0496122_0001768
940 Ga0496122_0008279
941 Ga0496122_0012045
942 Ga0496122_0095550
943 Ga0496123_0000018
944 Ga0496123_0000281
945 Ga0496123_0009633
946 Ga0496123_0010152
947 Ga0496123_0016959
948 Ga0496123_0144231
949 Ga0496124_0000217
950 Ga0496124_0000940
951 Ga0496124_0002532
952 Ga0496124_0007281
953 Ga0496124_0034576
954 Ga0496124_0048669
955 Ga0496124_0049742
956 Ga0496125_0000161
957 Ga0496125_0000221
958 Ga0496125_0000413
959 Ga0496125_0001224
960 Ga0496125_0013279
961 Ga0496125_0014109
962 Ga0496126_0000212
963 Ga0496126_0000457
964 Ga0496126_0001037
965 Ga0496126_0001379
966 Ga0496126_0048574
967 Ga0496126_0058691
968 Ga0496126_0103806
969 Ga0496126_0114648
970 Ga0496126_0180806
971 Ga0496126_0215147
972 Ga0501034_0066095
973 Ga0501036_0151551
974 Ga0501046_0074604
975 Ga0501047_0009665
976 Ga0501067_0029936
977 Ga0501069_0036367
978 Ga0501073_0011570
979 Ga0501074_0008060
980 Ga0501080_0011770
981 Ga0501083_0008142
982 Ga0501083_0037673
983 Ga0501035_0262151
984 Ga0501044_0014820
985 nmdc:mga00v17_103000_c1
986 nmdc:mga00v17_17091_c1
987 nmdc:mga00v17_3353_c1
988 nmdc:mga0yw44_13314_c1
989 nmdc:mga0yw44_15035_c1
990 nmdc:mga0yw44_86236_c1
991 nmdc:mga06z11_131522_c1
992 nmdc:mga07m45_102151_c1
993 Ga0500610_0072085
994 Ga0500644_0007122
995 Ga0500568_0000004
996 Ga0500616_0070862
997 Ga0500616_0077995
998 Ga0500622_0000343
999 Ga0500622_0004607
1000 Ga0500636_0001782
1001 Ga0501084_0013748
1002 Ga0501082_0001003
1003 2919124820
1004 2503198883
1005 2509117911
1006 2509368893
1007 2509393694
1008 2510840239
1009 2511137278
1010 2511389559
1011 2512933722
1012 2512961887
1013 2514035445
1014 2514421957
1015 2524452000
1016 2555259531
1017 2585164362
1018 2585222312
1019 2585264603
1020 2585274105
1021 2585389971
1022 2585544735
1023 2585560555
1024 2585898767
1025 2585903662
1026 2587981219
1027 2588519805
1028 2599412110
1029 2600197115
1030 2601525288
1031 2601530475
1032 2601616921
1033 2601621732
1034 2601644856
1035 2601650544
1036 2601655056
1037 2601660277
1038 2601665174
1039 2601697789
1040 2601703177
1041 2601708124
1042 2601713217
1043 2601718615
1044 2601723338
1045 2601728152
1046 2601733563
1047 2601738136
1048 2601742259
1049 2601753473
1050 2602020140
1051 2603643681
1052 2603661970
1053 2603666868
1054 2603700262
1055 2603704254
1056 2603840676
1057 2603845662
1058 2603850735
1059 2603855893
1060 2603866416
1061 2603873474
1062 2603877476
1063 2606050564
1064 2606071300
1065 2606148248
1066 2606178543
1067 2637226859
1068 2643804838
1069 2643853946
1070 2644051703
1071 2644067377
1072 2644104273
1073 2644148036
1074 2644200187
1075 2644206992
1076 2644310235
1077 2644333441
1078 2644378857
1079 2644418465
1080 2644451832
1081 2644480571
1082 2644498719
1083 2644543711
1084 2644616780
1085 2644650640
1086 2644675180
1087 2644691005
1088 2671102107
1089 2671587953
1090 2676406990
1091 2681996015
1092 2682009034
1093 2688596155
1094 2692318987
1095 2694627712
1096 2694636826
1097 2723573293
1098 2739350913
1099 2753459285
1100 2753854807
1101 2756673552
1102 2765587672
1103 2775541928
1104 2776269682
1105 2776282611
1106 2776916037
1107 2777023656
1108 2793281446
1109 2821118587
1110 2823377212
1111 2841736551
1112 2842510546
1113 2842872624
1114 2844003280
1115 2844165046
1116 2844426360
1117 2847090179
1118 2847422511
1119 2848998080
1120 2852390980
1121 2855875848
1122 2856324070
1123 2856329437
1124 2856335078
1125 2856367388
1126 2857353095
1127 2857373297
1128 2869174244
1129 2869239198
1130 2869246632
1131 2869256581
1132 2869257584
1133 2869270089
1134 2869271629
1135 2869282405
1136 2869288529
1137 2871431196
1138 2871443382
1139 2871452045
1140 2871465275
1141 2871473467
1142 2871478537
1143 2871481545
1144 2871498816
1145 2874114846
1146 2874123514
1147 2874126290
1148 2874134453
1149 2874142764
1150 2874150571
1151 2874158311
1152 2874163669
1153 2874170524
1154 2876364023
1155 2876381400
1156 2876392590
1157 2876399057
1158 2876401118
1159 2876407899
1160 2876416619
1161 2876427223
1162 2878734941
1163 2878739794
1164 2878747800
1165 2878763034
1166 2878770004
1167 2878782814
1168 2878792915
1169 2881148370
1170 2881158316
1171 2881165153
1172 2882635236
1173 2884090189
1174 2885307032
1175 2885329029
1176 2885339784
1177 2885349263
1178 2885357493
1179 2888343547
1180 2888353369
1181 2889015085
1182 2889019840
1183 2891376953
1184 2903453878
1185 2903502281
1186 2903521373
1187 2903525818
1188 2903532636
1189 2903543618
1190 2904515125
1191 2904665584
1192 2906310973
1193 2906323084
1194 2906354912
1195 2906366351
1196 2906374156
1197 2906385749
1198 2906391744
1199 2906394422
1200 2906408993
1201 2919102878
1202 2919109972
1203 2922137749
1204 2922153578
1205 2922182116
1206 2922189398
1207 2923638223
1208 2924740597
1209 2924741754
1210 2924753115
1211 2924768712
1212 2924777415
1213 2927835341
1214 2932405048
1215 2937542781
1216 2937815510
1217 2937822826
1218 2937838874
1219 2937852719
1220 2937864387
1221 2937880434
1222 2937975768
1223 2937997464
1224 2938020422
1225 2939570829
1226 2939574996
1227 2939610886
1228 2939644935
1229 2939671941
1230 2941503968
1231 2957444698
1232 2958038263
1233 2958050989
1234 2958072329
1235 2958087569
1236 2958092469
1237 2958105007
1238 2958116255
1239 2958129573
1240 2958132931
1241 2958149813
1242 2958161390
1243 2958167938
1244 2958178341
1245 2958182633
1246 2960621127
1247 2960630352
1248 2960661413
1249 2961080481
1250 2961120927
1251 2961134275
1252 2961166406
1253 2961187706
1254 2963645481
1255 2965021225
1256 2965026809
1257 2965033245
1258 2965046120
1259 2965053987
1260 2965091077
1261 2965109662
1262 2965114061
1263 2965125536
1264 2968017403
1265 2968085188
1266 2968117077
1267 2968122499
1268 2968174807
1269 2969083842
1270 2970472447
1271 2970493569
1272 2970511147
1273 2970536322
1274 2970550904
1275 2970557889
1276 2970597014
1277 2970622865
1278 2970629596
1279 2971825313
1280 2974313397
1281 2977524913
1282 2977846725
1283 2977853499
1284 2977863577
1285 2977869311
1286 2977876734
1287 2977902951
1288 2977924742
1289 2977935828
1290 2977945555
1291 2977952145
1292 2977979559
1293 2978970098
1294 2979715333
1295 2979768881
1296 2979775665
1297 2984560946
1298 2984587127
1299 2984599020
1300 2987641687
1301 2987646912
1302 2987653928
1303 2987662414
1304 2987667128
1305 2987679619
1306 2989353811
1307 2996314976
1308 2996392779
1309 3000137546
1310 3002141574
1311 3003935661
1312 3004173471
1313 3004191465
1314 3004199175
1315 3004209501
1316 3004218533
1317 3004223621
1318 3004238286
1319 3004273028
1320 3004293641
1321 637076834
1322 643823617
1323 649870715
1324 8002287303
1325 8004305904
1326 8004314950
1327 8004368351
1328 8004390498
1329 8004448770
1330 8004638940
1331 8004641862
1332 8004697187
1333 8004704751
1334 8004717190
1335 8004734610
1336 8018223714
1337 8018406618
1338 8054848569
1339 8054850139
1340 8055090128
1341 8055096380
1342 8055101445
1343 8055698006
1344 8057306373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

48

245

0.91

PF02254

TrkA_N

TrkA-N domain

310

373

0.9

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

25

256

0.87

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

46

241

0.87

PF13379

NMT1_2

NMT1-like family

19

252

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6st1-assembly2.cif.gz_B taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) 0.9736 18 317
6st1-assembly2.cif.gz_B taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) 0.9672 18 317
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8483 19 314
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.835 14 317
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8294 18 320
ID Description Score Start End Superfamily
af_Q47537_124_320_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9635 122 318 3.40.190.10
af_Q47537_124_320_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9492 122 318 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9324 98 189 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8721 101 192 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8537 98 189 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A530BGF1-F1-model_v4 Taurine ABC transporter substrate-binding protein 0.9885 156 325 GO:0022857
GO:0042918
GO:0043190
AF-A0A530BGF1-F1-model_v4 Taurine ABC transporter substrate-binding protein 0.9827 156 325 GO:0022857
GO:0042918
GO:0043190
AF-A0A013RS58-F1-model_v4 deleted 0.9803 10 318
AF-A0A062IQY5-F1-model_v4 Taurine ABC transporter, periplasmic binding protein 0.9722 10 272 GO:0022857
GO:0042597
GO:0042918
GO:0043190
AF-A0A0J8YK14-F1-model_v4 Taurine ABC transporter substrate-binding protein 0.9708 8 322 GO:0022857
GO:0042597
GO:0042918
GO:0043190

Map