F474277

General Info

Members Datasets Scaffolds Average Seq Length
673 399 1344 152

Family's Representative Sequence

Representative Sequence 3300004799|Ga0058863_10022113|Ga0058863_100221131
Length 182
Sequence MAPAVMLEPHTPFIALGTEITAMAVDMFLKLDGIKGESLDATHKDEIDVLAWSWGLSQSGSTHVGGGSGAGKVNIQDISFTKWVDKSSPVLFYDCAAGKHITEATLTVRKAGEKPLEYLKINLKDLIVSSISTGGSGGEDRLTENVTLNFGKVQVTYTPQKKDGSGDAQVVNGWDIQTNQKL

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
172 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
177 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
178 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
190 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
203 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
204 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
205 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
206 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
207 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
225 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
231 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
235 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
239 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
244 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
247 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
250 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
253 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
254 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
266 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
273 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
274 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
275 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
276 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
277 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
282 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
283 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
293 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
296 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
297 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
303 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
317 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
318 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
319 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
320 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
321 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
323 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
324 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
340 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
343 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
359 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
360 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
361 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
362 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
363 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
364 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
365 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
366 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
367 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
368 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
369 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
370 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
376 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
377 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
378 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
379 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
380 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
381 2643221556 Massilia sp. Root1485 Isolate Unclassified
382 2643221583 Caulobacter sp. Root655 Isolate Unclassified
383 2643221584 Caulobacter sp. Root656 Isolate Unclassified
384 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
385 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
386 2643221640 Caulobacter sp. Root342 Isolate Unclassified
387 2643221642 Caulobacter sp. Root343 Isolate Unclassified
388 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
389 2643221684 Massilia sp. Root133 Isolate Unclassified
390 2818991435 Caulobacter henricii 536 Isolate Unclassified
391 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
392 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
393 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
394 2904424332 Duganella sp. 1411 Isolate Rhizosphere
395 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
396 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
397 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
398 639633007 Azoarcus olearius BH72 Isolate Unclassified
399 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.23
Metatranscriptomes 5.05
Isolates 3.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.36
Nodule 0.45
Rhizoplane 2.67
Rhizosphere 80.98
Stem 0
Stem Tuber 0
Unclassified 8.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_10022113 3300004799 Bacteria 950
2 JGI25152J39213_1002469 3300002773 Bacteria 7006
3 JGI25150J39212_1002495 3300002774 Bacteria 4557
4 JGI25153J46596_10005824 3300003215 Bacteria 6404
5 rootL2_10093421 3300003322 Bacteria 4672
6 rootL2_10128998 3300003322 Bacteria 1743
7 rootH1_10132987 3300003323 Bacteria 3341
8 Ga0055526_1005023 3300003771 Bacteria 7737
9 Ga0055526_1005529 3300003771 Bacteria 7229
10 Ga0055537_1007066 3300003773 Bacteria 2761
11 Ga0055524_1000182 3300003775 Bacteria 70730
12 Ga0055524_1006279 3300003775 Bacteria 5174
13 Ga0055524_1082106 3300003775 Bacteria 583
14 Ga0055534_1042626 3300003784 Bacteria 664
15 Ga0055530_10000037 3300003791 Bacteria 116741
16 Ga0055530_10012424 3300003791 Bacteria 2971
17 Ga0055530_10043783 3300003791 Bacteria 1078
18 Ga0055540_1003124 3300003792 Bacteria 8208
19 Ga0055531_10000557 3300003794 Bacteria 32742
20 Ga0055531_10043071 3300003794 Bacteria 1282
21 Ga0058858_1158617 3300004785 Bacteria 863
22 Ga0058859_10842610 3300004798 Unclassified 794
23 Ga0058863_11830666 3300004799 Bacteria 4264
24 Ga0058861_10021452 3300004800 Bacteria 901
25 Ga0058861_11921876 3300004800 Bacteria 3764
26 Ga0058860_11397319 3300004801 Bacteria 715
27 Ga0058860_11538292 3300004801 Bacteria 1545
28 Ga0058860_12134235 3300004801 Bacteria 785
29 Ga0058862_10008156 3300004803 Bacteria 1568
30 Ga0058862_12692344 3300004803 Bacteria 3473
31 Ga0058862_12871773 3300004803 Bacteria 1217
32 Ga0065165_1000615 3300005262 Bacteria 51725
33 Ga0070658_10105728 3300005327 Bacteria 2328
34 Ga0070683_100071547 3300005329 Bacteria 3236
35 Ga0068869_100179405 3300005334 Bacteria 1660
36 Ga0070666_10241251 3300005335 Bacteria 1278
37 Ga0070680_100002662 3300005336 Bacteria 13236
38 Ga0070680_100006366 3300005336 Bacteria 8968
39 Ga0070680_100116848 3300005336 Bacteria 2224
40 Ga0070680_100224391 3300005336 Unclassified 1586
41 Ga0070680_100587637 3300005336 Bacteria 956
42 Ga0070680_100807117 3300005336 Unclassified 809
43 Ga0068868_101040511 3300005338 Bacteria 751
44 Ga0070660_100498789 3300005339 Unclassified 1013
45 Ga0070691_10287996 3300005341 Unclassified 893
46 Ga0070687_100723982 3300005343 Bacteria 697
47 Ga0070669_100133338 3300005353 Bacteria 1908
48 Ga0070675_100450676 3300005354 Bacteria 1154
49 Ga0070674_100231661 3300005356 Unclassified 1442
50 Ga0070688_100048473 3300005365 Bacteria 2640
51 Ga0070667_100197769 3300005367 Bacteria 1783
52 Ga0070709_10198086 3300005434 Bacteria 1421
53 Ga0070714_100546863 3300005435 Bacteria 1108
54 Ga0070694_100012071 3300005444 Bacteria 5365
55 Ga0070708_100044519 3300005445 Bacteria 3903
56 Ga0070708_100143747 3300005445 Bacteria 2214
57 Ga0070678_100031236 3300005456 Bacteria 3671
58 Ga0070678_100091416 3300005456 Bacteria 2335
59 Ga0070678_100165666 3300005456 Bacteria 1795
60 Ga0070678_100256737 3300005456 Unclassified 1468
61 Ga0070662_100264234 3300005457 Bacteria 1387
62 Ga0070681_10001907 3300005458 Bacteria 18810
63 Ga0070681_10193820 3300005458 Bacteria 1951
64 Ga0068867_100110734 3300005459 Unclassified 2109
65 Ga0070685_10311616 3300005466 Unclassified 1064
66 Ga0070706_100059014 3300005467 Bacteria 3541
67 Ga0070706_100560864 3300005467 Bacteria 1062
68 Ga0070707_100362489 3300005468 Bacteria 1408
69 Ga0070698_100333961 3300005471 Bacteria 1447
70 Ga0070698_101096864 3300005471 Bacteria 744
71 Ga0070679_100001193 3300005530 Bacteria 22833
72 Ga0070679_100001971 3300005530 Bacteria 18411
73 Ga0070679_100171998 3300005530 Unclassified 2139
74 Ga0070679_100219890 3300005530 Bacteria 1861
75 Ga0070684_100083380 3300005535 Bacteria 2832
76 Ga0070697_100254164 3300005536 Unclassified 1503
77 Ga0070697_101475259 3300005536 Bacteria 608
78 Ga0070672_100331843 3300005543 Bacteria 1294
79 Ga0070665_100027839 3300005548 Bacteria 5692
80 Ga0068855_100135254 3300005563 Bacteria 2813
81 Ga0068855_100324882 3300005563 Bacteria 1700
82 Ga0068855_100748706 3300005563 Unclassified 1042
83 Ga0068855_101143462 3300005563 Bacteria 812
84 Ga0070664_100391096 3300005564 Bacteria 1270
85 Ga0068854_100610014 3300005578 Bacteria 933
86 Ga0068856_100451997 3300005614 Bacteria 1305
87 Ga0068852_100052884 3300005616 Bacteria 3493
88 Ga0068852_101225068 3300005616 Unclassified 772
89 Ga0068859_100007356 3300005617 Bacteria 11171
90 Ga0068859_100100382 3300005617 Bacteria 2950
91 Ga0068864_100070433 3300005618 Bacteria 3043
92 Ga0068864_100083232 3300005618 Bacteria 2809
93 Ga0068866_10025543 3300005718 Bacteria 2778
94 Ga0068851_10083545 3300005834 Bacteria 1671
95 Ga0068863_100088411 3300005841 Bacteria 2936
96 Ga0068863_100153974 3300005841 Bacteria 2200
97 Ga0068863_100373581 3300005841 Bacteria 1391
98 Ga0068863_100409645 3300005841 Bacteria 1327
99 Ga0068863_100930611 3300005841 Bacteria 870
100 Ga0068858_100181912 3300005842 Bacteria 1985
101 Ga0068858_100896103 3300005842 Bacteria 867
102 Ga0068860_100629064 3300005843 Bacteria 1080
103 Ga0068862_100189320 3300005844 Unclassified 1851
104 Ga0081538_10069435 3300005981 Bacteria 1952
105 Ga0075364_10501552 3300006051 Bacteria 830
106 Ga0070716_100549068 3300006173 Bacteria 861
107 Ga0075366_10122003 3300006195 Bacteria 1571
108 Ga0097621_100715318 3300006237 Bacteria 923
109 Ga0075370_10033556 3300006353 Bacteria 2874
110 Ga0075370_10838997 3300006353 Bacteria 561
111 Ga0068871_100251431 3300006358 Bacteria 1540
112 Ga0068871_100432399 3300006358 Unclassified 1177
113 Ga0075428_100022695 3300006844 Bacteria 6946
114 Ga0075430_100015375 3300006846 Bacteria 6515
115 Ga0075431_100000941 3300006847 Bacteria 25660
116 Ga0075433_11423449 3300006852 Unclassified 599
117 Ga0075429_100024405 3300006880 Bacteria 5246
118 Ga0075429_101330961 3300006880 Unclassified 626
119 Ga0068865_100262622 3300006881 Bacteria 1367
120 Ga0097620_100007356 3300006931 Bacteria 11171
121 Ga0097620_100100384 3300006931 Bacteria 2950
122 Ga0079104_1000333 3300006946 Bacteria 57718
123 Ga0105251_10023081 3300009011 Bacteria 3217
124 Ga0105251_10063868 3300009011 Bacteria 1727
125 Ga0105244_10000079 3300009036 Bacteria 107070
126 Ga0105240_10159674 3300009093 Bacteria 2679
127 Ga0111539_10836118 3300009094 Bacteria 1071
128 Ga0105247_10127208 3300009101 Bacteria 1657
129 Ga0105247_11075912 3300009101 Bacteria 633
130 Ga0114129_10131009 3300009147 Bacteria 3444
131 Ga0105243_10772248 3300009148 Unclassified 944
132 Ga0105243_11258507 3300009148 Unclassified 755
133 Ga0105242_10789854 3300009176 Bacteria 939
134 Ga0105248_10045882 3300009177 Bacteria 4899
135 Ga0105248_10225457 3300009177 Bacteria 2109
136 Ga0105248_10983521 3300009177 Bacteria 953
137 Ga0105238_10680362 3300009551 Bacteria 1040
138 Ga0157327_1023884 3300012512 Bacteria 713
139 Ga0157370_10010706 3300013104 Bacteria 9650
140 Ga0157369_10502363 3300013105 Bacteria 1254
141 Ga0157369_10758997 3300013105 Bacteria 997
142 Ga0157374_10258764 3300013296 Bacteria 1714
143 Ga0157378_10205693 3300013297 Bacteria 1864
144 Ga0163162_10001320 3300013306 Bacteria 23166
145 Ga0163162_10022603 3300013306 Bacteria 6199
146 Ga0163162_10088294 3300013306 Bacteria 3180
147 Ga0163162_11681545 3300013306 Bacteria 725
148 Ga0157372_10020425 3300013307 Bacteria 7145
149 Ga0157372_10195755 3300013307 Bacteria 2341
150 Ga0157372_10237871 3300013307 Unclassified 2113
151 Ga0157372_10757280 3300013307 Bacteria 1129
152 Ga0157375_10013360 3300013308 Bacteria 7302
153 Ga0157375_10161954 3300013308 Bacteria 2380
154 Ga0163163_10000226 3300014325 Bacteria 58312
155 Ga0157380_10078260 3300014326 Bacteria 2697
156 Ga0157380_10454051 3300014326 Bacteria 1232
157 Ga0157376_10281662 3300014969 Bacteria 1566
158 Ga0157376_11069920 3300014969 Bacteria 831
159 Ga0163161_10103296 3300017792 Bacteria 2124
160 Ga0163161_10588390 3300017792 Unclassified 916
161 Ga0206356_11608922 3300020070 Bacteria 1095
162 Ga0154015_1582689 3300020610 Bacteria 630
163 Ga0213872_10159972 3300021361 Unclassified 980
164 Ga0213876_10000155 3300021384 Bacteria 72486
165 Ga0213875_10116180 3300021388 Bacteria 1250
166 Ga0207425_1000452 3300025245 Bacteria 26650
167 Ga0209129_1000027 3300025258 Bacteria 409587
168 Ga0209565_1004369 3300025263 Bacteria 4312
169 Ga0209565_1011078 3300025263 Bacteria 2211
170 Ga0209673_1011233 3300025273 Bacteria 3706
171 Ga0209673_1020665 3300025273 Bacteria 2326
172 Ga0209675_1006973 3300025291 Bacteria 4424
173 Ga0209675_1018926 3300025291 Bacteria 1912
174 Ga0209675_1047707 3300025291 Bacteria 899
175 Ga0209564_1000046 3300025295 Bacteria 373787
176 Ga0209564_1000142 3300025295 Bacteria 178742
177 Ga0209564_1000818 3300025295 Bacteria 42378
178 Ga0209564_1005525 3300025295 Bacteria 7164
179 Ga0209758_1000052 3300025297 Bacteria 338962
180 Ga0209758_1000246 3300025297 Bacteria 111041
181 Ga0209050_1000058 3300025298 Bacteria 325558
182 Ga0209050_1001069 3300025298 Bacteria 33615
183 Ga0209050_1014421 3300025298 Bacteria 3405
184 Ga0209050_1018180 3300025298 Bacteria 2746
185 Ga0209256_1000024 3300025299 Bacteria 448909
186 Ga0209256_1001716 3300025299 Bacteria 21021
187 Ga0209256_1014547 3300025299 Bacteria 2822
188 Ga0209256_1028527 3300025299 Bacteria 1572
189 Ga0209051_1000155 3300025303 Bacteria 129560
190 Ga0209257_1000236 3300025304 Bacteria 129543
191 Ga0209257_1000259 3300025304 Bacteria 122101
192 Ga0207656_10103245 3300025321 Bacteria 1309
193 Ga0207655_1000188 3300025728 Bacteria 109393
194 Ga0207713_1035062 3300025735 Bacteria 2170
195 Ga0207710_10091215 3300025900 Bacteria 1426
196 Ga0207680_10348640 3300025903 Unclassified 1040
197 Ga0207699_10541724 3300025906 Bacteria 843
198 Ga0207643_10378225 3300025908 Bacteria 892
199 Ga0207705_10080606 3300025909 Bacteria 2372
200 Ga0207705_10211804 3300025909 Bacteria 1470
201 Ga0207684_11223657 3300025910 Unclassified 621
202 Ga0207707_10000732 3300025912 Bacteria 32480
203 Ga0207707_10067747 3300025912 Bacteria 3109
204 Ga0207695_10367320 3300025913 Bacteria 1325
205 Ga0207663_10574231 3300025916 Bacteria 884
206 Ga0207660_10014120 3300025917 Bacteria 5245
207 Ga0207660_10032840 3300025917 Bacteria 3585
208 Ga0207660_10113048 3300025917 Bacteria 2046
209 Ga0207660_10647779 3300025917 Bacteria 861
210 Ga0207657_10399050 3300025919 Bacteria 1082
211 Ga0207649_10355808 3300025920 Bacteria 1085
212 Ga0207652_10022573 3300025921 Bacteria 5207
213 Ga0207652_10051639 3300025921 Bacteria 3525
214 Ga0207652_11408186 3300025921 Unclassified 600
215 Ga0207646_10218024 3300025922 Bacteria 1724
216 Ga0207681_10209874 3300025923 Unclassified 1500
217 Ga0207694_11156925 3300025924 Bacteria 655
218 Ga0207659_10418885 3300025926 Unclassified 1123
219 Ga0207659_10446840 3300025926 Bacteria 1088
220 Ga0207664_10466076 3300025929 Bacteria 1129
221 Ga0207690_10581868 3300025932 Bacteria 912
222 Ga0207706_10313860 3300025933 Bacteria 1365
223 Ga0207709_10075225 3300025935 Unclassified 2158
224 Ga0207704_10153059 3300025938 Bacteria 1630
225 Ga0207704_10473609 3300025938 Bacteria 1004
226 Ga0207704_10532023 3300025938 Unclassified 952
227 Ga0207704_10798840 3300025938 Bacteria 788
228 Ga0207665_10036171 3300025939 Bacteria 3282
229 Ga0207665_10099209 3300025939 Bacteria 2031
230 Ga0207691_10003268 3300025940 Bacteria 15788
231 Ga0207691_10357168 3300025940 Bacteria 1250
232 Ga0207711_10021013 3300025941 Bacteria 5451
233 Ga0207711_10877436 3300025941 Bacteria 834
234 Ga0207711_11414388 3300025941 Bacteria 638
235 Ga0207661_10019114 3300025944 Bacteria 5101
236 Ga0207667_10107881 3300025949 Bacteria 2873
237 Ga0207667_10599363 3300025949 Bacteria 1111
238 Ga0207651_10360502 3300025960 Bacteria 1227
239 Ga0207668_10110183 3300025972 Bacteria 2064
240 Ga0207640_10307673 3300025981 Bacteria 1256
241 Ga0207703_10652173 3300026035 Bacteria 999
242 Ga0207639_10216025 3300026041 Bacteria 1653
243 Ga0207702_10069213 3300026078 Bacteria 3034
244 Ga0207641_10024381 3300026088 Bacteria 4986
245 Ga0207641_10314902 3300026088 Bacteria 1482
246 Ga0207641_10364067 3300026088 Bacteria 1381
247 Ga0207641_10666483 3300026088 Bacteria 1023
248 Ga0207648_10046412 3300026089 Unclassified 3809
249 Ga0207648_10558719 3300026089 Unclassified 1052
250 Ga0207676_10110448 3300026095 Bacteria 2300
251 Ga0207676_10155485 3300026095 Bacteria 1975
252 Ga0207676_11867293 3300026095 Unclassified 599
253 Ga0207674_10233765 3300026116 Bacteria 1786
254 Ga0207674_11363754 3300026116 Bacteria 678
255 Ga0207675_100085272 3300026118 Bacteria 2964
256 Ga0207683_10036996 3300026121 Bacteria 4250
257 Ga0207683_10520972 3300026121 Bacteria 1099
258 Ga0207698_10180921 3300026142 Bacteria 1867
259 Ga0207698_11795013 3300026142 Unclassified 628
260 Ga0209281_1000322 3300027111 Bacteria 84374
261 Ga0268265_10639436 3300028380 Bacteria 1021
262 Ga0268264_10019844 3300028381 Bacteria 5491
263 Ga0268264_10891426 3300028381 Unclassified 892
264 Ga0265318_10318036 3300028577 Bacteria 568
265 Ga0265340_10010391 3300031247 Bacteria 4980
266 Ga0307513_10007974 3300031456 Bacteria 13615
267 Ga0307513_10075226 3300031456 Bacteria 3508
268 Ga0307513_10082794 3300031456 Bacteria 3302
269 Ga0307513_10720466 3300031456 Bacteria 703
270 Ga0307509_10004925 3300031507 Bacteria 18905
271 Ga0307408_100035841 3300031548 Bacteria 3483
272 Ga0316575_10002218 3300031665 Bacteria 6482
273 Ga0265342_10497903 3300031712 Bacteria 622
274 Ga0316576_10007196 3300031727 Bacteria 6983
275 Ga0316576_10024025 3300031727 Bacteria 4253
276 Ga0316576_11164423 3300031727 Unclassified 545
277 Ga0316578_10003454 3300031728 Bacteria 7227
278 Ga0316578_10033641 3300031728 Bacteria 2938
279 Ga0316578_10100083 3300031728 Bacteria 1737
280 Ga0316578_10200339 3300031728 Unclassified 1202
281 Ga0316577_10015853 3300031733 Bacteria 4148
282 Ga0307410_10150694 3300031852 Bacteria 1731
283 Ga0307416_100483379 3300032002 Bacteria 1299
284 Ga0307411_10890372 3300032005 Unclassified 790
285 Ga0316585_10000135 3300032137 Bacteria 14374
286 Ga0316585_10015525 3300032137 Bacteria 2286
287 Ga0316580_10003872 3300032139 Bacteria 4295
288 Ga0316593_10000488 3300032168 Bacteria 7342
289 Ga0316593_10012916 3300032168 Bacteria 2461
290 Ga0316592_1008726 3300033524 Bacteria 2013
291 Ga0316592_1045478 3300033524 Bacteria 977
292 Ga0316592_1045972 3300033524 Bacteria 972
293 Ga0316586_1013613 3300033527 Bacteria 1274
294 Ga0316586_1070231 3300033527 Unclassified 644
295 Ga0316586_1110879 3300033527 Unclassified 530
296 Ga0316588_1028846 3300033528 Bacteria 1296
297 Ga0316588_1074923 3300033528 Unclassified 834
298 Ga0316587_1009144 3300033529 Bacteria 1568
299 Ga0316587_1073882 3300033529 Unclassified 640
300 Ga0316596_1001923 3300033541 Bacteria 4353
301 Ga0316596_1006082 3300033541 Bacteria 2791
302 Ga0316596_1039698 3300033541 Bacteria 1235
303 Ga0316596_1191131 3300033541 Unclassified 568
304 Ga0373957_0109252 3300035120 Bacteria 1113
305 Ga0373955_0301483 3300035172 Bacteria 966
306 Ga0316574_0004903 3300035398 Bacteria 7088
307 Ga0316574_0007153 3300035398 Bacteria 6101
308 Ga0316574_0015422 3300035398 Bacteria 4433
309 Ga0316574_0121960 3300035398 Bacteria 1674
310 Ga0373931_0644463 3300035691 Bacteria 696
311 Ga0373937_0032536 3300036401 Bacteria 4730
312 Ga0373937_0066233 3300036401 Bacteria 3326
313 Ga0373937_0542939 3300036401 Bacteria 1104
314 Ga0310109_049593 3300036534 Unclassified 541
315 Ga0316582_0004722 3300036647 Bacteria 6934
316 Ga0316582_0106664 3300036647 Bacteria 1861
317 Ga0316582_0227241 3300036647 Unclassified 1277
318 Ga0316582_0382842 3300036647 Unclassified 969
319 Ga0316584_0055392 3300036712 Bacteria 2969
320 Ga0316584_0236936 3300036712 Unclassified 1337
321 Ga0395899_0121509 3300037312 Bacteria 1870
322 Ga0395900_0061088 3300037418 Bacteria 3875
323 Ga0395900_0286488 3300037418 Bacteria 1637
324 Ga0395900_0329012 3300037418 Bacteria 1506
325 Ga0395900_0912106 3300037418 Bacteria 801
326 Ga0395898_0140228 3300037466 Bacteria 2314
327 Ga0395898_0245260 3300037466 Bacteria 1708
328 Ga0395905_0120906 3300037471 Bacteria 2461
329 Ga0395905_0131211 3300037471 Bacteria 2356
330 Ga0395905_0347648 3300037471 Bacteria 1374
331 Ga0395905_0573681 3300037471 Bacteria 1029
332 Ga0436364_0657416 3300037853 Bacteria 2095
333 Ga0395901_0675161 3300038443 Bacteria 1033
334 Ga0400491_20990 3300038727 Bacteria 6987
335 Ga0436365_0124459 3300039437 Bacteria 1901
336 Ga0436365_1190722 3300039437 Bacteria 68726
337 Ga0436365_1930978 3300039437 Bacteria 2880
338 Ga0436360_0198049 3300039438 Bacteria 2298
339 Ga0436361_0028601 3300039447 Unclassified 4066
340 Ga0436361_1127599 3300039447 Unclassified 3363
341 Ga0439437_024272 3300042000 Bacteria 744
342 Ga0439448_0083741 3300042005 Bacteria 1073
343 Ga0439455_0020843 3300042012 Bacteria 1557
344 Ga0450890_034873 3300042127 Bacteria 728
345 Ga0439435_0027498 3300042436 Bacteria 1522
346 Ga0439459_0002620 3300042438 Bacteria 2789
347 Ga0451577_0001743 3300042876 Bacteria 28044
348 Ga0439440_0086160 3300042993 Bacteria 837
349 Ga0466969_0189687 3300044656 Bacteria 939
350 Ga0466972_0108906 3300044658 Bacteria 1309
351 Ga0466965_0059795 3300044683 Bacteria 1902
352 Ga0466961_0269813 3300044693 Bacteria 1042
353 Ga0466961_0420101 3300044693 Bacteria 810
354 Ga0466964_0112789 3300044706 Bacteria 1215
355 Ga0466968_0452414 3300044735 Bacteria 635
356 Ga0466970_0187859 3300044765 Bacteria 1147
357 Ga0466957_0019001 3300044842 Bacteria 4040
358 Ga0466959_0106308 3300045049 Bacteria 2006
359 Ga0466959_0164492 3300045049 Bacteria 1558
360 Ga0451576_0038173 3300045051 Bacteria 5083
361 Ga0466958_0183561 3300045836 Bacteria 1328
362 Ga0466967_0174395 3300045976 Bacteria 2025
363 Ga0466967_1034409 3300045976 Bacteria 818
364 Ga0495592_0003568 3300046454 Bacteria 11180
365 Ga0495603_0021112 3300046455 Bacteria 3942
366 Ga0495603_0040025 3300046455 Bacteria 2807
367 Ga0495590_0123163 3300046457 Bacteria 929
368 Ga0495591_000806 3300046458 Bacteria 22207
369 Ga0495591_137425 3300046458 Bacteria 590
370 Ga0495629_0000436 3300046459 Bacteria 34789
371 Ga0495629_0008971 3300046459 Bacteria 7343
372 Ga0495629_0110817 3300046459 Bacteria 1913
373 Ga0495638_0001574 3300046460 Bacteria 20441
374 Ga0495638_0004077 3300046460 Bacteria 11193
375 Ga0495638_0004290 3300046460 Bacteria 10819
376 Ga0495638_0011608 3300046460 Bacteria 6066
377 Ga0495638_0506840 3300046460 Bacteria 607
378 Ga0495641_0021538 3300046461 Bacteria 3242
379 Ga0495641_0076252 3300046461 Bacteria 1503
380 Ga0495651_0016516 3300046462 Bacteria 5718
381 Ga0495651_0066336 3300046462 Bacteria 2755
382 Ga0495653_0001432 3300046463 Bacteria 18609
383 Ga0495653_0009893 3300046463 Bacteria 7797
384 Ga0495653_0024886 3300046463 Bacteria 4817
385 Ga0495650_0006227 3300046471 Bacteria 7479
386 Ga0495580_0000454 3300046472 Bacteria 33966
387 Ga0495580_0007150 3300046472 Bacteria 8988
388 Ga0495580_0105818 3300046472 Bacteria 1954
389 Ga0495582_0008680 3300046473 Bacteria 5603
390 Ga0495582_0784309 3300046473 Bacteria 551
391 Ga0495605_0003916 3300046474 Bacteria 8809
392 Ga0495605_0009041 3300046474 Bacteria 5608
393 Ga0495605_0159260 3300046474 Bacteria 1003
394 Ga0495662_0013480 3300046476 Bacteria 3979
395 Ga0495662_0017902 3300046476 Bacteria 3429
396 Ga0495662_0091525 3300046476 Bacteria 1483
397 Ga0495664_0007110 3300046477 Bacteria 6202
398 Ga0495664_0016662 3300046477 Bacteria 4190
399 Ga0495664_0129883 3300046477 Bacteria 1525
400 Ga0495594_0038887 3300046499 Bacteria 2599
401 Ga0495594_0223823 3300046499 Bacteria 1073
402 Ga0495594_0293698 3300046499 Unclassified 926
403 Ga0495596_0038128 3300046500 Bacteria 1900
404 Ga0495596_0044388 3300046500 Bacteria 1749
405 Ga0495607_0037403 3300046501 Bacteria 2916
406 Ga0495583_0022721 3300046506 Bacteria 3190
407 Ga0495606_0041956 3300046507 Bacteria 3064
408 Ga0495606_0074761 3300046507 Bacteria 2122
409 Ga0495606_0092735 3300046507 Bacteria 1854
410 Ga0495606_0265903 3300046507 Bacteria 944
411 Ga0495608_0141134 3300046511 Bacteria 1537
412 Ga0495610_0083855 3300046512 Bacteria 1457
413 Ga0495610_0092869 3300046512 Bacteria 1365
414 Ga0495616_0000031 3300046513 Bacteria 130957
415 Ga0495616_0193990 3300046513 Bacteria 896
416 Ga0495618_0006609 3300046514 Bacteria 7031
417 Ga0495618_0040991 3300046514 Bacteria 2915
418 Ga0495618_0072283 3300046514 Bacteria 2195
419 Ga0495620_0017356 3300046515 Bacteria 3590
420 Ga0495628_0011906 3300046516 Bacteria 7334
421 Ga0495628_0025554 3300046516 Bacteria 4824
422 Ga0495628_0110360 3300046516 Bacteria 2116
423 Ga0495628_0119613 3300046516 Bacteria 2021
424 Ga0495630_0008810 3300046517 Bacteria 7243
425 Ga0495630_0028380 3300046517 Bacteria 4158
426 Ga0495631_0230616 3300046518 Bacteria 790
427 Ga0495632_0011423 3300046519 Bacteria 5181
428 Ga0495632_0069336 3300046519 Bacteria 1698
429 Ga0495643_0361069 3300046522 Bacteria 648
430 Ga0495643_0365649 3300046522 Bacteria 643
431 Ga0495644_0082696 3300046523 Bacteria 1210
432 Ga0495648_0019060 3300046524 Bacteria 4838
433 Ga0495648_0023871 3300046524 Bacteria 4177
434 Ga0495648_0089242 3300046524 Bacteria 1730
435 Ga0495666_0001761 3300046526 Bacteria 10678
436 Ga0495666_0186969 3300046526 Bacteria 955
437 Ga0495642_0131993 3300046528 Bacteria 1075
438 Ga0495642_0161316 3300046528 Bacteria 972
439 Ga0495642_0468128 3300046528 Bacteria 557
440 Ga0495652_0096851 3300046529 Bacteria 2401
441 Ga0495654_0060996 3300046530 Bacteria 1812
442 Ga0495665_0000684 3300046531 Bacteria 17401
443 Ga0495665_0082262 3300046531 Bacteria 1692
444 Ga0495665_0324830 3300046531 Bacteria 785
445 Ga0495640_0120825 3300046533 Bacteria 1703
446 Ga0495586_0006614 3300046535 Bacteria 6190
447 Ga0495586_0243830 3300046535 Bacteria 1024
448 Ga0495587_0000623 3300046536 Bacteria 23941
449 Ga0495587_0004114 3300046536 Bacteria 9621
450 Ga0495609_0051556 3300046538 Bacteria 1832
451 Ga0495597_0027595 3300046542 Bacteria 2603
452 Ga0495597_0039268 3300046542 Bacteria 2120
453 Ga0495645_0002458 3300046543 Bacteria 12581
454 Ga0495645_0051268 3300046543 Bacteria 3003
455 Ga0495622_0000018 3300046557 Bacteria 173985
456 Ga0495667_0036463 3300046559 Bacteria 3283
457 Ga0495667_0216758 3300046559 Bacteria 1222
458 Ga0495668_0000028 3300046616 Bacteria 286629
459 Ga0495668_0008200 3300046616 Bacteria 6558
460 Ga0495668_0043959 3300046616 Bacteria 2483
461 Ga0495668_0102187 3300046616 Bacteria 1568
462 Ga0495668_0473743 3300046616 Bacteria 689
463 Ga0495634_0004462 3300046642 Bacteria 10980
464 Ga0495634_0261936 3300046642 Bacteria 1054
465 Ga0495634_0365306 3300046642 Bacteria 862
466 Ga0495611_0052761 3300046648 Bacteria 1835
467 Ga0495611_0218241 3300046648 Bacteria 887
468 Ga0495625_0060515 3300046660 Bacteria 2683
469 Ga0495625_0068594 3300046660 Bacteria 2492
470 Ga0495625_0213719 3300046660 Bacteria 1267
471 Ga0495635_0003028 3300046663 Bacteria 11548
472 Ga0495635_0015141 3300046663 Bacteria 5394
473 Ga0495661_0003061 3300046665 Bacteria 12582
474 Ga0495661_0003818 3300046665 Bacteria 11024
475 Ga0495661_0043052 3300046665 Bacteria 2778
476 Ga0495661_0074687 3300046665 Bacteria 1972
477 Ga0495588_0268636 3300046674 Bacteria 899
478 Ga0495657_0079428 3300046675 Bacteria 2125
479 Ga0495599_0076400 3300046678 Bacteria 2091
480 Ga0495599_0107804 3300046678 Bacteria 1735
481 Ga0495623_0002881 3300046679 Bacteria 11335
482 Ga0495623_0019699 3300046679 Bacteria 4361
483 Ga0495646_0030921 3300046680 Bacteria 3340
484 Ga0495646_0033452 3300046680 Bacteria 3195
485 Ga0495646_0055206 3300046680 Bacteria 2386
486 Ga0495669_0030615 3300046684 Bacteria 2362
487 Ga0495669_0113642 3300046684 Bacteria 1266
488 Ga0495669_0121767 3300046684 Unclassified 1223
489 Ga0495613_0011548 3300046689 Bacteria 6565
490 Ga0495613_0108647 3300046689 Bacteria 2000
491 Ga0495613_0164360 3300046689 Bacteria 1577
492 Ga0495624_0006943 3300046690 Bacteria 7985
493 Ga0495624_0022029 3300046690 Bacteria 4218
494 Ga0495624_0027504 3300046690 Bacteria 3723
495 Ga0495624_0054486 3300046690 Bacteria 2521
496 Ga0495670_0004408 3300046691 Bacteria 6906
497 Ga0495670_0280063 3300046691 Bacteria 892
498 Ga0495671_0012743 3300046692 Bacteria 4581
499 Ga0495589_0002595 3300046794 Bacteria 10041
500 Ga0495589_0016853 3300046794 Bacteria 3751
501 Ga0495589_0049937 3300046794 Bacteria 2070
502 Ga0495600_0001426 3300046809 Bacteria 13213
503 Ga0495600_0039484 3300046809 Bacteria 3074
504 Ga0495600_0054224 3300046809 Bacteria 2619
505 Ga0495600_0676955 3300046809 Bacteria 622
506 Ga0495660_0002945 3300046810 Bacteria 10660
507 Ga0495660_0037357 3300046810 Bacteria 2705
508 Ga0495660_0201221 3300046810 Bacteria 951
509 Ga0495581_0000308 3300047315 Bacteria 23951
510 Ga0495581_0010566 3300047315 Bacteria 5337
511 Ga0495604_0002498 3300047317 Bacteria 14692
512 Ga0495604_0022448 3300047317 Bacteria 5038
513 Ga0495674_0095829 3300047319 Bacteria 2529
514 Ga0495672_0002721 3300047320 Bacteria 15870
515 Ga0495672_0016868 3300047320 Bacteria 4902
516 Ga0495676_0010249 3300047321 Bacteria 8506
517 Ga0495676_0031983 3300047321 Bacteria 4445
518 Ga0495676_0240225 3300047321 Bacteria 1240
519 Ga0495680_0022450 3300047322 Bacteria 5257
520 Ga0495680_0043303 3300047322 Bacteria 3566
521 Ga0495680_0335970 3300047322 Bacteria 1054
522 Ga0495683_0016611 3300047323 Bacteria 3821
523 Ga0495683_0056996 3300047323 Bacteria 1942
524 Ga0495687_061217 3300047443 Bacteria 1549
525 Ga0495675_0009494 3300047444 Bacteria 6057
526 Ga0495675_0036533 3300047444 Bacteria 3132
527 Ga0495675_0138038 3300047444 Bacteria 1512
528 Ga0495679_000008 3300047446 Bacteria 367186
529 Ga0495679_000300 3300047446 Bacteria 39860
530 Ga0495679_000528 3300047446 Bacteria 27024
531 Ga0495673_0008048 3300047469 Bacteria 5974
532 Ga0495673_0159263 3300047469 Bacteria 867
533 Ga0495673_0213161 3300047469 Bacteria 718
534 Ga0495681_0027734 3300047470 Bacteria 2925
535 Ga0495681_0028017 3300047470 Bacteria 2905
536 Ga0495681_0055594 3300047470 Bacteria 1845
537 Ga0495684_0042294 3300047471 Bacteria 3490
538 Ga0495686_0000080 3300047472 Bacteria 201665
539 Ga0495593_0003365 3300047673 Bacteria 9580
540 Ga0495593_0010047 3300047673 Bacteria 5481
541 Ga0495602_0011757 3300048088 Bacteria 9040
542 Ga0495602_0033683 3300048088 Bacteria 4801
543 Ga0495602_0048159 3300048088 Bacteria 3834
544 Ga0495602_0720530 3300048088 Bacteria 675
545 Ga0495614_0001749 3300048089 Bacteria 9485
546 Ga0495614_0015119 3300048089 Bacteria 3368
547 Ga0495626_0005137 3300048091 Bacteria 7774
548 Ga0495626_0026687 3300048091 Bacteria 2812
549 Ga0495626_0041344 3300048091 Bacteria 2172
550 Ga0495626_0090685 3300048091 Bacteria 1344
551 Ga0496100_0834814 3300048903 Bacteria 722
552 Ga0496101_0183918 3300048904 Bacteria 1610
553 Ga0496101_0224775 3300048904 Bacteria 1458
554 Ga0496102_0207473 3300048905 Bacteria 1847
555 Ga0496102_0354021 3300048905 Bacteria 1382
556 Ga0496104_0513625 3300048907 Bacteria 1109
557 Ga0496104_0909528 3300048907 Unclassified 785
558 Ga0496105_0101656 3300048908 Bacteria 2374
559 Ga0496107_0025214 3300048910 Bacteria 4208
560 Ga0496108_0091387 3300048911 Bacteria 2588
561 Ga0496109_0144539 3300048912 Bacteria 2225
562 Ga0496109_0185128 3300048912 Bacteria 1957
563 Ga0496110_0185911 3300048913 Bacteria 1887
564 Ga0496112_0202447 3300048915 Bacteria 1944
565 Ga0496114_0012808 3300048917 Bacteria 6715
566 Ga0496114_0104534 3300048917 Unclassified 2421
567 Ga0496114_0275663 3300048917 Unclassified 1482
568 Ga0496115_0277947 3300048918 Bacteria 1375
569 Ga0496117_0066625 3300048920 Bacteria 2441
570 Ga0496118_0022027 3300048921 Bacteria 5587
571 Ga0496118_0202237 3300048921 Bacteria 1175
572 Ga0496121_0008159 3300048924 Bacteria 12438
573 Ga0496121_0419662 3300048924 Bacteria 871
574 Ga0496125_0010896 3300048928 Bacteria 9143
575 Ga0496126_0000980 3300048929 Bacteria 48954
576 Ga0496126_0187235 3300048929 Bacteria 1755
577 Ga0501308_015218 3300049128 Bacteria 909
578 Ga0495678_007106 3300049459 Bacteria 5853
579 Ga0495678_019188 3300049459 Bacteria 3056
580 Ga0495682_0025626 3300049460 Bacteria 2194
581 Ga0495682_0190387 3300049460 Bacteria 728
582 Ga0501031_0015019 3300049568 Bacteria 5030
583 Ga0501031_0148125 3300049568 Bacteria 1533
584 Ga0501032_0002974 3300049569 Bacteria 13154
585 Ga0501032_0009021 3300049569 Bacteria 7248
586 Ga0501033_0001594 3300049570 Bacteria 19939
587 Ga0501033_0167046 3300049570 Bacteria 1581
588 Ga0501034_0040006 3300049571 Bacteria 4748
589 Ga0501034_0040330 3300049571 Bacteria 4725
590 Ga0501036_0004807 3300049572 Bacteria 10918
591 Ga0501036_0088629 3300049572 Bacteria 2614
592 Ga0501037_0002776 3300049573 Bacteria 12676
593 Ga0501038_0002215 3300049574 Bacteria 18081
594 Ga0501038_0008444 3300049574 Bacteria 9473
595 Ga0501038_0022440 3300049574 Bacteria 5655
596 Ga0501039_0005521 3300049575 Bacteria 9568
597 Ga0501039_0017532 3300049575 Bacteria 5492
598 Ga0501040_0007076 3300049576 Bacteria 7272
599 Ga0501041_0349276 3300049577 Bacteria 935
600 Ga0501042_0001122 3300049578 Bacteria 15421
601 Ga0501043_0005777 3300049579 Bacteria 9960
602 Ga0501043_0044298 3300049579 Bacteria 3498
603 Ga0501043_0149271 3300049579 Bacteria 1829
604 Ga0501046_0001218 3300049580 Bacteria 24929
605 Ga0501046_0013156 3300049580 Bacteria 7020
606 Ga0501047_0022202 3300049581 Bacteria 6097
607 Ga0501048_0055918 3300049582 Bacteria 2800
608 Ga0501067_0619606 3300049583 Bacteria 607
609 Ga0501068_0010069 3300049584 Bacteria 5305
610 Ga0501073_0729258 3300049589 Bacteria 684
611 Ga0501074_0249880 3300049590 Bacteria 1261
612 Ga0501249_014616 3300049679 Bacteria 1674
613 Ga0501080_0054212 3300049742 Bacteria 3734
614 Ga0501080_0733510 3300049742 Bacteria 870
615 Ga0501241_025048 3300049758 Bacteria 1110
616 Ga0501035_0001588 3300049822 Bacteria 23027
617 Ga0501035_0290622 3300049822 Bacteria 1379
618 Ga0501035_0645934 3300049822 Bacteria 858
619 Ga0501044_0009871 3300049823 Bacteria 10376
620 Ga0501044_0015564 3300049823 Bacteria 8194
621 Ga0501045_0005631 3300049824 Bacteria 8671
622 nmdc:mga0yw44_42787_c1 3300050492 Bacteria 2702
623 nmdc:mga0k408_88087_c1 3300050493 Bacteria 1823
624 nmdc:mga07m45_12402_c1 3300050496 Bacteria 4504
625 nmdc:mga05p37_80858_c1 3300050507 Bacteria 4002
626 nmdc:mga09592_40483_c1 3300050508 Bacteria 3915
627 nmdc:mga0qj67_19318_c1 3300050509 Bacteria 5204
628 nmdc:mga06r32_82249_c1 3300050510 Bacteria 3137
629 nmdc:mga08y16_1010141_c1 3300050511 Bacteria 811
630 nmdc:mga0a205_324751_c1 3300050515 Bacteria 1409
631 nmdc:mga0sz30_133863_c1 3300050516 Bacteria 1093
632 Ga0500578_0249850 3300053086 Bacteria 1069
633 Ga0500644_0400895 3300053088 Bacteria 598
634 Ga0500646_0209133 3300053090 Bacteria 672
635 Ga0500641_0003850 3300053096 Bacteria 5304
636 Ga0500660_176652 3300053100 Bacteria 779
637 Ga0500562_000577 3300053108 Bacteria 8802
638 Ga0500593_111046 3300053117 Bacteria 1127
639 Ga0500642_0087133 3300053130 Bacteria 1440
640 Ga0500559_0193570 3300053136 Bacteria 958
641 Ga0500616_0032201 3300053153 Bacteria 2867
642 Ga0500622_0020392 3300053156 Bacteria 3520
643 Ga0500609_001115 3300053731 Bacteria 4005
644 Ga0501084_1468346 3300054114 Unclassified 571
645 Ga0587085_035384 3300059506 Bacteria 844
646 Ga0587062_047956 3300059639 Bacteria 715
647 Ga0501082_0313310 3300060353 Unclassified 1367
648 2516023484 2515154189 Bacteria 9629850
649 2585153789 2582581280 Bacteria 5994497
650 2585198002 2582581293 Bacteria 5907401
651 2587918688 2585428106 Bacteria 5179711
652 2588290921 2588253510 Bacteria 6901809
653 2643778334 2643221552 Bacteria 5708754
654 2643801247 2643221556 Bacteria 7251154
655 2643925471 2643221583 Bacteria 5218014
656 2643927406 2643221584 Bacteria 5511711
657 2643972138 2643221592 Bacteria 6608788
658 2644142337 2643221625 Bacteria 6512927
659 2644225334 2643221640 Bacteria 5258820
660 2644232642 2643221642 Bacteria 5357871
661 2644276031 2643221648 Bacteria 6521465
662 2644471665 2643221684 Bacteria 7145183
663 2819535819 2818991435 Bacteria 5433759
664 2819646051 2818991454 Bacteria 5563326
665 2857507790 2857504554 Bacteria 5369913
666 2883093429 2883087390 Bacteria 9532701
667 2904425137 2904424332 Bacteria 7633521
668 2912968802 2912963787 Bacteria 5646108
669 2928535624 2928531327 Bacteria 5101314
670 2939654137 2939651529 Bacteria 5895393
671 639789064 639633007 Bacteria 4376040
672 643600731 643348564 Bacteria 8839022
673 Ga0058863_10022113
674 JGI25152J39213_1002469
675 JGI25150J39212_1002495
676 JGI25153J46596_10005824
677 rootL2_10093421
678 rootL2_10128998
679 rootH1_10132987
680 Ga0055526_1005023
681 Ga0055526_1005529
682 Ga0055537_1007066
683 Ga0055524_1000182
684 Ga0055524_1006279
685 Ga0055524_1082106
686 Ga0055534_1042626
687 Ga0055530_10000037
688 Ga0055530_10012424
689 Ga0055530_10043783
690 Ga0055540_1003124
691 Ga0055531_10000557
692 Ga0055531_10043071
693 Ga0058858_1158617
694 Ga0058859_10842610
695 Ga0058863_11830666
696 Ga0058861_10021452
697 Ga0058861_11921876
698 Ga0058860_11397319
699 Ga0058860_11538292
700 Ga0058860_12134235
701 Ga0058862_10008156
702 Ga0058862_12692344
703 Ga0058862_12871773
704 Ga0065165_1000615
705 Ga0070658_10105728
706 Ga0070683_100071547
707 Ga0068869_100179405
708 Ga0070666_10241251
709 Ga0070680_100002662
710 Ga0070680_100006366
711 Ga0070680_100116848
712 Ga0070680_100224391
713 Ga0070680_100587637
714 Ga0070680_100807117
715 Ga0068868_101040511
716 Ga0070660_100498789
717 Ga0070691_10287996
718 Ga0070687_100723982
719 Ga0070669_100133338
720 Ga0070675_100450676
721 Ga0070674_100231661
722 Ga0070688_100048473
723 Ga0070667_100197769
724 Ga0070709_10198086
725 Ga0070714_100546863
726 Ga0070694_100012071
727 Ga0070708_100044519
728 Ga0070708_100143747
729 Ga0070678_100031236
730 Ga0070678_100091416
731 Ga0070678_100165666
732 Ga0070678_100256737
733 Ga0070662_100264234
734 Ga0070681_10001907
735 Ga0070681_10193820
736 Ga0068867_100110734
737 Ga0070685_10311616
738 Ga0070706_100059014
739 Ga0070706_100560864
740 Ga0070707_100362489
741 Ga0070698_100333961
742 Ga0070698_101096864
743 Ga0070679_100001193
744 Ga0070679_100001971
745 Ga0070679_100171998
746 Ga0070679_100219890
747 Ga0070684_100083380
748 Ga0070697_100254164
749 Ga0070697_101475259
750 Ga0070672_100331843
751 Ga0070665_100027839
752 Ga0068855_100135254
753 Ga0068855_100324882
754 Ga0068855_100748706
755 Ga0068855_101143462
756 Ga0070664_100391096
757 Ga0068854_100610014
758 Ga0068856_100451997
759 Ga0068852_100052884
760 Ga0068852_101225068
761 Ga0068859_100007356
762 Ga0068859_100100382
763 Ga0068864_100070433
764 Ga0068864_100083232
765 Ga0068866_10025543
766 Ga0068851_10083545
767 Ga0068863_100088411
768 Ga0068863_100153974
769 Ga0068863_100373581
770 Ga0068863_100409645
771 Ga0068863_100930611
772 Ga0068858_100181912
773 Ga0068858_100896103
774 Ga0068860_100629064
775 Ga0068862_100189320
776 Ga0081538_10069435
777 Ga0075364_10501552
778 Ga0070716_100549068
779 Ga0075366_10122003
780 Ga0097621_100715318
781 Ga0075370_10033556
782 Ga0075370_10838997
783 Ga0068871_100251431
784 Ga0068871_100432399
785 Ga0075428_100022695
786 Ga0075430_100015375
787 Ga0075431_100000941
788 Ga0075433_11423449
789 Ga0075429_100024405
790 Ga0075429_101330961
791 Ga0068865_100262622
792 Ga0097620_100007356
793 Ga0097620_100100384
794 Ga0079104_1000333
795 Ga0105251_10023081
796 Ga0105251_10063868
797 Ga0105244_10000079
798 Ga0105240_10159674
799 Ga0111539_10836118
800 Ga0105247_10127208
801 Ga0105247_11075912
802 Ga0114129_10131009
803 Ga0105243_10772248
804 Ga0105243_11258507
805 Ga0105242_10789854
806 Ga0105248_10045882
807 Ga0105248_10225457
808 Ga0105248_10983521
809 Ga0105238_10680362
810 Ga0157327_1023884
811 Ga0157370_10010706
812 Ga0157369_10502363
813 Ga0157369_10758997
814 Ga0157374_10258764
815 Ga0157378_10205693
816 Ga0163162_10001320
817 Ga0163162_10022603
818 Ga0163162_10088294
819 Ga0163162_11681545
820 Ga0157372_10020425
821 Ga0157372_10195755
822 Ga0157372_10237871
823 Ga0157372_10757280
824 Ga0157375_10013360
825 Ga0157375_10161954
826 Ga0163163_10000226
827 Ga0157380_10078260
828 Ga0157380_10454051
829 Ga0157376_10281662
830 Ga0157376_11069920
831 Ga0163161_10103296
832 Ga0163161_10588390
833 Ga0206356_11608922
834 Ga0154015_1582689
835 Ga0213872_10159972
836 Ga0213876_10000155
837 Ga0213875_10116180
838 Ga0207425_1000452
839 Ga0209129_1000027
840 Ga0209565_1004369
841 Ga0209565_1011078
842 Ga0209673_1011233
843 Ga0209673_1020665
844 Ga0209675_1006973
845 Ga0209675_1018926
846 Ga0209675_1047707
847 Ga0209564_1000046
848 Ga0209564_1000142
849 Ga0209564_1000818
850 Ga0209564_1005525
851 Ga0209758_1000052
852 Ga0209758_1000246
853 Ga0209050_1000058
854 Ga0209050_1001069
855 Ga0209050_1014421
856 Ga0209050_1018180
857 Ga0209256_1000024
858 Ga0209256_1001716
859 Ga0209256_1014547
860 Ga0209256_1028527
861 Ga0209051_1000155
862 Ga0209257_1000236
863 Ga0209257_1000259
864 Ga0207656_10103245
865 Ga0207655_1000188
866 Ga0207713_1035062
867 Ga0207710_10091215
868 Ga0207680_10348640
869 Ga0207699_10541724
870 Ga0207643_10378225
871 Ga0207705_10080606
872 Ga0207705_10211804
873 Ga0207684_11223657
874 Ga0207707_10000732
875 Ga0207707_10067747
876 Ga0207695_10367320
877 Ga0207663_10574231
878 Ga0207660_10014120
879 Ga0207660_10032840
880 Ga0207660_10113048
881 Ga0207660_10647779
882 Ga0207657_10399050
883 Ga0207649_10355808
884 Ga0207652_10022573
885 Ga0207652_10051639
886 Ga0207652_11408186
887 Ga0207646_10218024
888 Ga0207681_10209874
889 Ga0207694_11156925
890 Ga0207659_10418885
891 Ga0207659_10446840
892 Ga0207664_10466076
893 Ga0207690_10581868
894 Ga0207706_10313860
895 Ga0207709_10075225
896 Ga0207704_10153059
897 Ga0207704_10473609
898 Ga0207704_10532023
899 Ga0207704_10798840
900 Ga0207665_10036171
901 Ga0207665_10099209
902 Ga0207691_10003268
903 Ga0207691_10357168
904 Ga0207711_10021013
905 Ga0207711_10877436
906 Ga0207711_11414388
907 Ga0207661_10019114
908 Ga0207667_10107881
909 Ga0207667_10599363
910 Ga0207651_10360502
911 Ga0207668_10110183
912 Ga0207640_10307673
913 Ga0207703_10652173
914 Ga0207639_10216025
915 Ga0207702_10069213
916 Ga0207641_10024381
917 Ga0207641_10314902
918 Ga0207641_10364067
919 Ga0207641_10666483
920 Ga0207648_10046412
921 Ga0207648_10558719
922 Ga0207676_10110448
923 Ga0207676_10155485
924 Ga0207676_11867293
925 Ga0207674_10233765
926 Ga0207674_11363754
927 Ga0207675_100085272
928 Ga0207683_10036996
929 Ga0207683_10520972
930 Ga0207698_10180921
931 Ga0207698_11795013
932 Ga0209281_1000322
933 Ga0268265_10639436
934 Ga0268264_10019844
935 Ga0268264_10891426
936 Ga0265318_10318036
937 Ga0265340_10010391
938 Ga0307513_10007974
939 Ga0307513_10075226
940 Ga0307513_10082794
941 Ga0307513_10720466
942 Ga0307509_10004925
943 Ga0307408_100035841
944 Ga0316575_10002218
945 Ga0265342_10497903
946 Ga0316576_10007196
947 Ga0316576_10024025
948 Ga0316576_11164423
949 Ga0316578_10003454
950 Ga0316578_10033641
951 Ga0316578_10100083
952 Ga0316578_10200339
953 Ga0316577_10015853
954 Ga0307410_10150694
955 Ga0307416_100483379
956 Ga0307411_10890372
957 Ga0316585_10000135
958 Ga0316585_10015525
959 Ga0316580_10003872
960 Ga0316593_10000488
961 Ga0316593_10012916
962 Ga0316592_1008726
963 Ga0316592_1045478
964 Ga0316592_1045972
965 Ga0316586_1013613
966 Ga0316586_1070231
967 Ga0316586_1110879
968 Ga0316588_1028846
969 Ga0316588_1074923
970 Ga0316587_1009144
971 Ga0316587_1073882
972 Ga0316596_1001923
973 Ga0316596_1006082
974 Ga0316596_1039698
975 Ga0316596_1191131
976 Ga0373957_0109252
977 Ga0373955_0301483
978 Ga0316574_0004903
979 Ga0316574_0007153
980 Ga0316574_0015422
981 Ga0316574_0121960
982 Ga0373931_0644463
983 Ga0373937_0032536
984 Ga0373937_0066233
985 Ga0373937_0542939
986 Ga0310109_049593
987 Ga0316582_0004722
988 Ga0316582_0106664
989 Ga0316582_0227241
990 Ga0316582_0382842
991 Ga0316584_0055392
992 Ga0316584_0236936
993 Ga0395899_0121509
994 Ga0395900_0061088
995 Ga0395900_0286488
996 Ga0395900_0329012
997 Ga0395900_0912106
998 Ga0395898_0140228
999 Ga0395898_0245260
1000 Ga0395905_0120906
1001 Ga0395905_0131211
1002 Ga0395905_0347648
1003 Ga0395905_0573681
1004 Ga0436364_0657416
1005 Ga0395901_0675161
1006 Ga0400491_20990
1007 Ga0436365_0124459
1008 Ga0436365_1190722
1009 Ga0436365_1930978
1010 Ga0436360_0198049
1011 Ga0436361_0028601
1012 Ga0436361_1127599
1013 Ga0439437_024272
1014 Ga0439448_0083741
1015 Ga0439455_0020843
1016 Ga0450890_034873
1017 Ga0439435_0027498
1018 Ga0439459_0002620
1019 Ga0451577_0001743
1020 Ga0439440_0086160
1021 Ga0466969_0189687
1022 Ga0466972_0108906
1023 Ga0466965_0059795
1024 Ga0466961_0269813
1025 Ga0466961_0420101
1026 Ga0466964_0112789
1027 Ga0466968_0452414
1028 Ga0466970_0187859
1029 Ga0466957_0019001
1030 Ga0466959_0106308
1031 Ga0466959_0164492
1032 Ga0451576_0038173
1033 Ga0466958_0183561
1034 Ga0466967_0174395
1035 Ga0466967_1034409
1036 Ga0495592_0003568
1037 Ga0495603_0021112
1038 Ga0495603_0040025
1039 Ga0495590_0123163
1040 Ga0495591_000806
1041 Ga0495591_137425
1042 Ga0495629_0000436
1043 Ga0495629_0008971
1044 Ga0495629_0110817
1045 Ga0495638_0001574
1046 Ga0495638_0004077
1047 Ga0495638_0004290
1048 Ga0495638_0011608
1049 Ga0495638_0506840
1050 Ga0495641_0021538
1051 Ga0495641_0076252
1052 Ga0495651_0016516
1053 Ga0495651_0066336
1054 Ga0495653_0001432
1055 Ga0495653_0009893
1056 Ga0495653_0024886
1057 Ga0495650_0006227
1058 Ga0495580_0000454
1059 Ga0495580_0007150
1060 Ga0495580_0105818
1061 Ga0495582_0008680
1062 Ga0495582_0784309
1063 Ga0495605_0003916
1064 Ga0495605_0009041
1065 Ga0495605_0159260
1066 Ga0495662_0013480
1067 Ga0495662_0017902
1068 Ga0495662_0091525
1069 Ga0495664_0007110
1070 Ga0495664_0016662
1071 Ga0495664_0129883
1072 Ga0495594_0038887
1073 Ga0495594_0223823
1074 Ga0495594_0293698
1075 Ga0495596_0038128
1076 Ga0495596_0044388
1077 Ga0495607_0037403
1078 Ga0495583_0022721
1079 Ga0495606_0041956
1080 Ga0495606_0074761
1081 Ga0495606_0092735
1082 Ga0495606_0265903
1083 Ga0495608_0141134
1084 Ga0495610_0083855
1085 Ga0495610_0092869
1086 Ga0495616_0000031
1087 Ga0495616_0193990
1088 Ga0495618_0006609
1089 Ga0495618_0040991
1090 Ga0495618_0072283
1091 Ga0495620_0017356
1092 Ga0495628_0011906
1093 Ga0495628_0025554
1094 Ga0495628_0110360
1095 Ga0495628_0119613
1096 Ga0495630_0008810
1097 Ga0495630_0028380
1098 Ga0495631_0230616
1099 Ga0495632_0011423
1100 Ga0495632_0069336
1101 Ga0495643_0361069
1102 Ga0495643_0365649
1103 Ga0495644_0082696
1104 Ga0495648_0019060
1105 Ga0495648_0023871
1106 Ga0495648_0089242
1107 Ga0495666_0001761
1108 Ga0495666_0186969
1109 Ga0495642_0131993
1110 Ga0495642_0161316
1111 Ga0495642_0468128
1112 Ga0495652_0096851
1113 Ga0495654_0060996
1114 Ga0495665_0000684
1115 Ga0495665_0082262
1116 Ga0495665_0324830
1117 Ga0495640_0120825
1118 Ga0495586_0006614
1119 Ga0495586_0243830
1120 Ga0495587_0000623
1121 Ga0495587_0004114
1122 Ga0495609_0051556
1123 Ga0495597_0027595
1124 Ga0495597_0039268
1125 Ga0495645_0002458
1126 Ga0495645_0051268
1127 Ga0495622_0000018
1128 Ga0495667_0036463
1129 Ga0495667_0216758
1130 Ga0495668_0000028
1131 Ga0495668_0008200
1132 Ga0495668_0043959
1133 Ga0495668_0102187
1134 Ga0495668_0473743
1135 Ga0495634_0004462
1136 Ga0495634_0261936
1137 Ga0495634_0365306
1138 Ga0495611_0052761
1139 Ga0495611_0218241
1140 Ga0495625_0060515
1141 Ga0495625_0068594
1142 Ga0495625_0213719
1143 Ga0495635_0003028
1144 Ga0495635_0015141
1145 Ga0495661_0003061
1146 Ga0495661_0003818
1147 Ga0495661_0043052
1148 Ga0495661_0074687
1149 Ga0495588_0268636
1150 Ga0495657_0079428
1151 Ga0495599_0076400
1152 Ga0495599_0107804
1153 Ga0495623_0002881
1154 Ga0495623_0019699
1155 Ga0495646_0030921
1156 Ga0495646_0033452
1157 Ga0495646_0055206
1158 Ga0495669_0030615
1159 Ga0495669_0113642
1160 Ga0495669_0121767
1161 Ga0495613_0011548
1162 Ga0495613_0108647
1163 Ga0495613_0164360
1164 Ga0495624_0006943
1165 Ga0495624_0022029
1166 Ga0495624_0027504
1167 Ga0495624_0054486
1168 Ga0495670_0004408
1169 Ga0495670_0280063
1170 Ga0495671_0012743
1171 Ga0495589_0002595
1172 Ga0495589_0016853
1173 Ga0495589_0049937
1174 Ga0495600_0001426
1175 Ga0495600_0039484
1176 Ga0495600_0054224
1177 Ga0495600_0676955
1178 Ga0495660_0002945
1179 Ga0495660_0037357
1180 Ga0495660_0201221
1181 Ga0495581_0000308
1182 Ga0495581_0010566
1183 Ga0495604_0002498
1184 Ga0495604_0022448
1185 Ga0495674_0095829
1186 Ga0495672_0002721
1187 Ga0495672_0016868
1188 Ga0495676_0010249
1189 Ga0495676_0031983
1190 Ga0495676_0240225
1191 Ga0495680_0022450
1192 Ga0495680_0043303
1193 Ga0495680_0335970
1194 Ga0495683_0016611
1195 Ga0495683_0056996
1196 Ga0495687_061217
1197 Ga0495675_0009494
1198 Ga0495675_0036533
1199 Ga0495675_0138038
1200 Ga0495679_000008
1201 Ga0495679_000300
1202 Ga0495679_000528
1203 Ga0495673_0008048
1204 Ga0495673_0159263
1205 Ga0495673_0213161
1206 Ga0495681_0027734
1207 Ga0495681_0028017
1208 Ga0495681_0055594
1209 Ga0495684_0042294
1210 Ga0495686_0000080
1211 Ga0495593_0003365
1212 Ga0495593_0010047
1213 Ga0495602_0011757
1214 Ga0495602_0033683
1215 Ga0495602_0048159
1216 Ga0495602_0720530
1217 Ga0495614_0001749
1218 Ga0495614_0015119
1219 Ga0495626_0005137
1220 Ga0495626_0026687
1221 Ga0495626_0041344
1222 Ga0495626_0090685
1223 Ga0496100_0834814
1224 Ga0496101_0183918
1225 Ga0496101_0224775
1226 Ga0496102_0207473
1227 Ga0496102_0354021
1228 Ga0496104_0513625
1229 Ga0496104_0909528
1230 Ga0496105_0101656
1231 Ga0496107_0025214
1232 Ga0496108_0091387
1233 Ga0496109_0144539
1234 Ga0496109_0185128
1235 Ga0496110_0185911
1236 Ga0496112_0202447
1237 Ga0496114_0012808
1238 Ga0496114_0104534
1239 Ga0496114_0275663
1240 Ga0496115_0277947
1241 Ga0496117_0066625
1242 Ga0496118_0022027
1243 Ga0496118_0202237
1244 Ga0496121_0008159
1245 Ga0496121_0419662
1246 Ga0496125_0010896
1247 Ga0496126_0000980
1248 Ga0496126_0187235
1249 Ga0501308_015218
1250 Ga0495678_007106
1251 Ga0495678_019188
1252 Ga0495682_0025626
1253 Ga0495682_0190387
1254 Ga0501031_0015019
1255 Ga0501031_0148125
1256 Ga0501032_0002974
1257 Ga0501032_0009021
1258 Ga0501033_0001594
1259 Ga0501033_0167046
1260 Ga0501034_0040006
1261 Ga0501034_0040330
1262 Ga0501036_0004807
1263 Ga0501036_0088629
1264 Ga0501037_0002776
1265 Ga0501038_0002215
1266 Ga0501038_0008444
1267 Ga0501038_0022440
1268 Ga0501039_0005521
1269 Ga0501039_0017532
1270 Ga0501040_0007076
1271 Ga0501041_0349276
1272 Ga0501042_0001122
1273 Ga0501043_0005777
1274 Ga0501043_0044298
1275 Ga0501043_0149271
1276 Ga0501046_0001218
1277 Ga0501046_0013156
1278 Ga0501047_0022202
1279 Ga0501048_0055918
1280 Ga0501067_0619606
1281 Ga0501068_0010069
1282 Ga0501073_0729258
1283 Ga0501074_0249880
1284 Ga0501249_014616
1285 Ga0501080_0054212
1286 Ga0501080_0733510
1287 Ga0501241_025048
1288 Ga0501035_0001588
1289 Ga0501035_0290622
1290 Ga0501035_0645934
1291 Ga0501044_0009871
1292 Ga0501044_0015564
1293 Ga0501045_0005631
1294 nmdc:mga0yw44_42787_c1
1295 nmdc:mga0k408_88087_c1
1296 nmdc:mga07m45_12402_c1
1297 nmdc:mga05p37_80858_c1
1298 nmdc:mga09592_40483_c1
1299 nmdc:mga0qj67_19318_c1
1300 nmdc:mga06r32_82249_c1
1301 nmdc:mga08y16_1010141_c1
1302 nmdc:mga0a205_324751_c1
1303 nmdc:mga0sz30_133863_c1
1304 Ga0500578_0249850
1305 Ga0500644_0400895
1306 Ga0500646_0209133
1307 Ga0500641_0003850
1308 Ga0500660_176652
1309 Ga0500562_000577
1310 Ga0500593_111046
1311 Ga0500642_0087133
1312 Ga0500559_0193570
1313 Ga0500616_0032201
1314 Ga0500622_0020392
1315 Ga0500609_001115
1316 Ga0501084_1468346
1317 Ga0587085_035384
1318 Ga0587062_047956
1319 Ga0501082_0313310
1320 2516023484
1321 2585153789
1322 2585198002
1323 2587918688
1324 2588290921
1325 2643778334
1326 2643801247
1327 2643925471
1328 2643927406
1329 2643972138
1330 2644142337
1331 2644225334
1332 2644232642
1333 2644276031
1334 2644471665
1335 2819535819
1336 2819646051
1337 2857507790
1338 2883093429
1339 2904425137
1340 2912968802
1341 2928535624
1342 2939654137
1343 639789064
1344 643600731

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05638

T6SS_HCP

Type VI secretion system effector, Hcp

28

157

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y12-assembly1.cif.gz_A structure of a hemolysin-coregulated protein from pseudomonas aeruginosa 0.9271 2 139
1y12-assembly2.cif.gz_B structure of a hemolysin-coregulated protein from pseudomonas aeruginosa 0.9249 2 139
1y12-assembly1.cif.gz_C structure of a hemolysin-coregulated protein from pseudomonas aeruginosa 0.9229 2 139
4tv4-assembly1.cif.gz_A-2 crystal structure of a putative uncharacterized protein from burkholderia pseudomallei 0.9205 2 139
4tv4-assembly1.cif.gz_C-2 crystal structure of a putative uncharacterized protein from burkholderia pseudomallei 0.9201 2 139
ID Description Score Start End Superfamily
3eaaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.9201 2 139 2.30.110.20
3eaaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.9075 2 139 2.30.110.20
1y12B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.9033 2 139 2.30.110.20
1y12B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8908 2 139 2.30.110.20
5xeuF00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8692 4 137 2.30.110.20
ID Description Score Start End GO Terms
AF-K8A3X2-F1-model_v4 Uncharacterized protein ImpD 0.9585 38 139
AF-A0A3D5AS39-F1-model_v4 Type VI secretion system tube protein Hcp 0.9565 3 139
AF-A0A535EEU2-F1-model_v4 Type VI secretion system tube protein Hcp 0.9536 1 139
AF-A0A5C7M321-F1-model_v4 deleted 0.952 1 139
AF-A0A379CWI1-F1-model_v4 deleted 0.9513 34 139

Map