F474274

General Info

Members Datasets Scaffolds Average Seq Length
673 322 1346 231

Family's Representative Sequence

Representative Sequence 3300001904|JGI24736J21556_1000668|JGI24736J21556_10006682
Length 269
Sequence MHAPNLTPFGMKGVDASASGGCPVAKEPSPLALRARSLRSALRAEGGSHEPGHLPLLVRHLGRQLYEPVWHAMQAFTDARGPDTPDELWLVEHDPVFTLGQAGKPEHVLAAGDIPVIHVDRGGQVTYHGPGQIVAYPLLDLRRLKIGVRELVRRIEQSIIDTLAEWNIVAARREGAPGVYAGEAKIAALGLRVRHGCTFHGLAFNVAMDLEPFHRINPCGYAGLQVAQMLDLGGPSRLADVEEVLVAELGRQFGLSPQDAEPALPRAAA

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
176 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
177 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
180 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
181 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
193 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
194 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
195 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
196 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
197 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
198 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
199 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
200 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
203 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
204 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
205 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
206 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
207 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
208 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
226 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
284 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
290 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
291 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
292 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
293 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
297 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
298 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
299 2643221573 Lysobacter sp. Root604 Isolate Unclassified
300 2643221593 Lysobacter sp. Root690 Isolate Unclassified
301 2643221720 Lysobacter sp. Root916 Isolate Unclassified
302 2643221728 Lysobacter sp. Root983 Isolate Unclassified
303 2734482264 Dyella sp. AD052 Isolate Unclassified
304 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
305 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
306 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
307 2818991457 Xanthomonas translucens 569 Isolate Unclassified
308 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
309 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
310 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
311 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
312 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
313 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
314 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
315 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
316 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
317 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
318 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
319 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
320 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
321 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
322 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.39
Metatranscriptomes 0.74
Isolates 3.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 9.51
Nodule 0.15
Rhizoplane 2.67
Rhizosphere 79.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000668 3300001904 Bacteria 6283
2 SwRhRL2b_contig_1900888 2162886007 Bacteria 7548
3 JGI24741J21665_1000513 3300001915 Bacteria 11829
4 JGI24740J21852_10000733 3300001979 Bacteria 14284
5 JGI24740J21852_10001041 3300001979 Bacteria 12448
6 JGI25157J39369_1005706 3300002741 Bacteria 1985
7 JGI25151J46595_10000102 3300003187 Bacteria 114881
8 rootH1_10132375 3300003323 Bacteria 1213
9 Ga0055539_1001541 3300003752 Bacteria 4192
10 Ga0055533_1000809 3300003756 Bacteria 9692
11 Ga0055525_1000138 3300003759 Bacteria 104087
12 Ga0055527_1000281 3300003760 Bacteria 30006
13 Ga0055527_1000330 3300003760 Bacteria 25414
14 Ga0055535_1000843 3300003761 Bacteria 21891
15 Ga0055542_1000835 3300003762 Bacteria 21895
16 Ga0055542_1001160 3300003762 Bacteria 15324
17 Ga0055529_1000717 3300003763 Bacteria 21895
18 Ga0055529_1000943 3300003763 Bacteria 15407
19 Ga0055526_1006479 3300003771 Bacteria 6343
20 Ga0055537_1000059 3300003773 Bacteria 79628
21 Ga0055537_1001365 3300003773 Bacteria 9847
22 Ga0055524_1000019 3300003775 Bacteria 233561
23 Ga0055536_1018818 3300003781 Bacteria 2197
24 Ga0055534_1000012 3300003784 Bacteria 153530
25 Ga0055534_1000112 3300003784 Bacteria 59920
26 Ga0055528_1000007 3300003790 Bacteria 233327
27 Ga0055528_1001337 3300003790 Bacteria 15339
28 Ga0055530_10001674 3300003791 Bacteria 15731
29 Ga0055530_10002094 3300003791 Bacteria 13328
30 Ga0055531_10013881 3300003794 Bacteria 3678
31 Ga0055531_10024818 3300003794 Bacteria 2197
32 Ga0055531_10025507 3300003794 Bacteria 2143
33 Ga0058861_11997967 3300004800 Bacteria 3815
34 Ga0065714_10073865 3300005288 Bacteria 3115
35 Ga0065715_10008446 3300005293 Bacteria 3910
36 Ga0065715_10210857 3300005293 Bacteria 1310
37 Ga0070658_10025096 3300005327 Bacteria 4778
38 Ga0070683_100148995 3300005329 Bacteria 2218
39 Ga0070670_100001962 3300005331 Bacteria 16837
40 Ga0070670_100510566 3300005331 Bacteria 1070
41 Ga0070666_10267594 3300005335 Bacteria 1213
42 Ga0070680_100004327 3300005336 Bacteria 10676
43 Ga0070682_100013741 3300005337 Bacteria 4667
44 Ga0068868_100319978 3300005338 Bacteria 1321
45 Ga0070691_10146967 3300005341 Bacteria 1206
46 Ga0070691_10230441 3300005341 Bacteria 985
47 Ga0070661_100009383 3300005344 Bacteria 6771
48 Ga0070661_100063255 3300005344 Bacteria 2717
49 Ga0070661_100122479 3300005344 Bacteria 1948
50 Ga0070692_10014304 3300005345 Bacteria 3723
51 Ga0070692_10150891 3300005345 Bacteria 1323
52 Ga0070669_100064482 3300005353 Bacteria 2698
53 Ga0070675_100043947 3300005354 Bacteria 3654
54 Ga0070671_100045193 3300005355 Bacteria 3661
55 Ga0070671_100069039 3300005355 Bacteria 2947
56 Ga0070673_100408221 3300005364 Bacteria 1216
57 Ga0070659_100187046 3300005366 Bacteria 1701
58 Ga0070667_100005400 3300005367 Bacteria 10674
59 Ga0070667_100041398 3300005367 Bacteria 3865
60 Ga0070667_100050689 3300005367 Bacteria 3499
61 Ga0070667_100121267 3300005367 Bacteria 2274
62 Ga0070667_100187140 3300005367 Bacteria 1833
63 Ga0070663_100000042 3300005455 Bacteria 57899
64 Ga0070663_100060983 3300005455 Bacteria 2715
65 Ga0070663_100136117 3300005455 Bacteria 1870
66 Ga0070663_100216615 3300005455 Bacteria 1501
67 Ga0070662_100014495 3300005457 Bacteria 5270
68 Ga0070662_100041992 3300005457 Bacteria 3265
69 Ga0070681_10001872 3300005458 Bacteria 18988
70 Ga0070681_10009167 3300005458 Bacteria 9724
71 Ga0070681_10177415 3300005458 Bacteria 2052
72 Ga0070681_10191941 3300005458 Bacteria 1962
73 Ga0070681_10300998 3300005458 Bacteria 1513
74 Ga0070681_10754860 3300005458 Bacteria 889
75 Ga0070679_100004396 3300005530 Bacteria 13033
76 Ga0070679_100164520 3300005530 Bacteria 2192
77 Ga0070679_100819986 3300005530 Bacteria 873
78 Ga0070684_100024537 3300005535 Bacteria 5060
79 Ga0070684_100048363 3300005535 Bacteria 3690
80 Ga0070684_100152602 3300005535 Bacteria 2093
81 Ga0070684_100585753 3300005535 Bacteria 1037
82 Ga0068853_100004195 3300005539 Bacteria 11116
83 Ga0068853_100007213 3300005539 Bacteria 8902
84 Ga0068853_100011114 3300005539 Bacteria 7303
85 Ga0068853_100020141 3300005539 Bacteria 5545
86 Ga0068853_100028892 3300005539 Bacteria 4668
87 Ga0068853_100033305 3300005539 Bacteria 4371
88 Ga0068853_100047267 3300005539 Bacteria 3692
89 Ga0070672_100003657 3300005543 Bacteria 9989
90 Ga0070686_100167171 3300005544 Bacteria 1553
91 Ga0070696_100002079 3300005546 Bacteria 13147
92 Ga0070693_100005032 3300005547 Bacteria 6313
93 Ga0070693_100012299 3300005547 Bacteria 4328
94 Ga0070693_100025853 3300005547 Bacteria 3162
95 Ga0070665_100000028 3300005548 Bacteria 351357
96 Ga0070665_100008261 3300005548 Bacteria 10529
97 Ga0070665_100027661 3300005548 Bacteria 5710
98 Ga0070665_100050597 3300005548 Bacteria 4169
99 Ga0070665_100084459 3300005548 Bacteria 3180
100 Ga0070665_100168154 3300005548 Bacteria 2194
101 Ga0070665_100219067 3300005548 Bacteria 1904
102 Ga0070665_100412820 3300005548 Bacteria 1358
103 Ga0070665_100832480 3300005548 Bacteria 936
104 Ga0068855_100005951 3300005563 Bacteria 14870
105 Ga0068855_100105650 3300005563 Bacteria 3237
106 Ga0068855_100171818 3300005563 Bacteria 2454
107 Ga0068855_100384484 3300005563 Bacteria 1540
108 Ga0068855_100400853 3300005563 Bacteria 1503
109 Ga0068855_100640412 3300005563 Bacteria 1143
110 Ga0070664_100023351 3300005564 Bacteria 5107
111 Ga0070664_100203877 3300005564 Bacteria 1766
112 Ga0068857_100053558 3300005577 Bacteria 3579
113 Ga0068857_100182944 3300005577 Bacteria 1907
114 Ga0068857_100358917 3300005577 Bacteria 1351
115 Ga0068854_100004688 3300005578 Bacteria 8616
116 Ga0068854_100024611 3300005578 Bacteria 4125
117 Ga0068854_100053357 3300005578 Bacteria 2903
118 Ga0068854_100070907 3300005578 Bacteria 2547
119 Ga0068854_100080020 3300005578 Bacteria 2411
120 Ga0068854_100542130 3300005578 Bacteria 985
121 Ga0068854_100546565 3300005578 Bacteria 982
122 Ga0068856_100012643 3300005614 Bacteria 8173
123 Ga0068856_100161736 3300005614 Bacteria 2249
124 Ga0068856_100406692 3300005614 Bacteria 1381
125 Ga0068856_100452062 3300005614 Bacteria 1305
126 Ga0068852_100005973 3300005616 Bacteria 8769
127 Ga0068852_100068716 3300005616 Bacteria 3102
128 Ga0068852_100082660 3300005616 Bacteria 2854
129 Ga0068852_100212373 3300005616 Bacteria 1836
130 Ga0068852_100345615 3300005616 Bacteria 1451
131 Ga0068852_100348820 3300005616 Bacteria 1445
132 Ga0068859_100000280 3300005617 Bacteria 50848
133 Ga0068851_10011937 3300005834 Bacteria 4084
134 Ga0068851_10027186 3300005834 Bacteria 2818
135 Ga0068851_10035589 3300005834 Bacteria 2489
136 Ga0068870_10057938 3300005840 Bacteria 2073
137 Ga0068863_100018882 3300005841 Bacteria 6597
138 Ga0068863_100066084 3300005841 Bacteria 3421
139 Ga0068863_100077761 3300005841 Bacteria 3140
140 Ga0068863_100240960 3300005841 Bacteria 1745
141 Ga0068860_100124956 3300005843 Bacteria 2466
142 Ga0068862_100000215 3300005844 Bacteria 64251
143 Ga0068862_100111847 3300005844 Bacteria 2398
144 Ga0081539_10008186 3300005985 Bacteria 9212
145 Ga0097621_100206800 3300006237 Bacteria 1706
146 Ga0068871_100039983 3300006358 Bacteria 3755
147 Ga0068871_100199111 3300006358 Bacteria 1728
148 Ga0068871_100215267 3300006358 Bacteria 1663
149 Ga0068865_100017143 3300006881 Bacteria 4652
150 Ga0068865_100053746 3300006881 Bacteria 2795
151 Ga0097620_100000280 3300006931 Bacteria 50848
152 Ga0105251_10000205 3300009011 Bacteria 59437
153 Ga0105240_10087720 3300009093 Bacteria 3809
154 Ga0105240_10103888 3300009093 Bacteria 3451
155 Ga0105240_10152371 3300009093 Bacteria 2752
156 Ga0105245_10723360 3300009098 Bacteria 1030
157 Ga0105247_10124470 3300009101 Bacteria 1674
158 Ga0105241_10017637 3300009174 Bacteria 5249
159 Ga0105241_10055846 3300009174 Bacteria 3026
160 Ga0105241_10103439 3300009174 Bacteria 2268
161 Ga0105242_10675965 3300009176 Bacteria 1007
162 Ga0105248_10000120 3300009177 Bacteria 89960
163 Ga0105248_10309656 3300009177 Bacteria 1778
164 Ga0105237_10010356 3300009545 Bacteria 9929
165 Ga0105237_10618370 3300009545 Bacteria 1090
166 Ga0105238_10006626 3300009551 Bacteria 11543
167 Ga0105238_10011965 3300009551 Bacteria 8742
168 Ga0105238_10110821 3300009551 Bacteria 2725
169 Ga0105238_10192207 3300009551 Bacteria 2017
170 Ga0105249_10000898 3300009553 Bacteria 26273
171 Ga0105249_11264596 3300009553 Bacteria 809
172 Ga0105239_10005391 3300010375 Bacteria 15027
173 Ga0105239_10033812 3300010375 Bacteria 5613
174 Ga0105239_10107680 3300010375 Bacteria 3088
175 Ga0157373_10012798 3300013100 Bacteria 6163
176 Ga0157373_10042694 3300013100 Bacteria 3240
177 Ga0157373_10055024 3300013100 Bacteria 2827
178 Ga0157373_10084294 3300013100 Bacteria 2240
179 Ga0157371_10057507 3300013102 Bacteria 2758
180 Ga0157371_10190065 3300013102 Bacteria 1470
181 Ga0157370_10033604 3300013104 Bacteria 5000
182 Ga0157370_10144952 3300013104 Bacteria 2212
183 Ga0157370_10663632 3300013104 Bacteria 953
184 Ga0157369_10002250 3300013105 Bacteria 23203
185 Ga0157369_10024352 3300013105 Bacteria 6735
186 Ga0157369_10383664 3300013105 Bacteria 1458
187 Ga0157374_10158927 3300013296 Bacteria 2201
188 Ga0157374_10625115 3300013296 Bacteria 1088
189 Ga0157378_10000536 3300013297 Bacteria 36043
190 Ga0163162_10028377 3300013306 Bacteria 5537
191 Ga0163162_11402870 3300013306 Bacteria 795
192 Ga0157372_10000344 3300013307 Bacteria 51217
193 Ga0157372_10013581 3300013307 Bacteria 8705
194 Ga0157372_10036173 3300013307 Bacteria 5442
195 Ga0157372_10037458 3300013307 Bacteria 5350
196 Ga0157372_10051825 3300013307 Bacteria 4568
197 Ga0157372_10057810 3300013307 Bacteria 4336
198 Ga0157372_10586568 3300013307 Bacteria 1299
199 Ga0157375_10584129 3300013308 Bacteria 1277
200 Ga0163163_10000029 3300014325 Bacteria 174973
201 Ga0163163_10672312 3300014325 Bacteria 1099
202 Ga0182008_10020566 3300014497 Bacteria 3397
203 Ga0182008_10029210 3300014497 Bacteria 2787
204 Ga0157379_10001942 3300014968 Bacteria 17106
205 Ga0157376_10002494 3300014969 Bacteria 12460
206 Ga0157376_10005280 3300014969 Bacteria 9025
207 Ga0182006_1053246 3300015261 Bacteria 1552
208 Ga0182005_1002582 3300015265 Bacteria 6416
209 Ga0163161_10073490 3300017792 Bacteria 2506
210 Ga0206356_10496513 3300020070 Bacteria 3064
211 Ga0206356_11576430 3300020070 Bacteria 2668
212 Ga0206353_10732351 3300020082 Bacteria 1349
213 Ga0224712_10096835 3300022467 Bacteria 1245
214 Ga0209674_100149 3300025226 Bacteria 97879
215 Ga0209672_100004 3300025228 Bacteria 1467504
216 Ga0209672_100008 3300025228 Bacteria 946876
217 Ga0209563_100036 3300025230 Bacteria 448275
218 Ga0209258_100003 3300025242 Bacteria 1467504
219 Ga0209258_100004 3300025242 Bacteria 1376422
220 Ga0209258_100008 3300025242 Bacteria 1009355
221 Ga0207425_1010986 3300025245 Bacteria 2182
222 Ga0209026_1000045 3300025250 Bacteria 263431
223 Ga0209677_100974 3300025253 Bacteria 13904
224 Ga0209148_1000025 3300025254 Bacteria 663262
225 Ga0209148_1000053 3300025254 Bacteria 373506
226 Ga0209759_1000850 3300025256 Bacteria 23820
227 Ga0209565_1000001 3300025263 Bacteria 2950419
228 Ga0209565_1000060 3300025263 Bacteria 188543
229 Ga0209455_1000004 3300025272 Bacteria 1467504
230 Ga0209455_1000007 3300025272 Bacteria 1157983
231 Ga0209673_1000001 3300025273 Bacteria 3176258
232 Ga0209673_1000047 3300025273 Bacteria 289276
233 Ga0209130_1014021 3300025284 Bacteria 2029
234 Ga0209675_1000001 3300025291 Bacteria 2950293
235 Ga0209675_1000007 3300025291 Bacteria 683430
236 Ga0209676_1000052 3300025292 Bacteria 371539
237 Ga0209025_1000006 3300025294 Bacteria 1153444
238 Ga0209564_1000001 3300025295 Bacteria 3176258
239 Ga0209564_1000252 3300025295 Bacteria 114416
240 Ga0209758_1006577 3300025297 Bacteria 8257
241 Ga0209050_1000146 3300025298 Bacteria 166930
242 Ga0209256_1000006 3300025299 Bacteria 1250310
243 Ga0209256_1005932 3300025299 Bacteria 6743
244 Ga0209051_1005721 3300025303 Bacteria 7179
245 Ga0209257_1010878 3300025304 Bacteria 4500
246 Ga0207656_10003660 3300025321 Bacteria 5313
247 Ga0207656_10021120 3300025321 Bacteria 2597
248 Ga0207713_1000196 3300025735 Bacteria 84000
249 Ga0207682_10063268 3300025893 Bacteria 1553
250 Ga0207710_10054171 3300025900 Bacteria 1806
251 Ga0207688_10169944 3300025901 Bacteria 1296
252 Ga0207680_10139401 3300025903 Bacteria 1606
253 Ga0207680_10180954 3300025903 Bacteria 1425
254 Ga0207680_10323227 3300025903 Bacteria 1079
255 Ga0207647_10000826 3300025904 Bacteria 24065
256 Ga0207647_10001336 3300025904 Bacteria 18958
257 Ga0207647_10003112 3300025904 Bacteria 12460
258 Ga0207647_10138743 3300025904 Bacteria 1425
259 Ga0207645_10026306 3300025907 Bacteria 3761
260 Ga0207645_10106425 3300025907 Bacteria 1813
261 Ga0207643_10041259 3300025908 Bacteria 2600
262 Ga0207705_10000097 3300025909 Bacteria 105579
263 Ga0207705_10000341 3300025909 Bacteria 42108
264 Ga0207705_10000630 3300025909 Bacteria 29454
265 Ga0207705_10002108 3300025909 Bacteria 15463
266 Ga0207654_10000458 3300025911 Bacteria 23295
267 Ga0207654_10031408 3300025911 Bacteria 2924
268 Ga0207654_10063425 3300025911 Bacteria 2169
269 Ga0207707_10000065 3300025912 Bacteria 106546
270 Ga0207707_10000084 3300025912 Bacteria 95228
271 Ga0207707_10000578 3300025912 Bacteria 37213
272 Ga0207707_10001112 3300025912 Bacteria 25518
273 Ga0207707_10002407 3300025912 Bacteria 16839
274 Ga0207707_10054364 3300025912 Bacteria 3485
275 Ga0207695_10000772 3300025913 Bacteria 60706
276 Ga0207695_10002496 3300025913 Bacteria 27107
277 Ga0207695_10006652 3300025913 Bacteria 14917
278 Ga0207695_10015003 3300025913 Bacteria 9141
279 Ga0207695_10595887 3300025913 Bacteria 986
280 Ga0207671_10007551 3300025914 Bacteria 9414
281 Ga0207671_10088892 3300025914 Bacteria 2324
282 Ga0207671_10143283 3300025914 Bacteria 1842
283 Ga0207671_10249251 3300025914 Bacteria 1396
284 Ga0207660_10005551 3300025917 Bacteria 8192
285 Ga0207660_10006903 3300025917 Bacteria 7349
286 Ga0207660_10010377 3300025917 Bacteria 6043
287 Ga0207660_10011546 3300025917 Bacteria 5755
288 Ga0207660_10184679 3300025917 Bacteria 1621
289 Ga0207657_10002465 3300025919 Bacteria 20016
290 Ga0207657_10006390 3300025919 Bacteria 12239
291 Ga0207657_10007147 3300025919 Bacteria 11466
292 Ga0207657_10256498 3300025919 Bacteria 1392
293 Ga0207657_10483215 3300025919 Bacteria 971
294 Ga0207649_10004292 3300025920 Bacteria 7757
295 Ga0207649_10006309 3300025920 Bacteria 6443
296 Ga0207649_10385596 3300025920 Bacteria 1045
297 Ga0207649_10409040 3300025920 Bacteria 1017
298 Ga0207649_10705864 3300025920 Bacteria 782
299 Ga0207652_10000014 3300025921 Bacteria 196569
300 Ga0207652_10000076 3300025921 Bacteria 107686
301 Ga0207652_10002969 3300025921 Bacteria 14173
302 Ga0207652_10069249 3300025921 Bacteria 3063
303 Ga0207652_10378129 3300025921 Bacteria 1278
304 Ga0207652_10490868 3300025921 Bacteria 1106
305 Ga0207681_10056764 3300025923 Bacteria 2672
306 Ga0207694_10006803 3300025924 Bacteria 8679
307 Ga0207694_10012929 3300025924 Bacteria 6287
308 Ga0207650_10001926 3300025925 Bacteria 14613
309 Ga0207650_10328626 3300025925 Bacteria 1254
310 Ga0207687_10484561 3300025927 Bacteria 1030
311 Ga0207700_10513190 3300025928 Bacteria 1061
312 Ga0207644_10017204 3300025931 Bacteria 4877
313 Ga0207644_10257288 3300025931 Bacteria 1395
314 Ga0207690_10000122 3300025932 Bacteria 64448
315 Ga0207690_10003069 3300025932 Bacteria 10060
316 Ga0207690_10819681 3300025932 Bacteria 770
317 Ga0207706_10003801 3300025933 Bacteria 14393
318 Ga0207706_10316978 3300025933 Bacteria 1357
319 Ga0207706_10795698 3300025933 Bacteria 803
320 Ga0207691_10009099 3300025940 Bacteria 9532
321 Ga0207691_10019067 3300025940 Bacteria 6495
322 Ga0207711_10010606 3300025941 Bacteria 7662
323 Ga0207689_10034224 3300025942 Bacteria 4219
324 Ga0207661_10007040 3300025944 Bacteria 7981
325 Ga0207661_10071965 3300025944 Bacteria 2828
326 Ga0207661_10113455 3300025944 Bacteria 2296
327 Ga0207661_10266777 3300025944 Bacteria 1527
328 Ga0207661_10289978 3300025944 Bacteria 1464
329 Ga0207679_10026576 3300025945 Bacteria 3993
330 Ga0207667_10000623 3300025949 Bacteria 45814
331 Ga0207667_10000683 3300025949 Bacteria 43994
332 Ga0207667_10008297 3300025949 Bacteria 12358
333 Ga0207667_10019912 3300025949 Bacteria 7477
334 Ga0207667_10038594 3300025949 Bacteria 5098
335 Ga0207667_10049542 3300025949 Bacteria 4436
336 Ga0207651_10070326 3300025960 Bacteria 2476
337 Ga0207712_10000305 3300025961 Bacteria 45213
338 Ga0207712_10024220 3300025961 Bacteria 4017
339 Ga0207668_10017413 3300025972 Bacteria 4502
340 Ga0207668_10290936 3300025972 Bacteria 1344
341 Ga0207640_10000362 3300025981 Bacteria 29479
342 Ga0207640_10002592 3300025981 Bacteria 9682
343 Ga0207640_10003436 3300025981 Bacteria 8533
344 Ga0207640_10022848 3300025981 Bacteria 3750
345 Ga0207640_10053751 3300025981 Bacteria 2630
346 Ga0207640_10062553 3300025981 Bacteria 2470
347 Ga0207640_10135130 3300025981 Bacteria 1789
348 Ga0207658_10000033 3300025986 Bacteria 158540
349 Ga0207658_10009244 3300025986 Bacteria 6684
350 Ga0207658_10513082 3300025986 Bacteria 1069
351 Ga0207658_10805041 3300025986 Bacteria 853
352 Ga0207677_10008057 3300026023 Bacteria 5868
353 Ga0207703_10202544 3300026035 Bacteria 1764
354 Ga0207639_10000437 3300026041 Bacteria 28831
355 Ga0207639_10000514 3300026041 Bacteria 26656
356 Ga0207639_10001917 3300026041 Bacteria 13965
357 Ga0207639_10004441 3300026041 Bacteria 9464
358 Ga0207639_10007675 3300026041 Bacteria 7363
359 Ga0207639_10019356 3300026041 Bacteria 4854
360 Ga0207678_10001678 3300026067 Bacteria 20323
361 Ga0207678_10002250 3300026067 Bacteria 17473
362 Ga0207678_10002720 3300026067 Bacteria 16033
363 Ga0207678_10066322 3300026067 Bacteria 3100
364 Ga0207678_10094476 3300026067 Bacteria 2555
365 Ga0207678_10142849 3300026067 Bacteria 2043
366 Ga0207678_10247627 3300026067 Bacteria 1526
367 Ga0207702_10012063 3300026078 Bacteria 7187
368 Ga0207702_10027084 3300026078 Bacteria 4759
369 Ga0207702_10030282 3300026078 Bacteria 4509
370 Ga0207702_10107880 3300026078 Bacteria 2470
371 Ga0207641_10009512 3300026088 Bacteria 8012
372 Ga0207641_10060657 3300026088 Bacteria 3224
373 Ga0207641_10221528 3300026088 Bacteria 1755
374 Ga0207641_10567599 3300026088 Bacteria 1108
375 Ga0207648_10071014 3300026089 Bacteria 3035
376 Ga0207648_10220498 3300026089 Bacteria 1686
377 Ga0207674_10002322 3300026116 Bacteria 24094
378 Ga0207674_10008389 3300026116 Bacteria 11948
379 Ga0207674_10008726 3300026116 Bacteria 11669
380 Ga0207674_10049463 3300026116 Bacteria 4299
381 Ga0207675_100070634 3300026118 Bacteria 3264
382 Ga0207683_10275069 3300026121 Bacteria 1539
383 Ga0207698_10005406 3300026142 Bacteria 7890
384 Ga0207698_10074478 3300026142 Bacteria 2708
385 Ga0207698_10079744 3300026142 Bacteria 2634
386 Ga0207698_10121696 3300026142 Bacteria 2210
387 Ga0207698_10278447 3300026142 Bacteria 1546
388 Ga0209371_1000018 3300027312 Bacteria 614700
389 Ga0209974_10040660 3300027876 Bacteria 1548
390 Ga0268266_10000017 3300028379 Bacteria 607272
391 Ga0268266_10042299 3300028379 Bacteria 3891
392 Ga0268266_10080274 3300028379 Bacteria 2842
393 Ga0268266_10233736 3300028379 Bacteria 1694
394 Ga0268266_10528461 3300028379 Bacteria 1128
395 Ga0268266_10688073 3300028379 Bacteria 985
396 Ga0268265_10000376 3300028380 Bacteria 48178
397 Ga0307515_10483712 3300028794 Bacteria 850
398 Ga0268256_1000016 3300030500 Bacteria 614700
399 Ga0316178_1024454 3300030735 Bacteria 1433
400 Ga0316183_1013189 3300030742 Bacteria 1273
401 Ga0307513_10146417 3300031456 Bacteria 2279
402 Ga0307509_10154147 3300031507 Bacteria 2207
403 Ga0316575_10014957 3300031665 Bacteria 2921
404 Ga0316578_10001715 3300031728 Bacteria 9149
405 Ga0316578_10173597 3300031728 Bacteria 1299
406 Ga0307406_10003433 3300031901 Bacteria 8623
407 Ga0307409_100899672 3300031995 Bacteria 899
408 Ga0307409_100995499 3300031995 Bacteria 856
409 Ga0307414_10063368 3300032004 Bacteria 2627
410 Ga0307414_10170466 3300032004 Bacteria 1739
411 Ga0307414_10322283 3300032004 Bacteria 1316
412 Ga0316580_10021272 3300032139 Bacteria 1999
413 Ga0373937_0533753 3300036401 Bacteria 1115
414 Ga0316584_0004592 3300036712 Bacteria 9152
415 Ga0395899_0000164 3300037312 Bacteria 102165
416 Ga0395900_0000163 3300037418 Bacteria 109199
417 Ga0395900_0000217 3300037418 Bacteria 90402
418 Ga0395900_0424266 3300037418 Bacteria 1290
419 Ga0395898_0000029 3300037466 Bacteria 370667
420 Ga0395898_0812526 3300037466 Bacteria 875
421 Ga0395905_0246134 3300037471 Bacteria 1670
422 Ga0439436_0027207 3300041404 Bacteria 1674
423 Ga0439439_0014291 3300041406 Bacteria 1932
424 Ga0439447_000276 3300041407 Bacteria 18194
425 Ga0451787_716987 3300041441 Bacteria 2601
426 Ga0451791_0862441 3300041451 Bacteria 1388
427 Ga0451793_1023005 3300041452 Bacteria 1339
428 Ga0451800_0141867 3300041459 Bacteria 4981
429 Ga0451802_1110374 3300041460 Bacteria 5165
430 Ga0451802_1696655 3300041460 Bacteria 1079
431 Ga0451806_117351 3300041462 Bacteria 8065
432 Ga0451807_0337638 3300041486 Bacteria 1453
433 Ga0451807_0456601 3300041486 Bacteria 1856
434 Ga0451807_1394303 3300041486 Bacteria 2770
435 Ga0451837_0747194 3300041494 Bacteria 1828
436 Ga0451837_1713807 3300041494 Bacteria 1066
437 Ga0439445_0014309 3300042004 Bacteria 1930
438 Ga0439432_030801 3300042006 Bacteria 1738
439 Ga0439449_0020377 3300042007 Bacteria 2485
440 Ga0439449_0134387 3300042007 Bacteria 920
441 Ga0450908_000062 3300042184 Bacteria 21656
442 Ga0466988_0067231 3300044536 Bacteria 2115
443 Ga0466969_0015355 3300044656 Bacteria 4013
444 Ga0466972_0001414 3300044658 Bacteria 11634
445 Ga0466982_0000011 3300044672 Bacteria 175513
446 Ga0466966_0043419 3300044684 Bacteria 2881
447 Ga0466966_0153471 3300044684 Bacteria 1403
448 Ga0466961_0036989 3300044693 Bacteria 3132
449 Ga0466961_0323369 3300044693 Bacteria 940
450 Ga0453684_0000531 3300044712 Bacteria 145390
451 Ga0466970_0001522 3300044765 Bacteria 11158
452 Ga0466970_0013448 3300044765 Bacteria 4195
453 Ga0466970_0033643 3300044765 Bacteria 2709
454 Ga0466970_0342560 3300044765 Bacteria 847
455 Ga0466957_0066566 3300044842 Bacteria 2221
456 Ga0466959_0000246 3300045049 Bacteria 33596
457 Ga0466959_0012881 3300045049 Bacteria 6053
458 Ga0466959_0030265 3300045049 Bacteria 4009
459 Ga0451576_0000212 3300045051 Bacteria 145396
460 Ga0466958_0289006 3300045836 Bacteria 1051
461 Ga0495627_018790 3300046453 Bacteria 2325
462 Ga0495638_0000865 3300046460 Bacteria 31467
463 Ga0495607_0001295 3300046501 Bacteria 22335
464 Ga0495606_0000918 3300046507 Bacteria 43503
465 Ga0495606_0000948 3300046507 Bacteria 42725
466 Ga0495606_0011361 3300046507 Bacteria 7271
467 Ga0495610_0004897 3300046512 Bacteria 9726
468 Ga0495616_0100842 3300046513 Bacteria 1354
469 Ga0495620_0000565 3300046515 Bacteria 23373
470 Ga0495631_0003548 3300046518 Bacteria 8529
471 Ga0495643_0010311 3300046522 Bacteria 5754
472 Ga0495663_0001434 3300046525 Bacteria 7522
473 Ga0495598_0075565 3300046537 Bacteria 1070
474 Ga0495621_0001934 3300046539 Bacteria 5448
475 Ga0495656_0003859 3300046615 Bacteria 5098
476 Ga0495656_0006771 3300046615 Bacteria 4027
477 Ga0495668_0002964 3300046616 Bacteria 13323
478 Ga0495625_0107781 3300046660 Bacteria 1906
479 Ga0495670_0236149 3300046691 Bacteria 973
480 Ga0495671_0005538 3300046692 Bacteria 7384
481 Ga0495660_0026804 3300046810 Bacteria 3263
482 Ga0495636_0006456 3300047318 Bacteria 4607
483 Ga0495672_0000087 3300047320 Bacteria 154275
484 Ga0495672_0055159 3300047320 Bacteria 2320
485 Ga0495677_0035505 3300047445 Bacteria 1819
486 Ga0495686_0004214 3300047472 Bacteria 11939
487 Ga0495686_0004945 3300047472 Bacteria 10727
488 Ga0495686_0038417 3300047472 Bacteria 3061
489 Ga0495615_0003458 3300048090 Bacteria 2648
490 Ga0496100_0178507 3300048903 Bacteria 1534
491 Ga0496108_0319897 3300048911 Bacteria 1353
492 Ga0496109_0074224 3300048912 Bacteria 3126
493 Ga0496112_0501297 3300048915 Bacteria 1149
494 Ga0496113_0071099 3300048916 Bacteria 2646
495 Ga0496114_0033133 3300048917 Bacteria 4255
496 Ga0496114_0229627 3300048917 Bacteria 1630
497 Ga0496115_0000077 3300048918 Bacteria 89885
498 Ga0496117_0009829 3300048920 Bacteria 8812
499 Ga0496117_0028737 3300048920 Bacteria 4301
500 Ga0496117_0034057 3300048920 Bacteria 3844
501 Ga0496117_0326005 3300048920 Bacteria 803
502 Ga0496118_0035939 3300048921 Bacteria 4014
503 Ga0496118_0056691 3300048921 Bacteria 2943
504 Ga0496118_0183806 3300048921 Bacteria 1259
505 Ga0496119_0001836 3300048922 Bacteria 24586
506 Ga0496120_0000273 3300048923 Bacteria 86248
507 Ga0496121_0018990 3300048924 Bacteria 6897
508 Ga0496122_0000417 3300048925 Bacteria 90401
509 Ga0496122_0001517 3300048925 Bacteria 37011
510 Ga0496123_0000137 3300048926 Bacteria 152169
511 Ga0496123_0000323 3300048926 Bacteria 91212
512 Ga0496123_0005271 3300048926 Bacteria 13107
513 Ga0496123_0160107 3300048926 Bacteria 1201
514 Ga0496123_0166846 3300048926 Bacteria 1166
515 Ga0496124_0003391 3300048927 Bacteria 19565
516 Ga0496124_0038566 3300048927 Bacteria 4147
517 Ga0496125_0077822 3300048928 Bacteria 2553
518 Ga0496126_0000047 3300048929 Bacteria 322212
519 Ga0496126_0105791 3300048929 Bacteria 2456
520 Ga0496126_0176797 3300048929 Bacteria 1815
521 Ga0496126_0297614 3300048929 Bacteria 1332
522 Ga0501031_0011342 3300049568 Bacteria 5804
523 Ga0501031_0060029 3300049568 Bacteria 2478
524 Ga0501032_0020663 3300049569 Bacteria 4583
525 Ga0501032_0085227 3300049569 Bacteria 2100
526 Ga0501033_0000648 3300049570 Bacteria 32231
527 Ga0501033_0000683 3300049570 Bacteria 31408
528 Ga0501033_0120810 3300049570 Bacteria 1901
529 Ga0501033_0137547 3300049570 Bacteria 1767
530 Ga0501034_0002782 3300049571 Bacteria 20512
531 Ga0501034_0006063 3300049571 Bacteria 13053
532 Ga0501034_0065145 3300049571 Bacteria 3656
533 Ga0501034_0083756 3300049571 Bacteria 3191
534 Ga0501034_0300286 3300049571 Bacteria 1542
535 Ga0501036_0008180 3300049572 Bacteria 8573
536 Ga0501036_0031163 3300049572 Bacteria 4506
537 Ga0501036_0090604 3300049572 Bacteria 2583
538 Ga0501036_0098252 3300049572 Bacteria 2475
539 Ga0501037_0010898 3300049573 Bacteria 6680
540 Ga0501037_0067090 3300049573 Bacteria 2613
541 Ga0501037_0127846 3300049573 Bacteria 1823
542 Ga0501037_0378757 3300049573 Bacteria 973
543 Ga0501038_0049526 3300049574 Bacteria 3632
544 Ga0501038_0054955 3300049574 Bacteria 3422
545 Ga0501038_0106607 3300049574 Bacteria 2326
546 Ga0501038_0138085 3300049574 Bacteria 1996
547 Ga0501038_0187968 3300049574 Bacteria 1663
548 Ga0501038_0208685 3300049574 Bacteria 1564
549 Ga0501038_0390874 3300049574 Bacteria 1077
550 Ga0501039_0017656 3300049575 Bacteria 5473
551 Ga0501039_0109320 3300049575 Bacteria 2161
552 Ga0501043_0016644 3300049579 Bacteria 5762
553 Ga0501043_0033628 3300049579 Bacteria 4034
554 Ga0501043_0100193 3300049579 Bacteria 2277
555 Ga0501046_0021844 3300049580 Bacteria 5276
556 Ga0501046_0039025 3300049580 Bacteria 3806
557 Ga0501046_0048382 3300049580 Bacteria 3367
558 Ga0501046_0094391 3300049580 Bacteria 2299
559 Ga0501046_0206302 3300049580 Bacteria 1460
560 Ga0501047_0001522 3300049581 Bacteria 22636
561 Ga0501047_0001828 3300049581 Bacteria 20569
562 Ga0501047_0015935 3300049581 Bacteria 7165
563 Ga0501047_0018902 3300049581 Bacteria 6608
564 Ga0501047_0029824 3300049581 Bacteria 5258
565 Ga0501047_0082079 3300049581 Bacteria 3099
566 Ga0501047_0196976 3300049581 Bacteria 1876
567 Ga0501047_0261424 3300049581 Bacteria 1578
568 Ga0501048_0005076 3300049582 Bacteria 10027
569 Ga0501067_0000857 3300049583 Bacteria 16400
570 Ga0501067_0061569 3300049583 Bacteria 2077
571 Ga0501068_0002378 3300049584 Bacteria 10003
572 Ga0501068_0014946 3300049584 Bacteria 4448
573 Ga0501068_0041232 3300049584 Bacteria 2773
574 Ga0501068_0305055 3300049584 Bacteria 1019
575 Ga0501069_0004343 3300049585 Bacteria 7320
576 Ga0501069_0065347 3300049585 Bacteria 2034
577 Ga0501069_0066293 3300049585 Bacteria 2019
578 Ga0501070_0005876 3300049586 Bacteria 10464
579 Ga0501070_0023616 3300049586 Bacteria 5151
580 Ga0501070_0028917 3300049586 Bacteria 4647
581 Ga0501070_0050686 3300049586 Bacteria 3445
582 Ga0501070_0053490 3300049586 Bacteria 3349
583 Ga0501070_0100683 3300049586 Bacteria 2390
584 Ga0501070_0113020 3300049586 Bacteria 2244
585 Ga0501070_0254009 3300049586 Bacteria 1437
586 Ga0501070_0265574 3300049586 Bacteria 1402
587 Ga0501071_0027758 3300049587 Bacteria 3984
588 Ga0501071_0071996 3300049587 Bacteria 2520
589 Ga0501072_0000573 3300049588 Bacteria 26511
590 Ga0501073_0000434 3300049589 Bacteria 28757
591 Ga0501073_0021629 3300049589 Bacteria 4635
592 Ga0501073_0070760 3300049589 Bacteria 2430
593 Ga0501073_0094089 3300049589 Bacteria 2081
594 Ga0501073_0186270 3300049589 Bacteria 1436
595 Ga0501073_0319438 3300049589 Bacteria 1071
596 Ga0501074_0002217 3300049590 Bacteria 13482
597 Ga0501074_0003202 3300049590 Bacteria 11546
598 Ga0501074_0004731 3300049590 Bacteria 9756
599 Ga0501074_0050760 3300049590 Bacteria 2994
600 Ga0501074_0256565 3300049590 Bacteria 1243
601 Ga0501077_0013289 3300049593 Bacteria 5162
602 Ga0501079_0004962 3300049741 Bacteria 9869
603 Ga0501079_0011079 3300049741 Bacteria 6877
604 Ga0501079_0055881 3300049741 Bacteria 3046
605 Ga0501079_0148675 3300049741 Bacteria 1826
606 Ga0501079_0260668 3300049741 Bacteria 1355
607 Ga0501080_0000764 3300049742 Bacteria 26124
608 Ga0501080_0040656 3300049742 Bacteria 4336
609 Ga0501080_0309982 3300049742 Bacteria 1430
610 Ga0501083_0000246 3300049744 Bacteria 34511
611 Ga0501083_0016861 3300049744 Bacteria 5102
612 Ga0501083_0117151 3300049744 Bacteria 1748
613 Ga0501265_008607 3300049762 Bacteria 1219
614 Ga0501275_000512 3300049772 Bacteria 4353
615 Ga0501035_0004415 3300049822 Bacteria 13354
616 Ga0501035_0013478 3300049822 Bacteria 7546
617 Ga0501035_0029015 3300049822 Bacteria 5047
618 Ga0501035_0062096 3300049822 Bacteria 3324
619 Ga0501035_0156946 3300049822 Bacteria 1971
620 Ga0501035_0160760 3300049822 Bacteria 1944
621 Ga0501035_0485848 3300049822 Bacteria 1018
622 Ga0501035_0785746 3300049822 Bacteria 761
623 Ga0501044_0004071 3300049823 Bacteria 16399
624 Ga0501044_0004952 3300049823 Bacteria 14899
625 Ga0501044_0017726 3300049823 Bacteria 7638
626 Ga0501044_0053442 3300049823 Bacteria 4156
627 Ga0501044_0066121 3300049823 Bacteria 3687
628 Ga0501044_0104618 3300049823 Bacteria 2844
629 Ga0501044_0104735 3300049823 Bacteria 2842
630 Ga0501044_0118517 3300049823 Bacteria 2650
631 Ga0501044_0133983 3300049823 Bacteria 2470
632 Ga0501044_0155242 3300049823 Bacteria 2268
633 Ga0501045_0022730 3300049824 Bacteria 4491
634 nmdc:mga00v17_153920_c1 3300050491 Bacteria 1478
635 nmdc:mga00v17_2252_c1 3300050491 Bacteria 9886
636 Ga0500610_0000365 3300053079 Bacteria 13645
637 Ga0500651_0006630 3300053093 Bacteria 6696
638 Ga0500651_0034171 3300053093 Bacteria 3206
639 Ga0500651_0414209 3300053093 Bacteria 755
640 Ga0500568_0000233 3300053139 Bacteria 47567
641 Ga0500645_000375 3300053730 Bacteria 31466
642 Ga0500609_012751 3300053731 Bacteria 1137
643 Ga0501084_0073144 3300054114 Bacteria 2870
644 Ga0501082_0000107 3300060353 Bacteria 65178
645 Ga0501082_0054984 3300060353 Bacteria 3430
646 Ga0501082_0156873 3300060353 Bacteria 1977
647 Ga0466962_0012963 3300061719 Bacteria 4010
648 2547503589 2547132130 Bacteria 4660562
649 2578456967 2576861471 Bacteria 4648976
650 2643880455 2643221573 Bacteria 4784121
651 2643973376 2643221593 Bacteria 6296053
652 2644661030 2643221720 Bacteria 4694283
653 2644699112 2643221728 Bacteria 4797149
654 2735835413 2734482264 Unclassified 5014763
655 2747949943 2747842428 Bacteria 4689383
656 2765580539 2765235840 Bacteria 4663337
657 2816518437 2816332141 Bacteria 4436036
658 2819661328 2818991457 Bacteria 5323295
659 2842394454 2842391507 Bacteria 4486072
660 2852687199 2852684882 Bacteria 5463342
661 2857447000 2857442823 Bacteria 4562550
662 2919131044 2919130084 Bacteria 5301837
663 2919138752 2919134579 Bacteria 4480386
664 2929196283 2929195423 Bacteria 5325372
665 2939589840 2939589442 Bacteria 4214238
666 2939624953 2939622612 Bacteria 4698046
667 2961064871 2961064222 Bacteria 4749990
668 2974307615 2974307012 Bacteria 4172388
669 2977248326 2977247770 Bacteria 4160543
670 2984517181 2984514374 Bacteria 4172479
671 2987608827 2987605356 Bacteria 4187822
672 8003015465 8003014200 Bacteria 4059994
673 8021649751 8021648035 Bacteria 4772378
674 JGI24736J21556_1000668
675 SwRhRL2b_contig_1900888
676 JGI24741J21665_1000513
677 JGI24740J21852_10000733
678 JGI24740J21852_10001041
679 JGI25157J39369_1005706
680 JGI25151J46595_10000102
681 rootH1_10132375
682 Ga0055539_1001541
683 Ga0055533_1000809
684 Ga0055525_1000138
685 Ga0055527_1000281
686 Ga0055527_1000330
687 Ga0055535_1000843
688 Ga0055542_1000835
689 Ga0055542_1001160
690 Ga0055529_1000717
691 Ga0055529_1000943
692 Ga0055526_1006479
693 Ga0055537_1000059
694 Ga0055537_1001365
695 Ga0055524_1000019
696 Ga0055536_1018818
697 Ga0055534_1000012
698 Ga0055534_1000112
699 Ga0055528_1000007
700 Ga0055528_1001337
701 Ga0055530_10001674
702 Ga0055530_10002094
703 Ga0055531_10013881
704 Ga0055531_10024818
705 Ga0055531_10025507
706 Ga0058861_11997967
707 Ga0065714_10073865
708 Ga0065715_10008446
709 Ga0065715_10210857
710 Ga0070658_10025096
711 Ga0070683_100148995
712 Ga0070670_100001962
713 Ga0070670_100510566
714 Ga0070666_10267594
715 Ga0070680_100004327
716 Ga0070682_100013741
717 Ga0068868_100319978
718 Ga0070691_10146967
719 Ga0070691_10230441
720 Ga0070661_100009383
721 Ga0070661_100063255
722 Ga0070661_100122479
723 Ga0070692_10014304
724 Ga0070692_10150891
725 Ga0070669_100064482
726 Ga0070675_100043947
727 Ga0070671_100045193
728 Ga0070671_100069039
729 Ga0070673_100408221
730 Ga0070659_100187046
731 Ga0070667_100005400
732 Ga0070667_100041398
733 Ga0070667_100050689
734 Ga0070667_100121267
735 Ga0070667_100187140
736 Ga0070663_100000042
737 Ga0070663_100060983
738 Ga0070663_100136117
739 Ga0070663_100216615
740 Ga0070662_100014495
741 Ga0070662_100041992
742 Ga0070681_10001872
743 Ga0070681_10009167
744 Ga0070681_10177415
745 Ga0070681_10191941
746 Ga0070681_10300998
747 Ga0070681_10754860
748 Ga0070679_100004396
749 Ga0070679_100164520
750 Ga0070679_100819986
751 Ga0070684_100024537
752 Ga0070684_100048363
753 Ga0070684_100152602
754 Ga0070684_100585753
755 Ga0068853_100004195
756 Ga0068853_100007213
757 Ga0068853_100011114
758 Ga0068853_100020141
759 Ga0068853_100028892
760 Ga0068853_100033305
761 Ga0068853_100047267
762 Ga0070672_100003657
763 Ga0070686_100167171
764 Ga0070696_100002079
765 Ga0070693_100005032
766 Ga0070693_100012299
767 Ga0070693_100025853
768 Ga0070665_100000028
769 Ga0070665_100008261
770 Ga0070665_100027661
771 Ga0070665_100050597
772 Ga0070665_100084459
773 Ga0070665_100168154
774 Ga0070665_100219067
775 Ga0070665_100412820
776 Ga0070665_100832480
777 Ga0068855_100005951
778 Ga0068855_100105650
779 Ga0068855_100171818
780 Ga0068855_100384484
781 Ga0068855_100400853
782 Ga0068855_100640412
783 Ga0070664_100023351
784 Ga0070664_100203877
785 Ga0068857_100053558
786 Ga0068857_100182944
787 Ga0068857_100358917
788 Ga0068854_100004688
789 Ga0068854_100024611
790 Ga0068854_100053357
791 Ga0068854_100070907
792 Ga0068854_100080020
793 Ga0068854_100542130
794 Ga0068854_100546565
795 Ga0068856_100012643
796 Ga0068856_100161736
797 Ga0068856_100406692
798 Ga0068856_100452062
799 Ga0068852_100005973
800 Ga0068852_100068716
801 Ga0068852_100082660
802 Ga0068852_100212373
803 Ga0068852_100345615
804 Ga0068852_100348820
805 Ga0068859_100000280
806 Ga0068851_10011937
807 Ga0068851_10027186
808 Ga0068851_10035589
809 Ga0068870_10057938
810 Ga0068863_100018882
811 Ga0068863_100066084
812 Ga0068863_100077761
813 Ga0068863_100240960
814 Ga0068860_100124956
815 Ga0068862_100000215
816 Ga0068862_100111847
817 Ga0081539_10008186
818 Ga0097621_100206800
819 Ga0068871_100039983
820 Ga0068871_100199111
821 Ga0068871_100215267
822 Ga0068865_100017143
823 Ga0068865_100053746
824 Ga0097620_100000280
825 Ga0105251_10000205
826 Ga0105240_10087720
827 Ga0105240_10103888
828 Ga0105240_10152371
829 Ga0105245_10723360
830 Ga0105247_10124470
831 Ga0105241_10017637
832 Ga0105241_10055846
833 Ga0105241_10103439
834 Ga0105242_10675965
835 Ga0105248_10000120
836 Ga0105248_10309656
837 Ga0105237_10010356
838 Ga0105237_10618370
839 Ga0105238_10006626
840 Ga0105238_10011965
841 Ga0105238_10110821
842 Ga0105238_10192207
843 Ga0105249_10000898
844 Ga0105249_11264596
845 Ga0105239_10005391
846 Ga0105239_10033812
847 Ga0105239_10107680
848 Ga0157373_10012798
849 Ga0157373_10042694
850 Ga0157373_10055024
851 Ga0157373_10084294
852 Ga0157371_10057507
853 Ga0157371_10190065
854 Ga0157370_10033604
855 Ga0157370_10144952
856 Ga0157370_10663632
857 Ga0157369_10002250
858 Ga0157369_10024352
859 Ga0157369_10383664
860 Ga0157374_10158927
861 Ga0157374_10625115
862 Ga0157378_10000536
863 Ga0163162_10028377
864 Ga0163162_11402870
865 Ga0157372_10000344
866 Ga0157372_10013581
867 Ga0157372_10036173
868 Ga0157372_10037458
869 Ga0157372_10051825
870 Ga0157372_10057810
871 Ga0157372_10586568
872 Ga0157375_10584129
873 Ga0163163_10000029
874 Ga0163163_10672312
875 Ga0182008_10020566
876 Ga0182008_10029210
877 Ga0157379_10001942
878 Ga0157376_10002494
879 Ga0157376_10005280
880 Ga0182006_1053246
881 Ga0182005_1002582
882 Ga0163161_10073490
883 Ga0206356_10496513
884 Ga0206356_11576430
885 Ga0206353_10732351
886 Ga0224712_10096835
887 Ga0209674_100149
888 Ga0209672_100004
889 Ga0209672_100008
890 Ga0209563_100036
891 Ga0209258_100003
892 Ga0209258_100004
893 Ga0209258_100008
894 Ga0207425_1010986
895 Ga0209026_1000045
896 Ga0209677_100974
897 Ga0209148_1000025
898 Ga0209148_1000053
899 Ga0209759_1000850
900 Ga0209565_1000001
901 Ga0209565_1000060
902 Ga0209455_1000004
903 Ga0209455_1000007
904 Ga0209673_1000001
905 Ga0209673_1000047
906 Ga0209130_1014021
907 Ga0209675_1000001
908 Ga0209675_1000007
909 Ga0209676_1000052
910 Ga0209025_1000006
911 Ga0209564_1000001
912 Ga0209564_1000252
913 Ga0209758_1006577
914 Ga0209050_1000146
915 Ga0209256_1000006
916 Ga0209256_1005932
917 Ga0209051_1005721
918 Ga0209257_1010878
919 Ga0207656_10003660
920 Ga0207656_10021120
921 Ga0207713_1000196
922 Ga0207682_10063268
923 Ga0207710_10054171
924 Ga0207688_10169944
925 Ga0207680_10139401
926 Ga0207680_10180954
927 Ga0207680_10323227
928 Ga0207647_10000826
929 Ga0207647_10001336
930 Ga0207647_10003112
931 Ga0207647_10138743
932 Ga0207645_10026306
933 Ga0207645_10106425
934 Ga0207643_10041259
935 Ga0207705_10000097
936 Ga0207705_10000341
937 Ga0207705_10000630
938 Ga0207705_10002108
939 Ga0207654_10000458
940 Ga0207654_10031408
941 Ga0207654_10063425
942 Ga0207707_10000065
943 Ga0207707_10000084
944 Ga0207707_10000578
945 Ga0207707_10001112
946 Ga0207707_10002407
947 Ga0207707_10054364
948 Ga0207695_10000772
949 Ga0207695_10002496
950 Ga0207695_10006652
951 Ga0207695_10015003
952 Ga0207695_10595887
953 Ga0207671_10007551
954 Ga0207671_10088892
955 Ga0207671_10143283
956 Ga0207671_10249251
957 Ga0207660_10005551
958 Ga0207660_10006903
959 Ga0207660_10010377
960 Ga0207660_10011546
961 Ga0207660_10184679
962 Ga0207657_10002465
963 Ga0207657_10006390
964 Ga0207657_10007147
965 Ga0207657_10256498
966 Ga0207657_10483215
967 Ga0207649_10004292
968 Ga0207649_10006309
969 Ga0207649_10385596
970 Ga0207649_10409040
971 Ga0207649_10705864
972 Ga0207652_10000014
973 Ga0207652_10000076
974 Ga0207652_10002969
975 Ga0207652_10069249
976 Ga0207652_10378129
977 Ga0207652_10490868
978 Ga0207681_10056764
979 Ga0207694_10006803
980 Ga0207694_10012929
981 Ga0207650_10001926
982 Ga0207650_10328626
983 Ga0207687_10484561
984 Ga0207700_10513190
985 Ga0207644_10017204
986 Ga0207644_10257288
987 Ga0207690_10000122
988 Ga0207690_10003069
989 Ga0207690_10819681
990 Ga0207706_10003801
991 Ga0207706_10316978
992 Ga0207706_10795698
993 Ga0207691_10009099
994 Ga0207691_10019067
995 Ga0207711_10010606
996 Ga0207689_10034224
997 Ga0207661_10007040
998 Ga0207661_10071965
999 Ga0207661_10113455
1000 Ga0207661_10266777
1001 Ga0207661_10289978
1002 Ga0207679_10026576
1003 Ga0207667_10000623
1004 Ga0207667_10000683
1005 Ga0207667_10008297
1006 Ga0207667_10019912
1007 Ga0207667_10038594
1008 Ga0207667_10049542
1009 Ga0207651_10070326
1010 Ga0207712_10000305
1011 Ga0207712_10024220
1012 Ga0207668_10017413
1013 Ga0207668_10290936
1014 Ga0207640_10000362
1015 Ga0207640_10002592
1016 Ga0207640_10003436
1017 Ga0207640_10022848
1018 Ga0207640_10053751
1019 Ga0207640_10062553
1020 Ga0207640_10135130
1021 Ga0207658_10000033
1022 Ga0207658_10009244
1023 Ga0207658_10513082
1024 Ga0207658_10805041
1025 Ga0207677_10008057
1026 Ga0207703_10202544
1027 Ga0207639_10000437
1028 Ga0207639_10000514
1029 Ga0207639_10001917
1030 Ga0207639_10004441
1031 Ga0207639_10007675
1032 Ga0207639_10019356
1033 Ga0207678_10001678
1034 Ga0207678_10002250
1035 Ga0207678_10002720
1036 Ga0207678_10066322
1037 Ga0207678_10094476
1038 Ga0207678_10142849
1039 Ga0207678_10247627
1040 Ga0207702_10012063
1041 Ga0207702_10027084
1042 Ga0207702_10030282
1043 Ga0207702_10107880
1044 Ga0207641_10009512
1045 Ga0207641_10060657
1046 Ga0207641_10221528
1047 Ga0207641_10567599
1048 Ga0207648_10071014
1049 Ga0207648_10220498
1050 Ga0207674_10002322
1051 Ga0207674_10008389
1052 Ga0207674_10008726
1053 Ga0207674_10049463
1054 Ga0207675_100070634
1055 Ga0207683_10275069
1056 Ga0207698_10005406
1057 Ga0207698_10074478
1058 Ga0207698_10079744
1059 Ga0207698_10121696
1060 Ga0207698_10278447
1061 Ga0209371_1000018
1062 Ga0209974_10040660
1063 Ga0268266_10000017
1064 Ga0268266_10042299
1065 Ga0268266_10080274
1066 Ga0268266_10233736
1067 Ga0268266_10528461
1068 Ga0268266_10688073
1069 Ga0268265_10000376
1070 Ga0307515_10483712
1071 Ga0268256_1000016
1072 Ga0316178_1024454
1073 Ga0316183_1013189
1074 Ga0307513_10146417
1075 Ga0307509_10154147
1076 Ga0316575_10014957
1077 Ga0316578_10001715
1078 Ga0316578_10173597
1079 Ga0307406_10003433
1080 Ga0307409_100899672
1081 Ga0307409_100995499
1082 Ga0307414_10063368
1083 Ga0307414_10170466
1084 Ga0307414_10322283
1085 Ga0316580_10021272
1086 Ga0373937_0533753
1087 Ga0316584_0004592
1088 Ga0395899_0000164
1089 Ga0395900_0000163
1090 Ga0395900_0000217
1091 Ga0395900_0424266
1092 Ga0395898_0000029
1093 Ga0395898_0812526
1094 Ga0395905_0246134
1095 Ga0439436_0027207
1096 Ga0439439_0014291
1097 Ga0439447_000276
1098 Ga0451787_716987
1099 Ga0451791_0862441
1100 Ga0451793_1023005
1101 Ga0451800_0141867
1102 Ga0451802_1110374
1103 Ga0451802_1696655
1104 Ga0451806_117351
1105 Ga0451807_0337638
1106 Ga0451807_0456601
1107 Ga0451807_1394303
1108 Ga0451837_0747194
1109 Ga0451837_1713807
1110 Ga0439445_0014309
1111 Ga0439432_030801
1112 Ga0439449_0020377
1113 Ga0439449_0134387
1114 Ga0450908_000062
1115 Ga0466988_0067231
1116 Ga0466969_0015355
1117 Ga0466972_0001414
1118 Ga0466982_0000011
1119 Ga0466966_0043419
1120 Ga0466966_0153471
1121 Ga0466961_0036989
1122 Ga0466961_0323369
1123 Ga0453684_0000531
1124 Ga0466970_0001522
1125 Ga0466970_0013448
1126 Ga0466970_0033643
1127 Ga0466970_0342560
1128 Ga0466957_0066566
1129 Ga0466959_0000246
1130 Ga0466959_0012881
1131 Ga0466959_0030265
1132 Ga0451576_0000212
1133 Ga0466958_0289006
1134 Ga0495627_018790
1135 Ga0495638_0000865
1136 Ga0495607_0001295
1137 Ga0495606_0000918
1138 Ga0495606_0000948
1139 Ga0495606_0011361
1140 Ga0495610_0004897
1141 Ga0495616_0100842
1142 Ga0495620_0000565
1143 Ga0495631_0003548
1144 Ga0495643_0010311
1145 Ga0495663_0001434
1146 Ga0495598_0075565
1147 Ga0495621_0001934
1148 Ga0495656_0003859
1149 Ga0495656_0006771
1150 Ga0495668_0002964
1151 Ga0495625_0107781
1152 Ga0495670_0236149
1153 Ga0495671_0005538
1154 Ga0495660_0026804
1155 Ga0495636_0006456
1156 Ga0495672_0000087
1157 Ga0495672_0055159
1158 Ga0495677_0035505
1159 Ga0495686_0004214
1160 Ga0495686_0004945
1161 Ga0495686_0038417
1162 Ga0495615_0003458
1163 Ga0496100_0178507
1164 Ga0496108_0319897
1165 Ga0496109_0074224
1166 Ga0496112_0501297
1167 Ga0496113_0071099
1168 Ga0496114_0033133
1169 Ga0496114_0229627
1170 Ga0496115_0000077
1171 Ga0496117_0009829
1172 Ga0496117_0028737
1173 Ga0496117_0034057
1174 Ga0496117_0326005
1175 Ga0496118_0035939
1176 Ga0496118_0056691
1177 Ga0496118_0183806
1178 Ga0496119_0001836
1179 Ga0496120_0000273
1180 Ga0496121_0018990
1181 Ga0496122_0000417
1182 Ga0496122_0001517
1183 Ga0496123_0000137
1184 Ga0496123_0000323
1185 Ga0496123_0005271
1186 Ga0496123_0160107
1187 Ga0496123_0166846
1188 Ga0496124_0003391
1189 Ga0496124_0038566
1190 Ga0496125_0077822
1191 Ga0496126_0000047
1192 Ga0496126_0105791
1193 Ga0496126_0176797
1194 Ga0496126_0297614
1195 Ga0501031_0011342
1196 Ga0501031_0060029
1197 Ga0501032_0020663
1198 Ga0501032_0085227
1199 Ga0501033_0000648
1200 Ga0501033_0000683
1201 Ga0501033_0120810
1202 Ga0501033_0137547
1203 Ga0501034_0002782
1204 Ga0501034_0006063
1205 Ga0501034_0065145
1206 Ga0501034_0083756
1207 Ga0501034_0300286
1208 Ga0501036_0008180
1209 Ga0501036_0031163
1210 Ga0501036_0090604
1211 Ga0501036_0098252
1212 Ga0501037_0010898
1213 Ga0501037_0067090
1214 Ga0501037_0127846
1215 Ga0501037_0378757
1216 Ga0501038_0049526
1217 Ga0501038_0054955
1218 Ga0501038_0106607
1219 Ga0501038_0138085
1220 Ga0501038_0187968
1221 Ga0501038_0208685
1222 Ga0501038_0390874
1223 Ga0501039_0017656
1224 Ga0501039_0109320
1225 Ga0501043_0016644
1226 Ga0501043_0033628
1227 Ga0501043_0100193
1228 Ga0501046_0021844
1229 Ga0501046_0039025
1230 Ga0501046_0048382
1231 Ga0501046_0094391
1232 Ga0501046_0206302
1233 Ga0501047_0001522
1234 Ga0501047_0001828
1235 Ga0501047_0015935
1236 Ga0501047_0018902
1237 Ga0501047_0029824
1238 Ga0501047_0082079
1239 Ga0501047_0196976
1240 Ga0501047_0261424
1241 Ga0501048_0005076
1242 Ga0501067_0000857
1243 Ga0501067_0061569
1244 Ga0501068_0002378
1245 Ga0501068_0014946
1246 Ga0501068_0041232
1247 Ga0501068_0305055
1248 Ga0501069_0004343
1249 Ga0501069_0065347
1250 Ga0501069_0066293
1251 Ga0501070_0005876
1252 Ga0501070_0023616
1253 Ga0501070_0028917
1254 Ga0501070_0050686
1255 Ga0501070_0053490
1256 Ga0501070_0100683
1257 Ga0501070_0113020
1258 Ga0501070_0254009
1259 Ga0501070_0265574
1260 Ga0501071_0027758
1261 Ga0501071_0071996
1262 Ga0501072_0000573
1263 Ga0501073_0000434
1264 Ga0501073_0021629
1265 Ga0501073_0070760
1266 Ga0501073_0094089
1267 Ga0501073_0186270
1268 Ga0501073_0319438
1269 Ga0501074_0002217
1270 Ga0501074_0003202
1271 Ga0501074_0004731
1272 Ga0501074_0050760
1273 Ga0501074_0256565
1274 Ga0501077_0013289
1275 Ga0501079_0004962
1276 Ga0501079_0011079
1277 Ga0501079_0055881
1278 Ga0501079_0148675
1279 Ga0501079_0260668
1280 Ga0501080_0000764
1281 Ga0501080_0040656
1282 Ga0501080_0309982
1283 Ga0501083_0000246
1284 Ga0501083_0016861
1285 Ga0501083_0117151
1286 Ga0501265_008607
1287 Ga0501275_000512
1288 Ga0501035_0004415
1289 Ga0501035_0013478
1290 Ga0501035_0029015
1291 Ga0501035_0062096
1292 Ga0501035_0156946
1293 Ga0501035_0160760
1294 Ga0501035_0485848
1295 Ga0501035_0785746
1296 Ga0501044_0004071
1297 Ga0501044_0004952
1298 Ga0501044_0017726
1299 Ga0501044_0053442
1300 Ga0501044_0066121
1301 Ga0501044_0104618
1302 Ga0501044_0104735
1303 Ga0501044_0118517
1304 Ga0501044_0133983
1305 Ga0501044_0155242
1306 Ga0501045_0022730
1307 nmdc:mga00v17_153920_c1
1308 nmdc:mga00v17_2252_c1
1309 Ga0500610_0000365
1310 Ga0500651_0006630
1311 Ga0500651_0034171
1312 Ga0500651_0414209
1313 Ga0500568_0000233
1314 Ga0500645_000375
1315 Ga0500609_012751
1316 Ga0501084_0073144
1317 Ga0501082_0000107
1318 Ga0501082_0054984
1319 Ga0501082_0156873
1320 Ga0466962_0012963
1321 2547503589
1322 2578456967
1323 2643880455
1324 2643973376
1325 2644661030
1326 2644699112
1327 2735835413
1328 2747949943
1329 2765580539
1330 2816518437
1331 2819661328
1332 2842394454
1333 2852687199
1334 2857447000
1335 2919131044
1336 2919138752
1337 2929196283
1338 2939589840
1339 2939624953
1340 2961064871
1341 2974307615
1342 2977248326
1343 2984517181
1344 2987608827
1345 8003015465
1346 8021649751

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

66

250

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.9035 20 225
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.9011 21 220
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.8829 20 225
2aru-assembly1.cif.gz_A crystal structure of lipoate-protein ligase a bound with atp 0.8271 20 228
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.8267 21 220
ID Description Score Start End Superfamily
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9822 21 217 3.30.930.10
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9535 21 217 3.30.930.10
af_Q9SXP7_6_215_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9468 21 218 3.30.930.10
2qhuA01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9243 21 219 3.30.930.10
af_O36017_5_216_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9214 30 217 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A3B0VSD3-F1-model_v4 lipoyl(octanoyl) transferase (EC 2.3.1.181) 0.9952 20 108 GO:0033819
AF-A0A3D3D3L3-F1-model_v4 deleted 0.9931 22 99
AF-A0A090P1B0-F1-model_v4 deleted 0.9919 21 139
AF-A0A2J0QT14-F1-model_v4 deleted 0.9916 76 181
AF-A0A7Z7KMB8-F1-model_v4 deleted 0.9907 21 104

Map