F474274
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 673 | 322 | 1346 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300001904|JGI24736J21556_1000668|JGI24736J21556_10006682 |
| Length | 269 |
| Sequence | MHAPNLTPFGMKGVDASASGGCPVAKEPSPLALRARSLRSALRAEGGSHEPGHLPLLVRHLGRQLYEPVWHAMQAFTDARGPDTPDELWLVEHDPVFTLGQAGKPEHVLAAGDIPVIHVDRGGQVTYHGPGQIVAYPLLDLRRLKIGVRELVRRIEQSIIDTLAEWNIVAARREGAPGVYAGEAKIAALGLRVRHGCTFHGLAFNVAMDLEPFHRINPCGYAGLQVAQMLDLGGPSRLADVEEVLVAELGRQFGLSPQDAEPALPRAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 175 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 177 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 180 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 181 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 186 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 188 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 193 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 194 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 195 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 203 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 204 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 205 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 206 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 207 | 3300044536 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E | Metagenome | Unclassified |
| 208 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 209 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 210 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 211 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 212 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 213 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 214 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 217 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 218 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 219 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 250 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 251 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 252 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 255 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 256 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 257 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 284 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 285 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 289 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 290 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 291 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 292 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 293 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 294 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 297 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 298 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 299 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 300 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 301 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 302 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 303 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 304 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 305 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 306 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 307 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 308 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 309 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 310 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 311 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 312 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 313 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 314 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 315 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 316 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 317 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 318 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 319 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 320 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 321 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 322 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.39 |
| Metatranscriptomes | 0.74 |
| Isolates | 3.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 9.51 |
| Nodule | 0.15 |
| Rhizoplane | 2.67 |
| Rhizosphere | 79.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000668 | 3300001904 | Bacteria | 6283 |
| 2 | SwRhRL2b_contig_1900888 | 2162886007 | Bacteria | 7548 |
| 3 | JGI24741J21665_1000513 | 3300001915 | Bacteria | 11829 |
| 4 | JGI24740J21852_10000733 | 3300001979 | Bacteria | 14284 |
| 5 | JGI24740J21852_10001041 | 3300001979 | Bacteria | 12448 |
| 6 | JGI25157J39369_1005706 | 3300002741 | Bacteria | 1985 |
| 7 | JGI25151J46595_10000102 | 3300003187 | Bacteria | 114881 |
| 8 | rootH1_10132375 | 3300003323 | Bacteria | 1213 |
| 9 | Ga0055539_1001541 | 3300003752 | Bacteria | 4192 |
| 10 | Ga0055533_1000809 | 3300003756 | Bacteria | 9692 |
| 11 | Ga0055525_1000138 | 3300003759 | Bacteria | 104087 |
| 12 | Ga0055527_1000281 | 3300003760 | Bacteria | 30006 |
| 13 | Ga0055527_1000330 | 3300003760 | Bacteria | 25414 |
| 14 | Ga0055535_1000843 | 3300003761 | Bacteria | 21891 |
| 15 | Ga0055542_1000835 | 3300003762 | Bacteria | 21895 |
| 16 | Ga0055542_1001160 | 3300003762 | Bacteria | 15324 |
| 17 | Ga0055529_1000717 | 3300003763 | Bacteria | 21895 |
| 18 | Ga0055529_1000943 | 3300003763 | Bacteria | 15407 |
| 19 | Ga0055526_1006479 | 3300003771 | Bacteria | 6343 |
| 20 | Ga0055537_1000059 | 3300003773 | Bacteria | 79628 |
| 21 | Ga0055537_1001365 | 3300003773 | Bacteria | 9847 |
| 22 | Ga0055524_1000019 | 3300003775 | Bacteria | 233561 |
| 23 | Ga0055536_1018818 | 3300003781 | Bacteria | 2197 |
| 24 | Ga0055534_1000012 | 3300003784 | Bacteria | 153530 |
| 25 | Ga0055534_1000112 | 3300003784 | Bacteria | 59920 |
| 26 | Ga0055528_1000007 | 3300003790 | Bacteria | 233327 |
| 27 | Ga0055528_1001337 | 3300003790 | Bacteria | 15339 |
| 28 | Ga0055530_10001674 | 3300003791 | Bacteria | 15731 |
| 29 | Ga0055530_10002094 | 3300003791 | Bacteria | 13328 |
| 30 | Ga0055531_10013881 | 3300003794 | Bacteria | 3678 |
| 31 | Ga0055531_10024818 | 3300003794 | Bacteria | 2197 |
| 32 | Ga0055531_10025507 | 3300003794 | Bacteria | 2143 |
| 33 | Ga0058861_11997967 | 3300004800 | Bacteria | 3815 |
| 34 | Ga0065714_10073865 | 3300005288 | Bacteria | 3115 |
| 35 | Ga0065715_10008446 | 3300005293 | Bacteria | 3910 |
| 36 | Ga0065715_10210857 | 3300005293 | Bacteria | 1310 |
| 37 | Ga0070658_10025096 | 3300005327 | Bacteria | 4778 |
| 38 | Ga0070683_100148995 | 3300005329 | Bacteria | 2218 |
| 39 | Ga0070670_100001962 | 3300005331 | Bacteria | 16837 |
| 40 | Ga0070670_100510566 | 3300005331 | Bacteria | 1070 |
| 41 | Ga0070666_10267594 | 3300005335 | Bacteria | 1213 |
| 42 | Ga0070680_100004327 | 3300005336 | Bacteria | 10676 |
| 43 | Ga0070682_100013741 | 3300005337 | Bacteria | 4667 |
| 44 | Ga0068868_100319978 | 3300005338 | Bacteria | 1321 |
| 45 | Ga0070691_10146967 | 3300005341 | Bacteria | 1206 |
| 46 | Ga0070691_10230441 | 3300005341 | Bacteria | 985 |
| 47 | Ga0070661_100009383 | 3300005344 | Bacteria | 6771 |
| 48 | Ga0070661_100063255 | 3300005344 | Bacteria | 2717 |
| 49 | Ga0070661_100122479 | 3300005344 | Bacteria | 1948 |
| 50 | Ga0070692_10014304 | 3300005345 | Bacteria | 3723 |
| 51 | Ga0070692_10150891 | 3300005345 | Bacteria | 1323 |
| 52 | Ga0070669_100064482 | 3300005353 | Bacteria | 2698 |
| 53 | Ga0070675_100043947 | 3300005354 | Bacteria | 3654 |
| 54 | Ga0070671_100045193 | 3300005355 | Bacteria | 3661 |
| 55 | Ga0070671_100069039 | 3300005355 | Bacteria | 2947 |
| 56 | Ga0070673_100408221 | 3300005364 | Bacteria | 1216 |
| 57 | Ga0070659_100187046 | 3300005366 | Bacteria | 1701 |
| 58 | Ga0070667_100005400 | 3300005367 | Bacteria | 10674 |
| 59 | Ga0070667_100041398 | 3300005367 | Bacteria | 3865 |
| 60 | Ga0070667_100050689 | 3300005367 | Bacteria | 3499 |
| 61 | Ga0070667_100121267 | 3300005367 | Bacteria | 2274 |
| 62 | Ga0070667_100187140 | 3300005367 | Bacteria | 1833 |
| 63 | Ga0070663_100000042 | 3300005455 | Bacteria | 57899 |
| 64 | Ga0070663_100060983 | 3300005455 | Bacteria | 2715 |
| 65 | Ga0070663_100136117 | 3300005455 | Bacteria | 1870 |
| 66 | Ga0070663_100216615 | 3300005455 | Bacteria | 1501 |
| 67 | Ga0070662_100014495 | 3300005457 | Bacteria | 5270 |
| 68 | Ga0070662_100041992 | 3300005457 | Bacteria | 3265 |
| 69 | Ga0070681_10001872 | 3300005458 | Bacteria | 18988 |
| 70 | Ga0070681_10009167 | 3300005458 | Bacteria | 9724 |
| 71 | Ga0070681_10177415 | 3300005458 | Bacteria | 2052 |
| 72 | Ga0070681_10191941 | 3300005458 | Bacteria | 1962 |
| 73 | Ga0070681_10300998 | 3300005458 | Bacteria | 1513 |
| 74 | Ga0070681_10754860 | 3300005458 | Bacteria | 889 |
| 75 | Ga0070679_100004396 | 3300005530 | Bacteria | 13033 |
| 76 | Ga0070679_100164520 | 3300005530 | Bacteria | 2192 |
| 77 | Ga0070679_100819986 | 3300005530 | Bacteria | 873 |
| 78 | Ga0070684_100024537 | 3300005535 | Bacteria | 5060 |
| 79 | Ga0070684_100048363 | 3300005535 | Bacteria | 3690 |
| 80 | Ga0070684_100152602 | 3300005535 | Bacteria | 2093 |
| 81 | Ga0070684_100585753 | 3300005535 | Bacteria | 1037 |
| 82 | Ga0068853_100004195 | 3300005539 | Bacteria | 11116 |
| 83 | Ga0068853_100007213 | 3300005539 | Bacteria | 8902 |
| 84 | Ga0068853_100011114 | 3300005539 | Bacteria | 7303 |
| 85 | Ga0068853_100020141 | 3300005539 | Bacteria | 5545 |
| 86 | Ga0068853_100028892 | 3300005539 | Bacteria | 4668 |
| 87 | Ga0068853_100033305 | 3300005539 | Bacteria | 4371 |
| 88 | Ga0068853_100047267 | 3300005539 | Bacteria | 3692 |
| 89 | Ga0070672_100003657 | 3300005543 | Bacteria | 9989 |
| 90 | Ga0070686_100167171 | 3300005544 | Bacteria | 1553 |
| 91 | Ga0070696_100002079 | 3300005546 | Bacteria | 13147 |
| 92 | Ga0070693_100005032 | 3300005547 | Bacteria | 6313 |
| 93 | Ga0070693_100012299 | 3300005547 | Bacteria | 4328 |
| 94 | Ga0070693_100025853 | 3300005547 | Bacteria | 3162 |
| 95 | Ga0070665_100000028 | 3300005548 | Bacteria | 351357 |
| 96 | Ga0070665_100008261 | 3300005548 | Bacteria | 10529 |
| 97 | Ga0070665_100027661 | 3300005548 | Bacteria | 5710 |
| 98 | Ga0070665_100050597 | 3300005548 | Bacteria | 4169 |
| 99 | Ga0070665_100084459 | 3300005548 | Bacteria | 3180 |
| 100 | Ga0070665_100168154 | 3300005548 | Bacteria | 2194 |
| 101 | Ga0070665_100219067 | 3300005548 | Bacteria | 1904 |
| 102 | Ga0070665_100412820 | 3300005548 | Bacteria | 1358 |
| 103 | Ga0070665_100832480 | 3300005548 | Bacteria | 936 |
| 104 | Ga0068855_100005951 | 3300005563 | Bacteria | 14870 |
| 105 | Ga0068855_100105650 | 3300005563 | Bacteria | 3237 |
| 106 | Ga0068855_100171818 | 3300005563 | Bacteria | 2454 |
| 107 | Ga0068855_100384484 | 3300005563 | Bacteria | 1540 |
| 108 | Ga0068855_100400853 | 3300005563 | Bacteria | 1503 |
| 109 | Ga0068855_100640412 | 3300005563 | Bacteria | 1143 |
| 110 | Ga0070664_100023351 | 3300005564 | Bacteria | 5107 |
| 111 | Ga0070664_100203877 | 3300005564 | Bacteria | 1766 |
| 112 | Ga0068857_100053558 | 3300005577 | Bacteria | 3579 |
| 113 | Ga0068857_100182944 | 3300005577 | Bacteria | 1907 |
| 114 | Ga0068857_100358917 | 3300005577 | Bacteria | 1351 |
| 115 | Ga0068854_100004688 | 3300005578 | Bacteria | 8616 |
| 116 | Ga0068854_100024611 | 3300005578 | Bacteria | 4125 |
| 117 | Ga0068854_100053357 | 3300005578 | Bacteria | 2903 |
| 118 | Ga0068854_100070907 | 3300005578 | Bacteria | 2547 |
| 119 | Ga0068854_100080020 | 3300005578 | Bacteria | 2411 |
| 120 | Ga0068854_100542130 | 3300005578 | Bacteria | 985 |
| 121 | Ga0068854_100546565 | 3300005578 | Bacteria | 982 |
| 122 | Ga0068856_100012643 | 3300005614 | Bacteria | 8173 |
| 123 | Ga0068856_100161736 | 3300005614 | Bacteria | 2249 |
| 124 | Ga0068856_100406692 | 3300005614 | Bacteria | 1381 |
| 125 | Ga0068856_100452062 | 3300005614 | Bacteria | 1305 |
| 126 | Ga0068852_100005973 | 3300005616 | Bacteria | 8769 |
| 127 | Ga0068852_100068716 | 3300005616 | Bacteria | 3102 |
| 128 | Ga0068852_100082660 | 3300005616 | Bacteria | 2854 |
| 129 | Ga0068852_100212373 | 3300005616 | Bacteria | 1836 |
| 130 | Ga0068852_100345615 | 3300005616 | Bacteria | 1451 |
| 131 | Ga0068852_100348820 | 3300005616 | Bacteria | 1445 |
| 132 | Ga0068859_100000280 | 3300005617 | Bacteria | 50848 |
| 133 | Ga0068851_10011937 | 3300005834 | Bacteria | 4084 |
| 134 | Ga0068851_10027186 | 3300005834 | Bacteria | 2818 |
| 135 | Ga0068851_10035589 | 3300005834 | Bacteria | 2489 |
| 136 | Ga0068870_10057938 | 3300005840 | Bacteria | 2073 |
| 137 | Ga0068863_100018882 | 3300005841 | Bacteria | 6597 |
| 138 | Ga0068863_100066084 | 3300005841 | Bacteria | 3421 |
| 139 | Ga0068863_100077761 | 3300005841 | Bacteria | 3140 |
| 140 | Ga0068863_100240960 | 3300005841 | Bacteria | 1745 |
| 141 | Ga0068860_100124956 | 3300005843 | Bacteria | 2466 |
| 142 | Ga0068862_100000215 | 3300005844 | Bacteria | 64251 |
| 143 | Ga0068862_100111847 | 3300005844 | Bacteria | 2398 |
| 144 | Ga0081539_10008186 | 3300005985 | Bacteria | 9212 |
| 145 | Ga0097621_100206800 | 3300006237 | Bacteria | 1706 |
| 146 | Ga0068871_100039983 | 3300006358 | Bacteria | 3755 |
| 147 | Ga0068871_100199111 | 3300006358 | Bacteria | 1728 |
| 148 | Ga0068871_100215267 | 3300006358 | Bacteria | 1663 |
| 149 | Ga0068865_100017143 | 3300006881 | Bacteria | 4652 |
| 150 | Ga0068865_100053746 | 3300006881 | Bacteria | 2795 |
| 151 | Ga0097620_100000280 | 3300006931 | Bacteria | 50848 |
| 152 | Ga0105251_10000205 | 3300009011 | Bacteria | 59437 |
| 153 | Ga0105240_10087720 | 3300009093 | Bacteria | 3809 |
| 154 | Ga0105240_10103888 | 3300009093 | Bacteria | 3451 |
| 155 | Ga0105240_10152371 | 3300009093 | Bacteria | 2752 |
| 156 | Ga0105245_10723360 | 3300009098 | Bacteria | 1030 |
| 157 | Ga0105247_10124470 | 3300009101 | Bacteria | 1674 |
| 158 | Ga0105241_10017637 | 3300009174 | Bacteria | 5249 |
| 159 | Ga0105241_10055846 | 3300009174 | Bacteria | 3026 |
| 160 | Ga0105241_10103439 | 3300009174 | Bacteria | 2268 |
| 161 | Ga0105242_10675965 | 3300009176 | Bacteria | 1007 |
| 162 | Ga0105248_10000120 | 3300009177 | Bacteria | 89960 |
| 163 | Ga0105248_10309656 | 3300009177 | Bacteria | 1778 |
| 164 | Ga0105237_10010356 | 3300009545 | Bacteria | 9929 |
| 165 | Ga0105237_10618370 | 3300009545 | Bacteria | 1090 |
| 166 | Ga0105238_10006626 | 3300009551 | Bacteria | 11543 |
| 167 | Ga0105238_10011965 | 3300009551 | Bacteria | 8742 |
| 168 | Ga0105238_10110821 | 3300009551 | Bacteria | 2725 |
| 169 | Ga0105238_10192207 | 3300009551 | Bacteria | 2017 |
| 170 | Ga0105249_10000898 | 3300009553 | Bacteria | 26273 |
| 171 | Ga0105249_11264596 | 3300009553 | Bacteria | 809 |
| 172 | Ga0105239_10005391 | 3300010375 | Bacteria | 15027 |
| 173 | Ga0105239_10033812 | 3300010375 | Bacteria | 5613 |
| 174 | Ga0105239_10107680 | 3300010375 | Bacteria | 3088 |
| 175 | Ga0157373_10012798 | 3300013100 | Bacteria | 6163 |
| 176 | Ga0157373_10042694 | 3300013100 | Bacteria | 3240 |
| 177 | Ga0157373_10055024 | 3300013100 | Bacteria | 2827 |
| 178 | Ga0157373_10084294 | 3300013100 | Bacteria | 2240 |
| 179 | Ga0157371_10057507 | 3300013102 | Bacteria | 2758 |
| 180 | Ga0157371_10190065 | 3300013102 | Bacteria | 1470 |
| 181 | Ga0157370_10033604 | 3300013104 | Bacteria | 5000 |
| 182 | Ga0157370_10144952 | 3300013104 | Bacteria | 2212 |
| 183 | Ga0157370_10663632 | 3300013104 | Bacteria | 953 |
| 184 | Ga0157369_10002250 | 3300013105 | Bacteria | 23203 |
| 185 | Ga0157369_10024352 | 3300013105 | Bacteria | 6735 |
| 186 | Ga0157369_10383664 | 3300013105 | Bacteria | 1458 |
| 187 | Ga0157374_10158927 | 3300013296 | Bacteria | 2201 |
| 188 | Ga0157374_10625115 | 3300013296 | Bacteria | 1088 |
| 189 | Ga0157378_10000536 | 3300013297 | Bacteria | 36043 |
| 190 | Ga0163162_10028377 | 3300013306 | Bacteria | 5537 |
| 191 | Ga0163162_11402870 | 3300013306 | Bacteria | 795 |
| 192 | Ga0157372_10000344 | 3300013307 | Bacteria | 51217 |
| 193 | Ga0157372_10013581 | 3300013307 | Bacteria | 8705 |
| 194 | Ga0157372_10036173 | 3300013307 | Bacteria | 5442 |
| 195 | Ga0157372_10037458 | 3300013307 | Bacteria | 5350 |
| 196 | Ga0157372_10051825 | 3300013307 | Bacteria | 4568 |
| 197 | Ga0157372_10057810 | 3300013307 | Bacteria | 4336 |
| 198 | Ga0157372_10586568 | 3300013307 | Bacteria | 1299 |
| 199 | Ga0157375_10584129 | 3300013308 | Bacteria | 1277 |
| 200 | Ga0163163_10000029 | 3300014325 | Bacteria | 174973 |
| 201 | Ga0163163_10672312 | 3300014325 | Bacteria | 1099 |
| 202 | Ga0182008_10020566 | 3300014497 | Bacteria | 3397 |
| 203 | Ga0182008_10029210 | 3300014497 | Bacteria | 2787 |
| 204 | Ga0157379_10001942 | 3300014968 | Bacteria | 17106 |
| 205 | Ga0157376_10002494 | 3300014969 | Bacteria | 12460 |
| 206 | Ga0157376_10005280 | 3300014969 | Bacteria | 9025 |
| 207 | Ga0182006_1053246 | 3300015261 | Bacteria | 1552 |
| 208 | Ga0182005_1002582 | 3300015265 | Bacteria | 6416 |
| 209 | Ga0163161_10073490 | 3300017792 | Bacteria | 2506 |
| 210 | Ga0206356_10496513 | 3300020070 | Bacteria | 3064 |
| 211 | Ga0206356_11576430 | 3300020070 | Bacteria | 2668 |
| 212 | Ga0206353_10732351 | 3300020082 | Bacteria | 1349 |
| 213 | Ga0224712_10096835 | 3300022467 | Bacteria | 1245 |
| 214 | Ga0209674_100149 | 3300025226 | Bacteria | 97879 |
| 215 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 216 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 217 | Ga0209563_100036 | 3300025230 | Bacteria | 448275 |
| 218 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 219 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 220 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 221 | Ga0207425_1010986 | 3300025245 | Bacteria | 2182 |
| 222 | Ga0209026_1000045 | 3300025250 | Bacteria | 263431 |
| 223 | Ga0209677_100974 | 3300025253 | Bacteria | 13904 |
| 224 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 225 | Ga0209148_1000053 | 3300025254 | Bacteria | 373506 |
| 226 | Ga0209759_1000850 | 3300025256 | Bacteria | 23820 |
| 227 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 228 | Ga0209565_1000060 | 3300025263 | Bacteria | 188543 |
| 229 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 230 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 231 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 232 | Ga0209673_1000047 | 3300025273 | Bacteria | 289276 |
| 233 | Ga0209130_1014021 | 3300025284 | Bacteria | 2029 |
| 234 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 235 | Ga0209675_1000007 | 3300025291 | Bacteria | 683430 |
| 236 | Ga0209676_1000052 | 3300025292 | Bacteria | 371539 |
| 237 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 238 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 239 | Ga0209564_1000252 | 3300025295 | Bacteria | 114416 |
| 240 | Ga0209758_1006577 | 3300025297 | Bacteria | 8257 |
| 241 | Ga0209050_1000146 | 3300025298 | Bacteria | 166930 |
| 242 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 243 | Ga0209256_1005932 | 3300025299 | Bacteria | 6743 |
| 244 | Ga0209051_1005721 | 3300025303 | Bacteria | 7179 |
| 245 | Ga0209257_1010878 | 3300025304 | Bacteria | 4500 |
| 246 | Ga0207656_10003660 | 3300025321 | Bacteria | 5313 |
| 247 | Ga0207656_10021120 | 3300025321 | Bacteria | 2597 |
| 248 | Ga0207713_1000196 | 3300025735 | Bacteria | 84000 |
| 249 | Ga0207682_10063268 | 3300025893 | Bacteria | 1553 |
| 250 | Ga0207710_10054171 | 3300025900 | Bacteria | 1806 |
| 251 | Ga0207688_10169944 | 3300025901 | Bacteria | 1296 |
| 252 | Ga0207680_10139401 | 3300025903 | Bacteria | 1606 |
| 253 | Ga0207680_10180954 | 3300025903 | Bacteria | 1425 |
| 254 | Ga0207680_10323227 | 3300025903 | Bacteria | 1079 |
| 255 | Ga0207647_10000826 | 3300025904 | Bacteria | 24065 |
| 256 | Ga0207647_10001336 | 3300025904 | Bacteria | 18958 |
| 257 | Ga0207647_10003112 | 3300025904 | Bacteria | 12460 |
| 258 | Ga0207647_10138743 | 3300025904 | Bacteria | 1425 |
| 259 | Ga0207645_10026306 | 3300025907 | Bacteria | 3761 |
| 260 | Ga0207645_10106425 | 3300025907 | Bacteria | 1813 |
| 261 | Ga0207643_10041259 | 3300025908 | Bacteria | 2600 |
| 262 | Ga0207705_10000097 | 3300025909 | Bacteria | 105579 |
| 263 | Ga0207705_10000341 | 3300025909 | Bacteria | 42108 |
| 264 | Ga0207705_10000630 | 3300025909 | Bacteria | 29454 |
| 265 | Ga0207705_10002108 | 3300025909 | Bacteria | 15463 |
| 266 | Ga0207654_10000458 | 3300025911 | Bacteria | 23295 |
| 267 | Ga0207654_10031408 | 3300025911 | Bacteria | 2924 |
| 268 | Ga0207654_10063425 | 3300025911 | Bacteria | 2169 |
| 269 | Ga0207707_10000065 | 3300025912 | Bacteria | 106546 |
| 270 | Ga0207707_10000084 | 3300025912 | Bacteria | 95228 |
| 271 | Ga0207707_10000578 | 3300025912 | Bacteria | 37213 |
| 272 | Ga0207707_10001112 | 3300025912 | Bacteria | 25518 |
| 273 | Ga0207707_10002407 | 3300025912 | Bacteria | 16839 |
| 274 | Ga0207707_10054364 | 3300025912 | Bacteria | 3485 |
| 275 | Ga0207695_10000772 | 3300025913 | Bacteria | 60706 |
| 276 | Ga0207695_10002496 | 3300025913 | Bacteria | 27107 |
| 277 | Ga0207695_10006652 | 3300025913 | Bacteria | 14917 |
| 278 | Ga0207695_10015003 | 3300025913 | Bacteria | 9141 |
| 279 | Ga0207695_10595887 | 3300025913 | Bacteria | 986 |
| 280 | Ga0207671_10007551 | 3300025914 | Bacteria | 9414 |
| 281 | Ga0207671_10088892 | 3300025914 | Bacteria | 2324 |
| 282 | Ga0207671_10143283 | 3300025914 | Bacteria | 1842 |
| 283 | Ga0207671_10249251 | 3300025914 | Bacteria | 1396 |
| 284 | Ga0207660_10005551 | 3300025917 | Bacteria | 8192 |
| 285 | Ga0207660_10006903 | 3300025917 | Bacteria | 7349 |
| 286 | Ga0207660_10010377 | 3300025917 | Bacteria | 6043 |
| 287 | Ga0207660_10011546 | 3300025917 | Bacteria | 5755 |
| 288 | Ga0207660_10184679 | 3300025917 | Bacteria | 1621 |
| 289 | Ga0207657_10002465 | 3300025919 | Bacteria | 20016 |
| 290 | Ga0207657_10006390 | 3300025919 | Bacteria | 12239 |
| 291 | Ga0207657_10007147 | 3300025919 | Bacteria | 11466 |
| 292 | Ga0207657_10256498 | 3300025919 | Bacteria | 1392 |
| 293 | Ga0207657_10483215 | 3300025919 | Bacteria | 971 |
| 294 | Ga0207649_10004292 | 3300025920 | Bacteria | 7757 |
| 295 | Ga0207649_10006309 | 3300025920 | Bacteria | 6443 |
| 296 | Ga0207649_10385596 | 3300025920 | Bacteria | 1045 |
| 297 | Ga0207649_10409040 | 3300025920 | Bacteria | 1017 |
| 298 | Ga0207649_10705864 | 3300025920 | Bacteria | 782 |
| 299 | Ga0207652_10000014 | 3300025921 | Bacteria | 196569 |
| 300 | Ga0207652_10000076 | 3300025921 | Bacteria | 107686 |
| 301 | Ga0207652_10002969 | 3300025921 | Bacteria | 14173 |
| 302 | Ga0207652_10069249 | 3300025921 | Bacteria | 3063 |
| 303 | Ga0207652_10378129 | 3300025921 | Bacteria | 1278 |
| 304 | Ga0207652_10490868 | 3300025921 | Bacteria | 1106 |
| 305 | Ga0207681_10056764 | 3300025923 | Bacteria | 2672 |
| 306 | Ga0207694_10006803 | 3300025924 | Bacteria | 8679 |
| 307 | Ga0207694_10012929 | 3300025924 | Bacteria | 6287 |
| 308 | Ga0207650_10001926 | 3300025925 | Bacteria | 14613 |
| 309 | Ga0207650_10328626 | 3300025925 | Bacteria | 1254 |
| 310 | Ga0207687_10484561 | 3300025927 | Bacteria | 1030 |
| 311 | Ga0207700_10513190 | 3300025928 | Bacteria | 1061 |
| 312 | Ga0207644_10017204 | 3300025931 | Bacteria | 4877 |
| 313 | Ga0207644_10257288 | 3300025931 | Bacteria | 1395 |
| 314 | Ga0207690_10000122 | 3300025932 | Bacteria | 64448 |
| 315 | Ga0207690_10003069 | 3300025932 | Bacteria | 10060 |
| 316 | Ga0207690_10819681 | 3300025932 | Bacteria | 770 |
| 317 | Ga0207706_10003801 | 3300025933 | Bacteria | 14393 |
| 318 | Ga0207706_10316978 | 3300025933 | Bacteria | 1357 |
| 319 | Ga0207706_10795698 | 3300025933 | Bacteria | 803 |
| 320 | Ga0207691_10009099 | 3300025940 | Bacteria | 9532 |
| 321 | Ga0207691_10019067 | 3300025940 | Bacteria | 6495 |
| 322 | Ga0207711_10010606 | 3300025941 | Bacteria | 7662 |
| 323 | Ga0207689_10034224 | 3300025942 | Bacteria | 4219 |
| 324 | Ga0207661_10007040 | 3300025944 | Bacteria | 7981 |
| 325 | Ga0207661_10071965 | 3300025944 | Bacteria | 2828 |
| 326 | Ga0207661_10113455 | 3300025944 | Bacteria | 2296 |
| 327 | Ga0207661_10266777 | 3300025944 | Bacteria | 1527 |
| 328 | Ga0207661_10289978 | 3300025944 | Bacteria | 1464 |
| 329 | Ga0207679_10026576 | 3300025945 | Bacteria | 3993 |
| 330 | Ga0207667_10000623 | 3300025949 | Bacteria | 45814 |
| 331 | Ga0207667_10000683 | 3300025949 | Bacteria | 43994 |
| 332 | Ga0207667_10008297 | 3300025949 | Bacteria | 12358 |
| 333 | Ga0207667_10019912 | 3300025949 | Bacteria | 7477 |
| 334 | Ga0207667_10038594 | 3300025949 | Bacteria | 5098 |
| 335 | Ga0207667_10049542 | 3300025949 | Bacteria | 4436 |
| 336 | Ga0207651_10070326 | 3300025960 | Bacteria | 2476 |
| 337 | Ga0207712_10000305 | 3300025961 | Bacteria | 45213 |
| 338 | Ga0207712_10024220 | 3300025961 | Bacteria | 4017 |
| 339 | Ga0207668_10017413 | 3300025972 | Bacteria | 4502 |
| 340 | Ga0207668_10290936 | 3300025972 | Bacteria | 1344 |
| 341 | Ga0207640_10000362 | 3300025981 | Bacteria | 29479 |
| 342 | Ga0207640_10002592 | 3300025981 | Bacteria | 9682 |
| 343 | Ga0207640_10003436 | 3300025981 | Bacteria | 8533 |
| 344 | Ga0207640_10022848 | 3300025981 | Bacteria | 3750 |
| 345 | Ga0207640_10053751 | 3300025981 | Bacteria | 2630 |
| 346 | Ga0207640_10062553 | 3300025981 | Bacteria | 2470 |
| 347 | Ga0207640_10135130 | 3300025981 | Bacteria | 1789 |
| 348 | Ga0207658_10000033 | 3300025986 | Bacteria | 158540 |
| 349 | Ga0207658_10009244 | 3300025986 | Bacteria | 6684 |
| 350 | Ga0207658_10513082 | 3300025986 | Bacteria | 1069 |
| 351 | Ga0207658_10805041 | 3300025986 | Bacteria | 853 |
| 352 | Ga0207677_10008057 | 3300026023 | Bacteria | 5868 |
| 353 | Ga0207703_10202544 | 3300026035 | Bacteria | 1764 |
| 354 | Ga0207639_10000437 | 3300026041 | Bacteria | 28831 |
| 355 | Ga0207639_10000514 | 3300026041 | Bacteria | 26656 |
| 356 | Ga0207639_10001917 | 3300026041 | Bacteria | 13965 |
| 357 | Ga0207639_10004441 | 3300026041 | Bacteria | 9464 |
| 358 | Ga0207639_10007675 | 3300026041 | Bacteria | 7363 |
| 359 | Ga0207639_10019356 | 3300026041 | Bacteria | 4854 |
| 360 | Ga0207678_10001678 | 3300026067 | Bacteria | 20323 |
| 361 | Ga0207678_10002250 | 3300026067 | Bacteria | 17473 |
| 362 | Ga0207678_10002720 | 3300026067 | Bacteria | 16033 |
| 363 | Ga0207678_10066322 | 3300026067 | Bacteria | 3100 |
| 364 | Ga0207678_10094476 | 3300026067 | Bacteria | 2555 |
| 365 | Ga0207678_10142849 | 3300026067 | Bacteria | 2043 |
| 366 | Ga0207678_10247627 | 3300026067 | Bacteria | 1526 |
| 367 | Ga0207702_10012063 | 3300026078 | Bacteria | 7187 |
| 368 | Ga0207702_10027084 | 3300026078 | Bacteria | 4759 |
| 369 | Ga0207702_10030282 | 3300026078 | Bacteria | 4509 |
| 370 | Ga0207702_10107880 | 3300026078 | Bacteria | 2470 |
| 371 | Ga0207641_10009512 | 3300026088 | Bacteria | 8012 |
| 372 | Ga0207641_10060657 | 3300026088 | Bacteria | 3224 |
| 373 | Ga0207641_10221528 | 3300026088 | Bacteria | 1755 |
| 374 | Ga0207641_10567599 | 3300026088 | Bacteria | 1108 |
| 375 | Ga0207648_10071014 | 3300026089 | Bacteria | 3035 |
| 376 | Ga0207648_10220498 | 3300026089 | Bacteria | 1686 |
| 377 | Ga0207674_10002322 | 3300026116 | Bacteria | 24094 |
| 378 | Ga0207674_10008389 | 3300026116 | Bacteria | 11948 |
| 379 | Ga0207674_10008726 | 3300026116 | Bacteria | 11669 |
| 380 | Ga0207674_10049463 | 3300026116 | Bacteria | 4299 |
| 381 | Ga0207675_100070634 | 3300026118 | Bacteria | 3264 |
| 382 | Ga0207683_10275069 | 3300026121 | Bacteria | 1539 |
| 383 | Ga0207698_10005406 | 3300026142 | Bacteria | 7890 |
| 384 | Ga0207698_10074478 | 3300026142 | Bacteria | 2708 |
| 385 | Ga0207698_10079744 | 3300026142 | Bacteria | 2634 |
| 386 | Ga0207698_10121696 | 3300026142 | Bacteria | 2210 |
| 387 | Ga0207698_10278447 | 3300026142 | Bacteria | 1546 |
| 388 | Ga0209371_1000018 | 3300027312 | Bacteria | 614700 |
| 389 | Ga0209974_10040660 | 3300027876 | Bacteria | 1548 |
| 390 | Ga0268266_10000017 | 3300028379 | Bacteria | 607272 |
| 391 | Ga0268266_10042299 | 3300028379 | Bacteria | 3891 |
| 392 | Ga0268266_10080274 | 3300028379 | Bacteria | 2842 |
| 393 | Ga0268266_10233736 | 3300028379 | Bacteria | 1694 |
| 394 | Ga0268266_10528461 | 3300028379 | Bacteria | 1128 |
| 395 | Ga0268266_10688073 | 3300028379 | Bacteria | 985 |
| 396 | Ga0268265_10000376 | 3300028380 | Bacteria | 48178 |
| 397 | Ga0307515_10483712 | 3300028794 | Bacteria | 850 |
| 398 | Ga0268256_1000016 | 3300030500 | Bacteria | 614700 |
| 399 | Ga0316178_1024454 | 3300030735 | Bacteria | 1433 |
| 400 | Ga0316183_1013189 | 3300030742 | Bacteria | 1273 |
| 401 | Ga0307513_10146417 | 3300031456 | Bacteria | 2279 |
| 402 | Ga0307509_10154147 | 3300031507 | Bacteria | 2207 |
| 403 | Ga0316575_10014957 | 3300031665 | Bacteria | 2921 |
| 404 | Ga0316578_10001715 | 3300031728 | Bacteria | 9149 |
| 405 | Ga0316578_10173597 | 3300031728 | Bacteria | 1299 |
| 406 | Ga0307406_10003433 | 3300031901 | Bacteria | 8623 |
| 407 | Ga0307409_100899672 | 3300031995 | Bacteria | 899 |
| 408 | Ga0307409_100995499 | 3300031995 | Bacteria | 856 |
| 409 | Ga0307414_10063368 | 3300032004 | Bacteria | 2627 |
| 410 | Ga0307414_10170466 | 3300032004 | Bacteria | 1739 |
| 411 | Ga0307414_10322283 | 3300032004 | Bacteria | 1316 |
| 412 | Ga0316580_10021272 | 3300032139 | Bacteria | 1999 |
| 413 | Ga0373937_0533753 | 3300036401 | Bacteria | 1115 |
| 414 | Ga0316584_0004592 | 3300036712 | Bacteria | 9152 |
| 415 | Ga0395899_0000164 | 3300037312 | Bacteria | 102165 |
| 416 | Ga0395900_0000163 | 3300037418 | Bacteria | 109199 |
| 417 | Ga0395900_0000217 | 3300037418 | Bacteria | 90402 |
| 418 | Ga0395900_0424266 | 3300037418 | Bacteria | 1290 |
| 419 | Ga0395898_0000029 | 3300037466 | Bacteria | 370667 |
| 420 | Ga0395898_0812526 | 3300037466 | Bacteria | 875 |
| 421 | Ga0395905_0246134 | 3300037471 | Bacteria | 1670 |
| 422 | Ga0439436_0027207 | 3300041404 | Bacteria | 1674 |
| 423 | Ga0439439_0014291 | 3300041406 | Bacteria | 1932 |
| 424 | Ga0439447_000276 | 3300041407 | Bacteria | 18194 |
| 425 | Ga0451787_716987 | 3300041441 | Bacteria | 2601 |
| 426 | Ga0451791_0862441 | 3300041451 | Bacteria | 1388 |
| 427 | Ga0451793_1023005 | 3300041452 | Bacteria | 1339 |
| 428 | Ga0451800_0141867 | 3300041459 | Bacteria | 4981 |
| 429 | Ga0451802_1110374 | 3300041460 | Bacteria | 5165 |
| 430 | Ga0451802_1696655 | 3300041460 | Bacteria | 1079 |
| 431 | Ga0451806_117351 | 3300041462 | Bacteria | 8065 |
| 432 | Ga0451807_0337638 | 3300041486 | Bacteria | 1453 |
| 433 | Ga0451807_0456601 | 3300041486 | Bacteria | 1856 |
| 434 | Ga0451807_1394303 | 3300041486 | Bacteria | 2770 |
| 435 | Ga0451837_0747194 | 3300041494 | Bacteria | 1828 |
| 436 | Ga0451837_1713807 | 3300041494 | Bacteria | 1066 |
| 437 | Ga0439445_0014309 | 3300042004 | Bacteria | 1930 |
| 438 | Ga0439432_030801 | 3300042006 | Bacteria | 1738 |
| 439 | Ga0439449_0020377 | 3300042007 | Bacteria | 2485 |
| 440 | Ga0439449_0134387 | 3300042007 | Bacteria | 920 |
| 441 | Ga0450908_000062 | 3300042184 | Bacteria | 21656 |
| 442 | Ga0466988_0067231 | 3300044536 | Bacteria | 2115 |
| 443 | Ga0466969_0015355 | 3300044656 | Bacteria | 4013 |
| 444 | Ga0466972_0001414 | 3300044658 | Bacteria | 11634 |
| 445 | Ga0466982_0000011 | 3300044672 | Bacteria | 175513 |
| 446 | Ga0466966_0043419 | 3300044684 | Bacteria | 2881 |
| 447 | Ga0466966_0153471 | 3300044684 | Bacteria | 1403 |
| 448 | Ga0466961_0036989 | 3300044693 | Bacteria | 3132 |
| 449 | Ga0466961_0323369 | 3300044693 | Bacteria | 940 |
| 450 | Ga0453684_0000531 | 3300044712 | Bacteria | 145390 |
| 451 | Ga0466970_0001522 | 3300044765 | Bacteria | 11158 |
| 452 | Ga0466970_0013448 | 3300044765 | Bacteria | 4195 |
| 453 | Ga0466970_0033643 | 3300044765 | Bacteria | 2709 |
| 454 | Ga0466970_0342560 | 3300044765 | Bacteria | 847 |
| 455 | Ga0466957_0066566 | 3300044842 | Bacteria | 2221 |
| 456 | Ga0466959_0000246 | 3300045049 | Bacteria | 33596 |
| 457 | Ga0466959_0012881 | 3300045049 | Bacteria | 6053 |
| 458 | Ga0466959_0030265 | 3300045049 | Bacteria | 4009 |
| 459 | Ga0451576_0000212 | 3300045051 | Bacteria | 145396 |
| 460 | Ga0466958_0289006 | 3300045836 | Bacteria | 1051 |
| 461 | Ga0495627_018790 | 3300046453 | Bacteria | 2325 |
| 462 | Ga0495638_0000865 | 3300046460 | Bacteria | 31467 |
| 463 | Ga0495607_0001295 | 3300046501 | Bacteria | 22335 |
| 464 | Ga0495606_0000918 | 3300046507 | Bacteria | 43503 |
| 465 | Ga0495606_0000948 | 3300046507 | Bacteria | 42725 |
| 466 | Ga0495606_0011361 | 3300046507 | Bacteria | 7271 |
| 467 | Ga0495610_0004897 | 3300046512 | Bacteria | 9726 |
| 468 | Ga0495616_0100842 | 3300046513 | Bacteria | 1354 |
| 469 | Ga0495620_0000565 | 3300046515 | Bacteria | 23373 |
| 470 | Ga0495631_0003548 | 3300046518 | Bacteria | 8529 |
| 471 | Ga0495643_0010311 | 3300046522 | Bacteria | 5754 |
| 472 | Ga0495663_0001434 | 3300046525 | Bacteria | 7522 |
| 473 | Ga0495598_0075565 | 3300046537 | Bacteria | 1070 |
| 474 | Ga0495621_0001934 | 3300046539 | Bacteria | 5448 |
| 475 | Ga0495656_0003859 | 3300046615 | Bacteria | 5098 |
| 476 | Ga0495656_0006771 | 3300046615 | Bacteria | 4027 |
| 477 | Ga0495668_0002964 | 3300046616 | Bacteria | 13323 |
| 478 | Ga0495625_0107781 | 3300046660 | Bacteria | 1906 |
| 479 | Ga0495670_0236149 | 3300046691 | Bacteria | 973 |
| 480 | Ga0495671_0005538 | 3300046692 | Bacteria | 7384 |
| 481 | Ga0495660_0026804 | 3300046810 | Bacteria | 3263 |
| 482 | Ga0495636_0006456 | 3300047318 | Bacteria | 4607 |
| 483 | Ga0495672_0000087 | 3300047320 | Bacteria | 154275 |
| 484 | Ga0495672_0055159 | 3300047320 | Bacteria | 2320 |
| 485 | Ga0495677_0035505 | 3300047445 | Bacteria | 1819 |
| 486 | Ga0495686_0004214 | 3300047472 | Bacteria | 11939 |
| 487 | Ga0495686_0004945 | 3300047472 | Bacteria | 10727 |
| 488 | Ga0495686_0038417 | 3300047472 | Bacteria | 3061 |
| 489 | Ga0495615_0003458 | 3300048090 | Bacteria | 2648 |
| 490 | Ga0496100_0178507 | 3300048903 | Bacteria | 1534 |
| 491 | Ga0496108_0319897 | 3300048911 | Bacteria | 1353 |
| 492 | Ga0496109_0074224 | 3300048912 | Bacteria | 3126 |
| 493 | Ga0496112_0501297 | 3300048915 | Bacteria | 1149 |
| 494 | Ga0496113_0071099 | 3300048916 | Bacteria | 2646 |
| 495 | Ga0496114_0033133 | 3300048917 | Bacteria | 4255 |
| 496 | Ga0496114_0229627 | 3300048917 | Bacteria | 1630 |
| 497 | Ga0496115_0000077 | 3300048918 | Bacteria | 89885 |
| 498 | Ga0496117_0009829 | 3300048920 | Bacteria | 8812 |
| 499 | Ga0496117_0028737 | 3300048920 | Bacteria | 4301 |
| 500 | Ga0496117_0034057 | 3300048920 | Bacteria | 3844 |
| 501 | Ga0496117_0326005 | 3300048920 | Bacteria | 803 |
| 502 | Ga0496118_0035939 | 3300048921 | Bacteria | 4014 |
| 503 | Ga0496118_0056691 | 3300048921 | Bacteria | 2943 |
| 504 | Ga0496118_0183806 | 3300048921 | Bacteria | 1259 |
| 505 | Ga0496119_0001836 | 3300048922 | Bacteria | 24586 |
| 506 | Ga0496120_0000273 | 3300048923 | Bacteria | 86248 |
| 507 | Ga0496121_0018990 | 3300048924 | Bacteria | 6897 |
| 508 | Ga0496122_0000417 | 3300048925 | Bacteria | 90401 |
| 509 | Ga0496122_0001517 | 3300048925 | Bacteria | 37011 |
| 510 | Ga0496123_0000137 | 3300048926 | Bacteria | 152169 |
| 511 | Ga0496123_0000323 | 3300048926 | Bacteria | 91212 |
| 512 | Ga0496123_0005271 | 3300048926 | Bacteria | 13107 |
| 513 | Ga0496123_0160107 | 3300048926 | Bacteria | 1201 |
| 514 | Ga0496123_0166846 | 3300048926 | Bacteria | 1166 |
| 515 | Ga0496124_0003391 | 3300048927 | Bacteria | 19565 |
| 516 | Ga0496124_0038566 | 3300048927 | Bacteria | 4147 |
| 517 | Ga0496125_0077822 | 3300048928 | Bacteria | 2553 |
| 518 | Ga0496126_0000047 | 3300048929 | Bacteria | 322212 |
| 519 | Ga0496126_0105791 | 3300048929 | Bacteria | 2456 |
| 520 | Ga0496126_0176797 | 3300048929 | Bacteria | 1815 |
| 521 | Ga0496126_0297614 | 3300048929 | Bacteria | 1332 |
| 522 | Ga0501031_0011342 | 3300049568 | Bacteria | 5804 |
| 523 | Ga0501031_0060029 | 3300049568 | Bacteria | 2478 |
| 524 | Ga0501032_0020663 | 3300049569 | Bacteria | 4583 |
| 525 | Ga0501032_0085227 | 3300049569 | Bacteria | 2100 |
| 526 | Ga0501033_0000648 | 3300049570 | Bacteria | 32231 |
| 527 | Ga0501033_0000683 | 3300049570 | Bacteria | 31408 |
| 528 | Ga0501033_0120810 | 3300049570 | Bacteria | 1901 |
| 529 | Ga0501033_0137547 | 3300049570 | Bacteria | 1767 |
| 530 | Ga0501034_0002782 | 3300049571 | Bacteria | 20512 |
| 531 | Ga0501034_0006063 | 3300049571 | Bacteria | 13053 |
| 532 | Ga0501034_0065145 | 3300049571 | Bacteria | 3656 |
| 533 | Ga0501034_0083756 | 3300049571 | Bacteria | 3191 |
| 534 | Ga0501034_0300286 | 3300049571 | Bacteria | 1542 |
| 535 | Ga0501036_0008180 | 3300049572 | Bacteria | 8573 |
| 536 | Ga0501036_0031163 | 3300049572 | Bacteria | 4506 |
| 537 | Ga0501036_0090604 | 3300049572 | Bacteria | 2583 |
| 538 | Ga0501036_0098252 | 3300049572 | Bacteria | 2475 |
| 539 | Ga0501037_0010898 | 3300049573 | Bacteria | 6680 |
| 540 | Ga0501037_0067090 | 3300049573 | Bacteria | 2613 |
| 541 | Ga0501037_0127846 | 3300049573 | Bacteria | 1823 |
| 542 | Ga0501037_0378757 | 3300049573 | Bacteria | 973 |
| 543 | Ga0501038_0049526 | 3300049574 | Bacteria | 3632 |
| 544 | Ga0501038_0054955 | 3300049574 | Bacteria | 3422 |
| 545 | Ga0501038_0106607 | 3300049574 | Bacteria | 2326 |
| 546 | Ga0501038_0138085 | 3300049574 | Bacteria | 1996 |
| 547 | Ga0501038_0187968 | 3300049574 | Bacteria | 1663 |
| 548 | Ga0501038_0208685 | 3300049574 | Bacteria | 1564 |
| 549 | Ga0501038_0390874 | 3300049574 | Bacteria | 1077 |
| 550 | Ga0501039_0017656 | 3300049575 | Bacteria | 5473 |
| 551 | Ga0501039_0109320 | 3300049575 | Bacteria | 2161 |
| 552 | Ga0501043_0016644 | 3300049579 | Bacteria | 5762 |
| 553 | Ga0501043_0033628 | 3300049579 | Bacteria | 4034 |
| 554 | Ga0501043_0100193 | 3300049579 | Bacteria | 2277 |
| 555 | Ga0501046_0021844 | 3300049580 | Bacteria | 5276 |
| 556 | Ga0501046_0039025 | 3300049580 | Bacteria | 3806 |
| 557 | Ga0501046_0048382 | 3300049580 | Bacteria | 3367 |
| 558 | Ga0501046_0094391 | 3300049580 | Bacteria | 2299 |
| 559 | Ga0501046_0206302 | 3300049580 | Bacteria | 1460 |
| 560 | Ga0501047_0001522 | 3300049581 | Bacteria | 22636 |
| 561 | Ga0501047_0001828 | 3300049581 | Bacteria | 20569 |
| 562 | Ga0501047_0015935 | 3300049581 | Bacteria | 7165 |
| 563 | Ga0501047_0018902 | 3300049581 | Bacteria | 6608 |
| 564 | Ga0501047_0029824 | 3300049581 | Bacteria | 5258 |
| 565 | Ga0501047_0082079 | 3300049581 | Bacteria | 3099 |
| 566 | Ga0501047_0196976 | 3300049581 | Bacteria | 1876 |
| 567 | Ga0501047_0261424 | 3300049581 | Bacteria | 1578 |
| 568 | Ga0501048_0005076 | 3300049582 | Bacteria | 10027 |
| 569 | Ga0501067_0000857 | 3300049583 | Bacteria | 16400 |
| 570 | Ga0501067_0061569 | 3300049583 | Bacteria | 2077 |
| 571 | Ga0501068_0002378 | 3300049584 | Bacteria | 10003 |
| 572 | Ga0501068_0014946 | 3300049584 | Bacteria | 4448 |
| 573 | Ga0501068_0041232 | 3300049584 | Bacteria | 2773 |
| 574 | Ga0501068_0305055 | 3300049584 | Bacteria | 1019 |
| 575 | Ga0501069_0004343 | 3300049585 | Bacteria | 7320 |
| 576 | Ga0501069_0065347 | 3300049585 | Bacteria | 2034 |
| 577 | Ga0501069_0066293 | 3300049585 | Bacteria | 2019 |
| 578 | Ga0501070_0005876 | 3300049586 | Bacteria | 10464 |
| 579 | Ga0501070_0023616 | 3300049586 | Bacteria | 5151 |
| 580 | Ga0501070_0028917 | 3300049586 | Bacteria | 4647 |
| 581 | Ga0501070_0050686 | 3300049586 | Bacteria | 3445 |
| 582 | Ga0501070_0053490 | 3300049586 | Bacteria | 3349 |
| 583 | Ga0501070_0100683 | 3300049586 | Bacteria | 2390 |
| 584 | Ga0501070_0113020 | 3300049586 | Bacteria | 2244 |
| 585 | Ga0501070_0254009 | 3300049586 | Bacteria | 1437 |
| 586 | Ga0501070_0265574 | 3300049586 | Bacteria | 1402 |
| 587 | Ga0501071_0027758 | 3300049587 | Bacteria | 3984 |
| 588 | Ga0501071_0071996 | 3300049587 | Bacteria | 2520 |
| 589 | Ga0501072_0000573 | 3300049588 | Bacteria | 26511 |
| 590 | Ga0501073_0000434 | 3300049589 | Bacteria | 28757 |
| 591 | Ga0501073_0021629 | 3300049589 | Bacteria | 4635 |
| 592 | Ga0501073_0070760 | 3300049589 | Bacteria | 2430 |
| 593 | Ga0501073_0094089 | 3300049589 | Bacteria | 2081 |
| 594 | Ga0501073_0186270 | 3300049589 | Bacteria | 1436 |
| 595 | Ga0501073_0319438 | 3300049589 | Bacteria | 1071 |
| 596 | Ga0501074_0002217 | 3300049590 | Bacteria | 13482 |
| 597 | Ga0501074_0003202 | 3300049590 | Bacteria | 11546 |
| 598 | Ga0501074_0004731 | 3300049590 | Bacteria | 9756 |
| 599 | Ga0501074_0050760 | 3300049590 | Bacteria | 2994 |
| 600 | Ga0501074_0256565 | 3300049590 | Bacteria | 1243 |
| 601 | Ga0501077_0013289 | 3300049593 | Bacteria | 5162 |
| 602 | Ga0501079_0004962 | 3300049741 | Bacteria | 9869 |
| 603 | Ga0501079_0011079 | 3300049741 | Bacteria | 6877 |
| 604 | Ga0501079_0055881 | 3300049741 | Bacteria | 3046 |
| 605 | Ga0501079_0148675 | 3300049741 | Bacteria | 1826 |
| 606 | Ga0501079_0260668 | 3300049741 | Bacteria | 1355 |
| 607 | Ga0501080_0000764 | 3300049742 | Bacteria | 26124 |
| 608 | Ga0501080_0040656 | 3300049742 | Bacteria | 4336 |
| 609 | Ga0501080_0309982 | 3300049742 | Bacteria | 1430 |
| 610 | Ga0501083_0000246 | 3300049744 | Bacteria | 34511 |
| 611 | Ga0501083_0016861 | 3300049744 | Bacteria | 5102 |
| 612 | Ga0501083_0117151 | 3300049744 | Bacteria | 1748 |
| 613 | Ga0501265_008607 | 3300049762 | Bacteria | 1219 |
| 614 | Ga0501275_000512 | 3300049772 | Bacteria | 4353 |
| 615 | Ga0501035_0004415 | 3300049822 | Bacteria | 13354 |
| 616 | Ga0501035_0013478 | 3300049822 | Bacteria | 7546 |
| 617 | Ga0501035_0029015 | 3300049822 | Bacteria | 5047 |
| 618 | Ga0501035_0062096 | 3300049822 | Bacteria | 3324 |
| 619 | Ga0501035_0156946 | 3300049822 | Bacteria | 1971 |
| 620 | Ga0501035_0160760 | 3300049822 | Bacteria | 1944 |
| 621 | Ga0501035_0485848 | 3300049822 | Bacteria | 1018 |
| 622 | Ga0501035_0785746 | 3300049822 | Bacteria | 761 |
| 623 | Ga0501044_0004071 | 3300049823 | Bacteria | 16399 |
| 624 | Ga0501044_0004952 | 3300049823 | Bacteria | 14899 |
| 625 | Ga0501044_0017726 | 3300049823 | Bacteria | 7638 |
| 626 | Ga0501044_0053442 | 3300049823 | Bacteria | 4156 |
| 627 | Ga0501044_0066121 | 3300049823 | Bacteria | 3687 |
| 628 | Ga0501044_0104618 | 3300049823 | Bacteria | 2844 |
| 629 | Ga0501044_0104735 | 3300049823 | Bacteria | 2842 |
| 630 | Ga0501044_0118517 | 3300049823 | Bacteria | 2650 |
| 631 | Ga0501044_0133983 | 3300049823 | Bacteria | 2470 |
| 632 | Ga0501044_0155242 | 3300049823 | Bacteria | 2268 |
| 633 | Ga0501045_0022730 | 3300049824 | Bacteria | 4491 |
| 634 | nmdc:mga00v17_153920_c1 | 3300050491 | Bacteria | 1478 |
| 635 | nmdc:mga00v17_2252_c1 | 3300050491 | Bacteria | 9886 |
| 636 | Ga0500610_0000365 | 3300053079 | Bacteria | 13645 |
| 637 | Ga0500651_0006630 | 3300053093 | Bacteria | 6696 |
| 638 | Ga0500651_0034171 | 3300053093 | Bacteria | 3206 |
| 639 | Ga0500651_0414209 | 3300053093 | Bacteria | 755 |
| 640 | Ga0500568_0000233 | 3300053139 | Bacteria | 47567 |
| 641 | Ga0500645_000375 | 3300053730 | Bacteria | 31466 |
| 642 | Ga0500609_012751 | 3300053731 | Bacteria | 1137 |
| 643 | Ga0501084_0073144 | 3300054114 | Bacteria | 2870 |
| 644 | Ga0501082_0000107 | 3300060353 | Bacteria | 65178 |
| 645 | Ga0501082_0054984 | 3300060353 | Bacteria | 3430 |
| 646 | Ga0501082_0156873 | 3300060353 | Bacteria | 1977 |
| 647 | Ga0466962_0012963 | 3300061719 | Bacteria | 4010 |
| 648 | 2547503589 | 2547132130 | Bacteria | 4660562 |
| 649 | 2578456967 | 2576861471 | Bacteria | 4648976 |
| 650 | 2643880455 | 2643221573 | Bacteria | 4784121 |
| 651 | 2643973376 | 2643221593 | Bacteria | 6296053 |
| 652 | 2644661030 | 2643221720 | Bacteria | 4694283 |
| 653 | 2644699112 | 2643221728 | Bacteria | 4797149 |
| 654 | 2735835413 | 2734482264 | Unclassified | 5014763 |
| 655 | 2747949943 | 2747842428 | Bacteria | 4689383 |
| 656 | 2765580539 | 2765235840 | Bacteria | 4663337 |
| 657 | 2816518437 | 2816332141 | Bacteria | 4436036 |
| 658 | 2819661328 | 2818991457 | Bacteria | 5323295 |
| 659 | 2842394454 | 2842391507 | Bacteria | 4486072 |
| 660 | 2852687199 | 2852684882 | Bacteria | 5463342 |
| 661 | 2857447000 | 2857442823 | Bacteria | 4562550 |
| 662 | 2919131044 | 2919130084 | Bacteria | 5301837 |
| 663 | 2919138752 | 2919134579 | Bacteria | 4480386 |
| 664 | 2929196283 | 2929195423 | Bacteria | 5325372 |
| 665 | 2939589840 | 2939589442 | Bacteria | 4214238 |
| 666 | 2939624953 | 2939622612 | Bacteria | 4698046 |
| 667 | 2961064871 | 2961064222 | Bacteria | 4749990 |
| 668 | 2974307615 | 2974307012 | Bacteria | 4172388 |
| 669 | 2977248326 | 2977247770 | Bacteria | 4160543 |
| 670 | 2984517181 | 2984514374 | Bacteria | 4172479 |
| 671 | 2987608827 | 2987605356 | Bacteria | 4187822 |
| 672 | 8003015465 | 8003014200 | Bacteria | 4059994 |
| 673 | 8021649751 | 8021648035 | Bacteria | 4772378 |
| 674 | JGI24736J21556_1000668 | |||
| 675 | SwRhRL2b_contig_1900888 | |||
| 676 | JGI24741J21665_1000513 | |||
| 677 | JGI24740J21852_10000733 | |||
| 678 | JGI24740J21852_10001041 | |||
| 679 | JGI25157J39369_1005706 | |||
| 680 | JGI25151J46595_10000102 | |||
| 681 | rootH1_10132375 | |||
| 682 | Ga0055539_1001541 | |||
| 683 | Ga0055533_1000809 | |||
| 684 | Ga0055525_1000138 | |||
| 685 | Ga0055527_1000281 | |||
| 686 | Ga0055527_1000330 | |||
| 687 | Ga0055535_1000843 | |||
| 688 | Ga0055542_1000835 | |||
| 689 | Ga0055542_1001160 | |||
| 690 | Ga0055529_1000717 | |||
| 691 | Ga0055529_1000943 | |||
| 692 | Ga0055526_1006479 | |||
| 693 | Ga0055537_1000059 | |||
| 694 | Ga0055537_1001365 | |||
| 695 | Ga0055524_1000019 | |||
| 696 | Ga0055536_1018818 | |||
| 697 | Ga0055534_1000012 | |||
| 698 | Ga0055534_1000112 | |||
| 699 | Ga0055528_1000007 | |||
| 700 | Ga0055528_1001337 | |||
| 701 | Ga0055530_10001674 | |||
| 702 | Ga0055530_10002094 | |||
| 703 | Ga0055531_10013881 | |||
| 704 | Ga0055531_10024818 | |||
| 705 | Ga0055531_10025507 | |||
| 706 | Ga0058861_11997967 | |||
| 707 | Ga0065714_10073865 | |||
| 708 | Ga0065715_10008446 | |||
| 709 | Ga0065715_10210857 | |||
| 710 | Ga0070658_10025096 | |||
| 711 | Ga0070683_100148995 | |||
| 712 | Ga0070670_100001962 | |||
| 713 | Ga0070670_100510566 | |||
| 714 | Ga0070666_10267594 | |||
| 715 | Ga0070680_100004327 | |||
| 716 | Ga0070682_100013741 | |||
| 717 | Ga0068868_100319978 | |||
| 718 | Ga0070691_10146967 | |||
| 719 | Ga0070691_10230441 | |||
| 720 | Ga0070661_100009383 | |||
| 721 | Ga0070661_100063255 | |||
| 722 | Ga0070661_100122479 | |||
| 723 | Ga0070692_10014304 | |||
| 724 | Ga0070692_10150891 | |||
| 725 | Ga0070669_100064482 | |||
| 726 | Ga0070675_100043947 | |||
| 727 | Ga0070671_100045193 | |||
| 728 | Ga0070671_100069039 | |||
| 729 | Ga0070673_100408221 | |||
| 730 | Ga0070659_100187046 | |||
| 731 | Ga0070667_100005400 | |||
| 732 | Ga0070667_100041398 | |||
| 733 | Ga0070667_100050689 | |||
| 734 | Ga0070667_100121267 | |||
| 735 | Ga0070667_100187140 | |||
| 736 | Ga0070663_100000042 | |||
| 737 | Ga0070663_100060983 | |||
| 738 | Ga0070663_100136117 | |||
| 739 | Ga0070663_100216615 | |||
| 740 | Ga0070662_100014495 | |||
| 741 | Ga0070662_100041992 | |||
| 742 | Ga0070681_10001872 | |||
| 743 | Ga0070681_10009167 | |||
| 744 | Ga0070681_10177415 | |||
| 745 | Ga0070681_10191941 | |||
| 746 | Ga0070681_10300998 | |||
| 747 | Ga0070681_10754860 | |||
| 748 | Ga0070679_100004396 | |||
| 749 | Ga0070679_100164520 | |||
| 750 | Ga0070679_100819986 | |||
| 751 | Ga0070684_100024537 | |||
| 752 | Ga0070684_100048363 | |||
| 753 | Ga0070684_100152602 | |||
| 754 | Ga0070684_100585753 | |||
| 755 | Ga0068853_100004195 | |||
| 756 | Ga0068853_100007213 | |||
| 757 | Ga0068853_100011114 | |||
| 758 | Ga0068853_100020141 | |||
| 759 | Ga0068853_100028892 | |||
| 760 | Ga0068853_100033305 | |||
| 761 | Ga0068853_100047267 | |||
| 762 | Ga0070672_100003657 | |||
| 763 | Ga0070686_100167171 | |||
| 764 | Ga0070696_100002079 | |||
| 765 | Ga0070693_100005032 | |||
| 766 | Ga0070693_100012299 | |||
| 767 | Ga0070693_100025853 | |||
| 768 | Ga0070665_100000028 | |||
| 769 | Ga0070665_100008261 | |||
| 770 | Ga0070665_100027661 | |||
| 771 | Ga0070665_100050597 | |||
| 772 | Ga0070665_100084459 | |||
| 773 | Ga0070665_100168154 | |||
| 774 | Ga0070665_100219067 | |||
| 775 | Ga0070665_100412820 | |||
| 776 | Ga0070665_100832480 | |||
| 777 | Ga0068855_100005951 | |||
| 778 | Ga0068855_100105650 | |||
| 779 | Ga0068855_100171818 | |||
| 780 | Ga0068855_100384484 | |||
| 781 | Ga0068855_100400853 | |||
| 782 | Ga0068855_100640412 | |||
| 783 | Ga0070664_100023351 | |||
| 784 | Ga0070664_100203877 | |||
| 785 | Ga0068857_100053558 | |||
| 786 | Ga0068857_100182944 | |||
| 787 | Ga0068857_100358917 | |||
| 788 | Ga0068854_100004688 | |||
| 789 | Ga0068854_100024611 | |||
| 790 | Ga0068854_100053357 | |||
| 791 | Ga0068854_100070907 | |||
| 792 | Ga0068854_100080020 | |||
| 793 | Ga0068854_100542130 | |||
| 794 | Ga0068854_100546565 | |||
| 795 | Ga0068856_100012643 | |||
| 796 | Ga0068856_100161736 | |||
| 797 | Ga0068856_100406692 | |||
| 798 | Ga0068856_100452062 | |||
| 799 | Ga0068852_100005973 | |||
| 800 | Ga0068852_100068716 | |||
| 801 | Ga0068852_100082660 | |||
| 802 | Ga0068852_100212373 | |||
| 803 | Ga0068852_100345615 | |||
| 804 | Ga0068852_100348820 | |||
| 805 | Ga0068859_100000280 | |||
| 806 | Ga0068851_10011937 | |||
| 807 | Ga0068851_10027186 | |||
| 808 | Ga0068851_10035589 | |||
| 809 | Ga0068870_10057938 | |||
| 810 | Ga0068863_100018882 | |||
| 811 | Ga0068863_100066084 | |||
| 812 | Ga0068863_100077761 | |||
| 813 | Ga0068863_100240960 | |||
| 814 | Ga0068860_100124956 | |||
| 815 | Ga0068862_100000215 | |||
| 816 | Ga0068862_100111847 | |||
| 817 | Ga0081539_10008186 | |||
| 818 | Ga0097621_100206800 | |||
| 819 | Ga0068871_100039983 | |||
| 820 | Ga0068871_100199111 | |||
| 821 | Ga0068871_100215267 | |||
| 822 | Ga0068865_100017143 | |||
| 823 | Ga0068865_100053746 | |||
| 824 | Ga0097620_100000280 | |||
| 825 | Ga0105251_10000205 | |||
| 826 | Ga0105240_10087720 | |||
| 827 | Ga0105240_10103888 | |||
| 828 | Ga0105240_10152371 | |||
| 829 | Ga0105245_10723360 | |||
| 830 | Ga0105247_10124470 | |||
| 831 | Ga0105241_10017637 | |||
| 832 | Ga0105241_10055846 | |||
| 833 | Ga0105241_10103439 | |||
| 834 | Ga0105242_10675965 | |||
| 835 | Ga0105248_10000120 | |||
| 836 | Ga0105248_10309656 | |||
| 837 | Ga0105237_10010356 | |||
| 838 | Ga0105237_10618370 | |||
| 839 | Ga0105238_10006626 | |||
| 840 | Ga0105238_10011965 | |||
| 841 | Ga0105238_10110821 | |||
| 842 | Ga0105238_10192207 | |||
| 843 | Ga0105249_10000898 | |||
| 844 | Ga0105249_11264596 | |||
| 845 | Ga0105239_10005391 | |||
| 846 | Ga0105239_10033812 | |||
| 847 | Ga0105239_10107680 | |||
| 848 | Ga0157373_10012798 | |||
| 849 | Ga0157373_10042694 | |||
| 850 | Ga0157373_10055024 | |||
| 851 | Ga0157373_10084294 | |||
| 852 | Ga0157371_10057507 | |||
| 853 | Ga0157371_10190065 | |||
| 854 | Ga0157370_10033604 | |||
| 855 | Ga0157370_10144952 | |||
| 856 | Ga0157370_10663632 | |||
| 857 | Ga0157369_10002250 | |||
| 858 | Ga0157369_10024352 | |||
| 859 | Ga0157369_10383664 | |||
| 860 | Ga0157374_10158927 | |||
| 861 | Ga0157374_10625115 | |||
| 862 | Ga0157378_10000536 | |||
| 863 | Ga0163162_10028377 | |||
| 864 | Ga0163162_11402870 | |||
| 865 | Ga0157372_10000344 | |||
| 866 | Ga0157372_10013581 | |||
| 867 | Ga0157372_10036173 | |||
| 868 | Ga0157372_10037458 | |||
| 869 | Ga0157372_10051825 | |||
| 870 | Ga0157372_10057810 | |||
| 871 | Ga0157372_10586568 | |||
| 872 | Ga0157375_10584129 | |||
| 873 | Ga0163163_10000029 | |||
| 874 | Ga0163163_10672312 | |||
| 875 | Ga0182008_10020566 | |||
| 876 | Ga0182008_10029210 | |||
| 877 | Ga0157379_10001942 | |||
| 878 | Ga0157376_10002494 | |||
| 879 | Ga0157376_10005280 | |||
| 880 | Ga0182006_1053246 | |||
| 881 | Ga0182005_1002582 | |||
| 882 | Ga0163161_10073490 | |||
| 883 | Ga0206356_10496513 | |||
| 884 | Ga0206356_11576430 | |||
| 885 | Ga0206353_10732351 | |||
| 886 | Ga0224712_10096835 | |||
| 887 | Ga0209674_100149 | |||
| 888 | Ga0209672_100004 | |||
| 889 | Ga0209672_100008 | |||
| 890 | Ga0209563_100036 | |||
| 891 | Ga0209258_100003 | |||
| 892 | Ga0209258_100004 | |||
| 893 | Ga0209258_100008 | |||
| 894 | Ga0207425_1010986 | |||
| 895 | Ga0209026_1000045 | |||
| 896 | Ga0209677_100974 | |||
| 897 | Ga0209148_1000025 | |||
| 898 | Ga0209148_1000053 | |||
| 899 | Ga0209759_1000850 | |||
| 900 | Ga0209565_1000001 | |||
| 901 | Ga0209565_1000060 | |||
| 902 | Ga0209455_1000004 | |||
| 903 | Ga0209455_1000007 | |||
| 904 | Ga0209673_1000001 | |||
| 905 | Ga0209673_1000047 | |||
| 906 | Ga0209130_1014021 | |||
| 907 | Ga0209675_1000001 | |||
| 908 | Ga0209675_1000007 | |||
| 909 | Ga0209676_1000052 | |||
| 910 | Ga0209025_1000006 | |||
| 911 | Ga0209564_1000001 | |||
| 912 | Ga0209564_1000252 | |||
| 913 | Ga0209758_1006577 | |||
| 914 | Ga0209050_1000146 | |||
| 915 | Ga0209256_1000006 | |||
| 916 | Ga0209256_1005932 | |||
| 917 | Ga0209051_1005721 | |||
| 918 | Ga0209257_1010878 | |||
| 919 | Ga0207656_10003660 | |||
| 920 | Ga0207656_10021120 | |||
| 921 | Ga0207713_1000196 | |||
| 922 | Ga0207682_10063268 | |||
| 923 | Ga0207710_10054171 | |||
| 924 | Ga0207688_10169944 | |||
| 925 | Ga0207680_10139401 | |||
| 926 | Ga0207680_10180954 | |||
| 927 | Ga0207680_10323227 | |||
| 928 | Ga0207647_10000826 | |||
| 929 | Ga0207647_10001336 | |||
| 930 | Ga0207647_10003112 | |||
| 931 | Ga0207647_10138743 | |||
| 932 | Ga0207645_10026306 | |||
| 933 | Ga0207645_10106425 | |||
| 934 | Ga0207643_10041259 | |||
| 935 | Ga0207705_10000097 | |||
| 936 | Ga0207705_10000341 | |||
| 937 | Ga0207705_10000630 | |||
| 938 | Ga0207705_10002108 | |||
| 939 | Ga0207654_10000458 | |||
| 940 | Ga0207654_10031408 | |||
| 941 | Ga0207654_10063425 | |||
| 942 | Ga0207707_10000065 | |||
| 943 | Ga0207707_10000084 | |||
| 944 | Ga0207707_10000578 | |||
| 945 | Ga0207707_10001112 | |||
| 946 | Ga0207707_10002407 | |||
| 947 | Ga0207707_10054364 | |||
| 948 | Ga0207695_10000772 | |||
| 949 | Ga0207695_10002496 | |||
| 950 | Ga0207695_10006652 | |||
| 951 | Ga0207695_10015003 | |||
| 952 | Ga0207695_10595887 | |||
| 953 | Ga0207671_10007551 | |||
| 954 | Ga0207671_10088892 | |||
| 955 | Ga0207671_10143283 | |||
| 956 | Ga0207671_10249251 | |||
| 957 | Ga0207660_10005551 | |||
| 958 | Ga0207660_10006903 | |||
| 959 | Ga0207660_10010377 | |||
| 960 | Ga0207660_10011546 | |||
| 961 | Ga0207660_10184679 | |||
| 962 | Ga0207657_10002465 | |||
| 963 | Ga0207657_10006390 | |||
| 964 | Ga0207657_10007147 | |||
| 965 | Ga0207657_10256498 | |||
| 966 | Ga0207657_10483215 | |||
| 967 | Ga0207649_10004292 | |||
| 968 | Ga0207649_10006309 | |||
| 969 | Ga0207649_10385596 | |||
| 970 | Ga0207649_10409040 | |||
| 971 | Ga0207649_10705864 | |||
| 972 | Ga0207652_10000014 | |||
| 973 | Ga0207652_10000076 | |||
| 974 | Ga0207652_10002969 | |||
| 975 | Ga0207652_10069249 | |||
| 976 | Ga0207652_10378129 | |||
| 977 | Ga0207652_10490868 | |||
| 978 | Ga0207681_10056764 | |||
| 979 | Ga0207694_10006803 | |||
| 980 | Ga0207694_10012929 | |||
| 981 | Ga0207650_10001926 | |||
| 982 | Ga0207650_10328626 | |||
| 983 | Ga0207687_10484561 | |||
| 984 | Ga0207700_10513190 | |||
| 985 | Ga0207644_10017204 | |||
| 986 | Ga0207644_10257288 | |||
| 987 | Ga0207690_10000122 | |||
| 988 | Ga0207690_10003069 | |||
| 989 | Ga0207690_10819681 | |||
| 990 | Ga0207706_10003801 | |||
| 991 | Ga0207706_10316978 | |||
| 992 | Ga0207706_10795698 | |||
| 993 | Ga0207691_10009099 | |||
| 994 | Ga0207691_10019067 | |||
| 995 | Ga0207711_10010606 | |||
| 996 | Ga0207689_10034224 | |||
| 997 | Ga0207661_10007040 | |||
| 998 | Ga0207661_10071965 | |||
| 999 | Ga0207661_10113455 | |||
| 1000 | Ga0207661_10266777 | |||
| 1001 | Ga0207661_10289978 | |||
| 1002 | Ga0207679_10026576 | |||
| 1003 | Ga0207667_10000623 | |||
| 1004 | Ga0207667_10000683 | |||
| 1005 | Ga0207667_10008297 | |||
| 1006 | Ga0207667_10019912 | |||
| 1007 | Ga0207667_10038594 | |||
| 1008 | Ga0207667_10049542 | |||
| 1009 | Ga0207651_10070326 | |||
| 1010 | Ga0207712_10000305 | |||
| 1011 | Ga0207712_10024220 | |||
| 1012 | Ga0207668_10017413 | |||
| 1013 | Ga0207668_10290936 | |||
| 1014 | Ga0207640_10000362 | |||
| 1015 | Ga0207640_10002592 | |||
| 1016 | Ga0207640_10003436 | |||
| 1017 | Ga0207640_10022848 | |||
| 1018 | Ga0207640_10053751 | |||
| 1019 | Ga0207640_10062553 | |||
| 1020 | Ga0207640_10135130 | |||
| 1021 | Ga0207658_10000033 | |||
| 1022 | Ga0207658_10009244 | |||
| 1023 | Ga0207658_10513082 | |||
| 1024 | Ga0207658_10805041 | |||
| 1025 | Ga0207677_10008057 | |||
| 1026 | Ga0207703_10202544 | |||
| 1027 | Ga0207639_10000437 | |||
| 1028 | Ga0207639_10000514 | |||
| 1029 | Ga0207639_10001917 | |||
| 1030 | Ga0207639_10004441 | |||
| 1031 | Ga0207639_10007675 | |||
| 1032 | Ga0207639_10019356 | |||
| 1033 | Ga0207678_10001678 | |||
| 1034 | Ga0207678_10002250 | |||
| 1035 | Ga0207678_10002720 | |||
| 1036 | Ga0207678_10066322 | |||
| 1037 | Ga0207678_10094476 | |||
| 1038 | Ga0207678_10142849 | |||
| 1039 | Ga0207678_10247627 | |||
| 1040 | Ga0207702_10012063 | |||
| 1041 | Ga0207702_10027084 | |||
| 1042 | Ga0207702_10030282 | |||
| 1043 | Ga0207702_10107880 | |||
| 1044 | Ga0207641_10009512 | |||
| 1045 | Ga0207641_10060657 | |||
| 1046 | Ga0207641_10221528 | |||
| 1047 | Ga0207641_10567599 | |||
| 1048 | Ga0207648_10071014 | |||
| 1049 | Ga0207648_10220498 | |||
| 1050 | Ga0207674_10002322 | |||
| 1051 | Ga0207674_10008389 | |||
| 1052 | Ga0207674_10008726 | |||
| 1053 | Ga0207674_10049463 | |||
| 1054 | Ga0207675_100070634 | |||
| 1055 | Ga0207683_10275069 | |||
| 1056 | Ga0207698_10005406 | |||
| 1057 | Ga0207698_10074478 | |||
| 1058 | Ga0207698_10079744 | |||
| 1059 | Ga0207698_10121696 | |||
| 1060 | Ga0207698_10278447 | |||
| 1061 | Ga0209371_1000018 | |||
| 1062 | Ga0209974_10040660 | |||
| 1063 | Ga0268266_10000017 | |||
| 1064 | Ga0268266_10042299 | |||
| 1065 | Ga0268266_10080274 | |||
| 1066 | Ga0268266_10233736 | |||
| 1067 | Ga0268266_10528461 | |||
| 1068 | Ga0268266_10688073 | |||
| 1069 | Ga0268265_10000376 | |||
| 1070 | Ga0307515_10483712 | |||
| 1071 | Ga0268256_1000016 | |||
| 1072 | Ga0316178_1024454 | |||
| 1073 | Ga0316183_1013189 | |||
| 1074 | Ga0307513_10146417 | |||
| 1075 | Ga0307509_10154147 | |||
| 1076 | Ga0316575_10014957 | |||
| 1077 | Ga0316578_10001715 | |||
| 1078 | Ga0316578_10173597 | |||
| 1079 | Ga0307406_10003433 | |||
| 1080 | Ga0307409_100899672 | |||
| 1081 | Ga0307409_100995499 | |||
| 1082 | Ga0307414_10063368 | |||
| 1083 | Ga0307414_10170466 | |||
| 1084 | Ga0307414_10322283 | |||
| 1085 | Ga0316580_10021272 | |||
| 1086 | Ga0373937_0533753 | |||
| 1087 | Ga0316584_0004592 | |||
| 1088 | Ga0395899_0000164 | |||
| 1089 | Ga0395900_0000163 | |||
| 1090 | Ga0395900_0000217 | |||
| 1091 | Ga0395900_0424266 | |||
| 1092 | Ga0395898_0000029 | |||
| 1093 | Ga0395898_0812526 | |||
| 1094 | Ga0395905_0246134 | |||
| 1095 | Ga0439436_0027207 | |||
| 1096 | Ga0439439_0014291 | |||
| 1097 | Ga0439447_000276 | |||
| 1098 | Ga0451787_716987 | |||
| 1099 | Ga0451791_0862441 | |||
| 1100 | Ga0451793_1023005 | |||
| 1101 | Ga0451800_0141867 | |||
| 1102 | Ga0451802_1110374 | |||
| 1103 | Ga0451802_1696655 | |||
| 1104 | Ga0451806_117351 | |||
| 1105 | Ga0451807_0337638 | |||
| 1106 | Ga0451807_0456601 | |||
| 1107 | Ga0451807_1394303 | |||
| 1108 | Ga0451837_0747194 | |||
| 1109 | Ga0451837_1713807 | |||
| 1110 | Ga0439445_0014309 | |||
| 1111 | Ga0439432_030801 | |||
| 1112 | Ga0439449_0020377 | |||
| 1113 | Ga0439449_0134387 | |||
| 1114 | Ga0450908_000062 | |||
| 1115 | Ga0466988_0067231 | |||
| 1116 | Ga0466969_0015355 | |||
| 1117 | Ga0466972_0001414 | |||
| 1118 | Ga0466982_0000011 | |||
| 1119 | Ga0466966_0043419 | |||
| 1120 | Ga0466966_0153471 | |||
| 1121 | Ga0466961_0036989 | |||
| 1122 | Ga0466961_0323369 | |||
| 1123 | Ga0453684_0000531 | |||
| 1124 | Ga0466970_0001522 | |||
| 1125 | Ga0466970_0013448 | |||
| 1126 | Ga0466970_0033643 | |||
| 1127 | Ga0466970_0342560 | |||
| 1128 | Ga0466957_0066566 | |||
| 1129 | Ga0466959_0000246 | |||
| 1130 | Ga0466959_0012881 | |||
| 1131 | Ga0466959_0030265 | |||
| 1132 | Ga0451576_0000212 | |||
| 1133 | Ga0466958_0289006 | |||
| 1134 | Ga0495627_018790 | |||
| 1135 | Ga0495638_0000865 | |||
| 1136 | Ga0495607_0001295 | |||
| 1137 | Ga0495606_0000918 | |||
| 1138 | Ga0495606_0000948 | |||
| 1139 | Ga0495606_0011361 | |||
| 1140 | Ga0495610_0004897 | |||
| 1141 | Ga0495616_0100842 | |||
| 1142 | Ga0495620_0000565 | |||
| 1143 | Ga0495631_0003548 | |||
| 1144 | Ga0495643_0010311 | |||
| 1145 | Ga0495663_0001434 | |||
| 1146 | Ga0495598_0075565 | |||
| 1147 | Ga0495621_0001934 | |||
| 1148 | Ga0495656_0003859 | |||
| 1149 | Ga0495656_0006771 | |||
| 1150 | Ga0495668_0002964 | |||
| 1151 | Ga0495625_0107781 | |||
| 1152 | Ga0495670_0236149 | |||
| 1153 | Ga0495671_0005538 | |||
| 1154 | Ga0495660_0026804 | |||
| 1155 | Ga0495636_0006456 | |||
| 1156 | Ga0495672_0000087 | |||
| 1157 | Ga0495672_0055159 | |||
| 1158 | Ga0495677_0035505 | |||
| 1159 | Ga0495686_0004214 | |||
| 1160 | Ga0495686_0004945 | |||
| 1161 | Ga0495686_0038417 | |||
| 1162 | Ga0495615_0003458 | |||
| 1163 | Ga0496100_0178507 | |||
| 1164 | Ga0496108_0319897 | |||
| 1165 | Ga0496109_0074224 | |||
| 1166 | Ga0496112_0501297 | |||
| 1167 | Ga0496113_0071099 | |||
| 1168 | Ga0496114_0033133 | |||
| 1169 | Ga0496114_0229627 | |||
| 1170 | Ga0496115_0000077 | |||
| 1171 | Ga0496117_0009829 | |||
| 1172 | Ga0496117_0028737 | |||
| 1173 | Ga0496117_0034057 | |||
| 1174 | Ga0496117_0326005 | |||
| 1175 | Ga0496118_0035939 | |||
| 1176 | Ga0496118_0056691 | |||
| 1177 | Ga0496118_0183806 | |||
| 1178 | Ga0496119_0001836 | |||
| 1179 | Ga0496120_0000273 | |||
| 1180 | Ga0496121_0018990 | |||
| 1181 | Ga0496122_0000417 | |||
| 1182 | Ga0496122_0001517 | |||
| 1183 | Ga0496123_0000137 | |||
| 1184 | Ga0496123_0000323 | |||
| 1185 | Ga0496123_0005271 | |||
| 1186 | Ga0496123_0160107 | |||
| 1187 | Ga0496123_0166846 | |||
| 1188 | Ga0496124_0003391 | |||
| 1189 | Ga0496124_0038566 | |||
| 1190 | Ga0496125_0077822 | |||
| 1191 | Ga0496126_0000047 | |||
| 1192 | Ga0496126_0105791 | |||
| 1193 | Ga0496126_0176797 | |||
| 1194 | Ga0496126_0297614 | |||
| 1195 | Ga0501031_0011342 | |||
| 1196 | Ga0501031_0060029 | |||
| 1197 | Ga0501032_0020663 | |||
| 1198 | Ga0501032_0085227 | |||
| 1199 | Ga0501033_0000648 | |||
| 1200 | Ga0501033_0000683 | |||
| 1201 | Ga0501033_0120810 | |||
| 1202 | Ga0501033_0137547 | |||
| 1203 | Ga0501034_0002782 | |||
| 1204 | Ga0501034_0006063 | |||
| 1205 | Ga0501034_0065145 | |||
| 1206 | Ga0501034_0083756 | |||
| 1207 | Ga0501034_0300286 | |||
| 1208 | Ga0501036_0008180 | |||
| 1209 | Ga0501036_0031163 | |||
| 1210 | Ga0501036_0090604 | |||
| 1211 | Ga0501036_0098252 | |||
| 1212 | Ga0501037_0010898 | |||
| 1213 | Ga0501037_0067090 | |||
| 1214 | Ga0501037_0127846 | |||
| 1215 | Ga0501037_0378757 | |||
| 1216 | Ga0501038_0049526 | |||
| 1217 | Ga0501038_0054955 | |||
| 1218 | Ga0501038_0106607 | |||
| 1219 | Ga0501038_0138085 | |||
| 1220 | Ga0501038_0187968 | |||
| 1221 | Ga0501038_0208685 | |||
| 1222 | Ga0501038_0390874 | |||
| 1223 | Ga0501039_0017656 | |||
| 1224 | Ga0501039_0109320 | |||
| 1225 | Ga0501043_0016644 | |||
| 1226 | Ga0501043_0033628 | |||
| 1227 | Ga0501043_0100193 | |||
| 1228 | Ga0501046_0021844 | |||
| 1229 | Ga0501046_0039025 | |||
| 1230 | Ga0501046_0048382 | |||
| 1231 | Ga0501046_0094391 | |||
| 1232 | Ga0501046_0206302 | |||
| 1233 | Ga0501047_0001522 | |||
| 1234 | Ga0501047_0001828 | |||
| 1235 | Ga0501047_0015935 | |||
| 1236 | Ga0501047_0018902 | |||
| 1237 | Ga0501047_0029824 | |||
| 1238 | Ga0501047_0082079 | |||
| 1239 | Ga0501047_0196976 | |||
| 1240 | Ga0501047_0261424 | |||
| 1241 | Ga0501048_0005076 | |||
| 1242 | Ga0501067_0000857 | |||
| 1243 | Ga0501067_0061569 | |||
| 1244 | Ga0501068_0002378 | |||
| 1245 | Ga0501068_0014946 | |||
| 1246 | Ga0501068_0041232 | |||
| 1247 | Ga0501068_0305055 | |||
| 1248 | Ga0501069_0004343 | |||
| 1249 | Ga0501069_0065347 | |||
| 1250 | Ga0501069_0066293 | |||
| 1251 | Ga0501070_0005876 | |||
| 1252 | Ga0501070_0023616 | |||
| 1253 | Ga0501070_0028917 | |||
| 1254 | Ga0501070_0050686 | |||
| 1255 | Ga0501070_0053490 | |||
| 1256 | Ga0501070_0100683 | |||
| 1257 | Ga0501070_0113020 | |||
| 1258 | Ga0501070_0254009 | |||
| 1259 | Ga0501070_0265574 | |||
| 1260 | Ga0501071_0027758 | |||
| 1261 | Ga0501071_0071996 | |||
| 1262 | Ga0501072_0000573 | |||
| 1263 | Ga0501073_0000434 | |||
| 1264 | Ga0501073_0021629 | |||
| 1265 | Ga0501073_0070760 | |||
| 1266 | Ga0501073_0094089 | |||
| 1267 | Ga0501073_0186270 | |||
| 1268 | Ga0501073_0319438 | |||
| 1269 | Ga0501074_0002217 | |||
| 1270 | Ga0501074_0003202 | |||
| 1271 | Ga0501074_0004731 | |||
| 1272 | Ga0501074_0050760 | |||
| 1273 | Ga0501074_0256565 | |||
| 1274 | Ga0501077_0013289 | |||
| 1275 | Ga0501079_0004962 | |||
| 1276 | Ga0501079_0011079 | |||
| 1277 | Ga0501079_0055881 | |||
| 1278 | Ga0501079_0148675 | |||
| 1279 | Ga0501079_0260668 | |||
| 1280 | Ga0501080_0000764 | |||
| 1281 | Ga0501080_0040656 | |||
| 1282 | Ga0501080_0309982 | |||
| 1283 | Ga0501083_0000246 | |||
| 1284 | Ga0501083_0016861 | |||
| 1285 | Ga0501083_0117151 | |||
| 1286 | Ga0501265_008607 | |||
| 1287 | Ga0501275_000512 | |||
| 1288 | Ga0501035_0004415 | |||
| 1289 | Ga0501035_0013478 | |||
| 1290 | Ga0501035_0029015 | |||
| 1291 | Ga0501035_0062096 | |||
| 1292 | Ga0501035_0156946 | |||
| 1293 | Ga0501035_0160760 | |||
| 1294 | Ga0501035_0485848 | |||
| 1295 | Ga0501035_0785746 | |||
| 1296 | Ga0501044_0004071 | |||
| 1297 | Ga0501044_0004952 | |||
| 1298 | Ga0501044_0017726 | |||
| 1299 | Ga0501044_0053442 | |||
| 1300 | Ga0501044_0066121 | |||
| 1301 | Ga0501044_0104618 | |||
| 1302 | Ga0501044_0104735 | |||
| 1303 | Ga0501044_0118517 | |||
| 1304 | Ga0501044_0133983 | |||
| 1305 | Ga0501044_0155242 | |||
| 1306 | Ga0501045_0022730 | |||
| 1307 | nmdc:mga00v17_153920_c1 | |||
| 1308 | nmdc:mga00v17_2252_c1 | |||
| 1309 | Ga0500610_0000365 | |||
| 1310 | Ga0500651_0006630 | |||
| 1311 | Ga0500651_0034171 | |||
| 1312 | Ga0500651_0414209 | |||
| 1313 | Ga0500568_0000233 | |||
| 1314 | Ga0500645_000375 | |||
| 1315 | Ga0500609_012751 | |||
| 1316 | Ga0501084_0073144 | |||
| 1317 | Ga0501082_0000107 | |||
| 1318 | Ga0501082_0054984 | |||
| 1319 | Ga0501082_0156873 | |||
| 1320 | Ga0466962_0012963 | |||
| 1321 | 2547503589 | |||
| 1322 | 2578456967 | |||
| 1323 | 2643880455 | |||
| 1324 | 2643973376 | |||
| 1325 | 2644661030 | |||
| 1326 | 2644699112 | |||
| 1327 | 2735835413 | |||
| 1328 | 2747949943 | |||
| 1329 | 2765580539 | |||
| 1330 | 2816518437 | |||
| 1331 | 2819661328 | |||
| 1332 | 2842394454 | |||
| 1333 | 2852687199 | |||
| 1334 | 2857447000 | |||
| 1335 | 2919131044 | |||
| 1336 | 2919138752 | |||
| 1337 | 2929196283 | |||
| 1338 | 2939589840 | |||
| 1339 | 2939624953 | |||
| 1340 | 2961064871 | |||
| 1341 | 2974307615 | |||
| 1342 | 2977248326 | |||
| 1343 | 2984517181 | |||
| 1344 | 2987608827 | |||
| 1345 | 8003015465 | |||
| 1346 | 8021649751 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qhv-assembly1.cif.gz_A | structural basis of octanoic acid recognition by lipoate-protein ligase b | 0.9035 | 20 | 225 |
| 1w66-assembly1.cif.gz_A | structure of a lipoate-protein ligase b from mycobacterium tuberculosis | 0.9011 | 21 | 220 |
| 2qhv-assembly1.cif.gz_A | structural basis of octanoic acid recognition by lipoate-protein ligase b | 0.8829 | 20 | 225 |
| 2aru-assembly1.cif.gz_A | crystal structure of lipoate-protein ligase a bound with atp | 0.8271 | 20 | 228 |
| 1w66-assembly1.cif.gz_A | structure of a lipoate-protein ligase b from mycobacterium tuberculosis | 0.8267 | 21 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P60720_2_203_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9822 | 21 | 217 | 3.30.930.10 |
| af_P60720_2_203_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9535 | 21 | 217 | 3.30.930.10 |
| af_Q9SXP7_6_215_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9468 | 21 | 218 | 3.30.930.10 |
| 2qhuA01 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9243 | 21 | 219 | 3.30.930.10 |
| af_O36017_5_216_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9214 | 30 | 217 | 3.30.930.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B0VSD3-F1-model_v4 | lipoyl(octanoyl) transferase (EC 2.3.1.181) | 0.9952 | 20 | 108 |
GO:0033819
|
| AF-A0A3D3D3L3-F1-model_v4 | deleted | 0.9931 | 22 | 99 |
|
| AF-A0A090P1B0-F1-model_v4 | deleted | 0.9919 | 21 | 139 |
|
| AF-A0A2J0QT14-F1-model_v4 | deleted | 0.9916 | 76 | 181 |
|
| AF-A0A7Z7KMB8-F1-model_v4 | deleted | 0.9907 | 21 | 104 |
|