F474286

General Info

Members Datasets Scaffolds Average Seq Length
673 255 673 460

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10045040|Ga0070681_100450403
Length 518
Sequence MTIDLGTPMVAEVAVFGLMVLVLFVGLLRKPPVPIGPTFEPRIPDPGSRPSTRSGRPEALEGRIPDSGHASAAGWITLIGLLVTFVLMFFARDGATLLGGSFVNDSLAIFSKKLFVAAAALSVLASLTLRNSSFRRRAAEYHFVLLASVLGMMVLASARDLILLFVSFELMSIPLYVLTGFVKRDGAAPEAALKFFLVGTASSAVIVYGISFIIGVTGTTDLSAIPSALVANDSIMLLGMTLLLAGLGFKIAAFPFHMWAPDTYEAASTPFVAWLAVAPKAAGFIAIIRLYVEGVGASTLVWMPVVAAVAGMTIITGNLMAIPQHNIKRLLAYSGIAHIGYMLIGLAALTSNGIAMVLFYLLAYMFGNMGAFFVVEAVARSEQSDEIDAYKGLAQRSPVLALAMLVFLLSLGGIPFVAGFWAKLYVFLAAVDRGMYGLVFLGAVLTVVALYXXXXVARRMYIEAPVRTERVHVPALLGVAIFICIAGVVGMGAWPGPWVNATQRAAASVFAASAASIK

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
194 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
195 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 0.45
Rhizosphere 98.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000779 3300001977 Bacteria 4908
2 JGI25406J46586_10000120 3300003203 Bacteria 34396
3 JGI25406J46586_10002349 3300003203 Bacteria 8944
4 Ga0065714_10071211 3300005288 Bacteria 3637
5 Ga0065712_10002361 3300005290 Bacteria 8212
6 Ga0065712_10068087 3300005290 Bacteria 15101
7 Ga0065712_10081843 3300005290 Bacteria 2960
8 Ga0065715_10002974 3300005293 Bacteria 4577
9 Ga0065715_10005150 3300005293 Bacteria 6305
10 Ga0065707_10002595 3300005295 Bacteria 6960
11 Ga0065707_10136991 3300005295 Bacteria 1826
12 Ga0070676_10002255 3300005328 Bacteria 9831
13 Ga0070676_10037385 3300005328 Unclassified 2800
14 Ga0070683_100001902 3300005329 Bacteria 16331
15 Ga0070683_100145792 3300005329 Unclassified 2243
16 Ga0070690_100003636 3300005330 Bacteria 8490
17 Ga0070690_100034765 3300005330 Unclassified 3159
18 Ga0070670_100004978 3300005331 Bacteria 11177
19 Ga0070670_100097543 3300005331 Bacteria 2528
20 Ga0070670_100226873 3300005331 Bacteria 1625
21 Ga0068869_100001496 3300005334 Bacteria 13845
22 Ga0068869_100002011 3300005334 Bacteria 12219
23 Ga0068869_100010384 3300005334 Bacteria 6073
24 Ga0068869_100063299 3300005334 Bacteria 2717
25 Ga0070666_10004927 3300005335 Bacteria 8165
26 Ga0070666_10035192 3300005335 Bacteria 3321
27 Ga0070680_100002109 3300005336 Bacteria 14680
28 Ga0070682_100000365 3300005337 Bacteria 30423
29 Ga0068868_100078630 3300005338 Bacteria 2641
30 Ga0068868_100082588 3300005338 Bacteria 2577
31 Ga0070660_100018271 3300005339 Bacteria 5122
32 Ga0070689_100006307 3300005340 Bacteria 8192
33 Ga0070689_100016519 3300005340 Bacteria 5401
34 Ga0070689_100026025 3300005340 Bacteria 4401
35 Ga0070691_10014935 3300005341 Bacteria 3566
36 Ga0070691_10018250 3300005341 Bacteria 3234
37 Ga0070691_10022284 3300005341 Bacteria 2938
38 Ga0070687_100000488 3300005343 Bacteria 13208
39 Ga0070687_100005532 3300005343 Bacteria 5122
40 Ga0070687_100012791 3300005343 Bacteria 3718
41 Ga0070687_100013316 3300005343 Bacteria 3662
42 Ga0070661_100002514 3300005344 Bacteria 12556
43 Ga0070661_100006598 3300005344 Bacteria 8003
44 Ga0070661_100015343 3300005344 Bacteria 5407
45 Ga0070692_10001897 3300005345 Bacteria 7888
46 Ga0070668_100001246 3300005347 Bacteria 18156
47 Ga0070668_100057079 3300005347 Unclassified 3016
48 Ga0070668_100214214 3300005347 Bacteria 1586
49 Ga0070669_100105021 3300005353 Bacteria 2136
50 Ga0070675_100003563 3300005354 Bacteria 11830
51 Ga0070675_100007060 3300005354 Bacteria 8639
52 Ga0070675_100012585 3300005354 Bacteria 6634
53 Ga0070675_100131236 3300005354 Bacteria 2135
54 Ga0070675_100167651 3300005354 Unclassified 1892
55 Ga0070674_100000988 3300005356 Bacteria 14828
56 Ga0070674_100010071 3300005356 Bacteria 5693
57 Ga0070674_100017360 3300005356 Bacteria 4525
58 Ga0070673_100004953 3300005364 Bacteria 8487
59 Ga0070673_100081131 3300005364 Unclassified 2630
60 Ga0070688_100099993 3300005365 Unclassified 1910
61 Ga0070659_100001505 3300005366 Bacteria 16800
62 Ga0070659_100002251 3300005366 Bacteria 13737
63 Ga0070659_100061265 3300005366 Bacteria 2974
64 Ga0070667_100111783 3300005367 Bacteria 2370
65 Ga0070703_10003809 3300005406 Bacteria 4268
66 Ga0070701_10026049 3300005438 Unclassified 2847
67 Ga0070700_100009311 3300005441 Bacteria 5383
68 Ga0070700_100039984 3300005441 Bacteria 2868
69 Ga0070700_100182237 3300005441 Bacteria 1462
70 Ga0070694_100000345 3300005444 Bacteria 24871
71 Ga0070694_100006735 3300005444 Bacteria 6979
72 Ga0070694_100011586 3300005444 Bacteria 5461
73 Ga0070694_100015289 3300005444 Bacteria 4816
74 Ga0070694_100026765 3300005444 Bacteria 3740
75 Ga0070694_100026892 3300005444 Bacteria 3733
76 Ga0070694_100073558 3300005444 Bacteria 2361
77 Ga0070708_100040319 3300005445 Bacteria 4089
78 Ga0070708_100046013 3300005445 Bacteria 3848
79 Ga0070708_100071343 3300005445 Bacteria 3127
80 Ga0070708_100085474 3300005445 Bacteria 2863
81 Ga0070663_100001711 3300005455 Bacteria 12179
82 Ga0070663_100051172 3300005455 Bacteria 2941
83 Ga0070678_100053178 3300005456 Bacteria 2944
84 Ga0070662_100026986 3300005457 Bacteria 3982
85 Ga0070662_100027076 3300005457 Bacteria 3976
86 Ga0070662_100055135 3300005457 Bacteria 2883
87 Ga0070662_100059219 3300005457 Bacteria 2790
88 Ga0070681_10045040 3300005458 Bacteria 4415
89 Ga0068867_100006014 3300005459 Bacteria 8602
90 Ga0068867_100007131 3300005459 Bacteria 7897
91 Ga0068867_100052159 3300005459 Bacteria 3018
92 Ga0070685_10000264 3300005466 Bacteria 33696
93 Ga0070706_100003928 3300005467 Bacteria 14483
94 Ga0070706_100006413 3300005467 Bacteria 11121
95 Ga0070706_100039995 3300005467 Bacteria 4328
96 Ga0070706_100042411 3300005467 Bacteria 4203
97 Ga0070706_100061910 3300005467 Unclassified 3456
98 Ga0070706_100137563 3300005467 Bacteria 2279
99 Ga0070707_100001862 3300005468 Bacteria 20267
100 Ga0070707_100010381 3300005468 Bacteria 8670
101 Ga0070707_100149336 3300005468 Unclassified 2275
102 Ga0070698_100007713 3300005471 Bacteria 11640
103 Ga0070698_100016413 3300005471 Bacteria 7815
104 Ga0070698_100049291 3300005471 Bacteria 4299
105 Ga0070698_100296282 3300005471 Unclassified 1548
106 Ga0070699_100000712 3300005518 Bacteria 30836
107 Ga0070699_100003941 3300005518 Bacteria 13112
108 Ga0070699_100005248 3300005518 Bacteria 11376
109 Ga0070699_100008791 3300005518 Bacteria 8753
110 Ga0070699_100026173 3300005518 Bacteria 5032
111 Ga0070699_100035333 3300005518 Bacteria 4320
112 Ga0070699_100038913 3300005518 Bacteria 4117
113 Ga0070699_100068977 3300005518 Bacteria 3072
114 Ga0070684_100046398 3300005535 Bacteria 3765
115 Ga0070697_100042024 3300005536 Bacteria 3700
116 Ga0070697_100054351 3300005536 Bacteria 3255
117 Ga0068853_100010976 3300005539 Bacteria 7342
118 Ga0068853_100015316 3300005539 Bacteria 6301
119 Ga0068853_100144928 3300005539 Bacteria 2134
120 Ga0070672_100002079 3300005543 Bacteria 12608
121 Ga0070672_100019254 3300005543 Bacteria 4951
122 Ga0070672_100153097 3300005543 Bacteria 1908
123 Ga0070695_100000112 3300005545 Bacteria 36134
124 Ga0070695_100029138 3300005545 Bacteria 3429
125 Ga0070695_100042978 3300005545 Bacteria 2872
126 Ga0070696_100004871 3300005546 Bacteria 8970
127 Ga0070696_100017675 3300005546 Bacteria 4816
128 Ga0070696_100021801 3300005546 Bacteria 4345
129 Ga0070696_100038365 3300005546 Bacteria 3306
130 Ga0070696_100040971 3300005546 Bacteria 3199
131 Ga0070696_100043193 3300005546 Bacteria 3118
132 Ga0070696_100050366 3300005546 Bacteria 2895
133 Ga0070693_100000189 3300005547 Bacteria 28531
134 Ga0070693_100008457 3300005547 Bacteria 5076
135 Ga0070693_100009077 3300005547 Bacteria 4936
136 Ga0070704_100056342 3300005549 Bacteria 2791
137 Ga0070704_100067970 3300005549 Bacteria 2575
138 Ga0070704_100161853 3300005549 Bacteria 1771
139 Ga0068855_100000331 3300005563 Bacteria 58972
140 Ga0068855_100015855 3300005563 Bacteria 9066
141 Ga0070664_100001341 3300005564 Bacteria 19628
142 Ga0070664_100006931 3300005564 Bacteria 9131
143 Ga0070664_100064670 3300005564 Bacteria 3120
144 Ga0068857_100000030 3300005577 Bacteria 76781
145 Ga0068857_100030695 3300005577 Bacteria 4747
146 Ga0068857_100113601 3300005577 Bacteria 2435
147 Ga0068857_100231573 3300005577 Bacteria 1690
148 Ga0068856_100000923 3300005614 Bacteria 31463
149 Ga0068852_100000767 3300005616 Bacteria 21142
150 Ga0068859_100273956 3300005617 Bacteria 1780
151 Ga0068864_100017773 3300005618 Bacteria 5932
152 Ga0068864_100086867 3300005618 Unclassified 2752
153 Ga0068866_10000083 3300005718 Bacteria 38582
154 Ga0068866_10054606 3300005718 Bacteria 2047
155 Ga0068861_100000212 3300005719 Bacteria 31389
156 Ga0068861_100016033 3300005719 Bacteria 5291
157 Ga0068861_100188320 3300005719 Bacteria 1723
158 Ga0068851_10038131 3300005834 Bacteria 2410
159 Ga0068870_10000633 3300005840 Bacteria 13428
160 Ga0068870_10002979 3300005840 Bacteria 7138
161 Ga0068870_10005126 3300005840 Bacteria 5702
162 Ga0068870_10011935 3300005840 Bacteria 4044
163 Ga0068870_10024726 3300005840 Bacteria 2973
164 Ga0068863_100004918 3300005841 Bacteria 13169
165 Ga0068863_100030248 3300005841 Bacteria 5172
166 Ga0068863_100046577 3300005841 Bacteria 4116
167 Ga0068863_100072573 3300005841 Unclassified 3256
168 Ga0068858_100209763 3300005842 Bacteria 1843
169 Ga0068860_100031285 3300005843 Bacteria 5116
170 Ga0068860_100042597 3300005843 Bacteria 4334
171 Ga0068860_100129469 3300005843 Bacteria 2421
172 Ga0068862_100002125 3300005844 Bacteria 17860
173 Ga0068862_100008232 3300005844 Bacteria 8626
174 Ga0068862_100011482 3300005844 Bacteria 7312
175 Ga0068862_100016417 3300005844 Bacteria 6161
176 Ga0068862_100093277 3300005844 Bacteria 2625
177 Ga0081455_10000868 3300005937 Bacteria 39013
178 Ga0081538_10003260 3300005981 Bacteria 15419
179 Ga0081540_1000146 3300005983 Bacteria 72830
180 Ga0081540_1010521 3300005983 Bacteria 6252
181 Ga0081539_10000024 3300005985 Bacteria 354702
182 Ga0081539_10000096 3300005985 Bacteria 204059
183 Ga0081539_10002353 3300005985 Bacteria 27164
184 Ga0075365_10022819 3300006038 Bacteria 3927
185 Ga0075364_10015737 3300006051 Bacteria 4695
186 Ga0070716_100056184 3300006173 Bacteria 2256
187 Ga0070712_100003836 3300006175 Bacteria 9254
188 Ga0075362_10000233 3300006177 Bacteria 15482
189 Ga0075366_10007412 3300006195 Bacteria 6059
190 Ga0075366_10009293 3300006195 Bacteria 5490
191 Ga0075370_10066752 3300006353 Bacteria 2052
192 Ga0068871_100018934 3300006358 Bacteria 5247
193 Ga0068871_100152573 3300006358 Bacteria 1971
194 Ga0068871_100167268 3300006358 Bacteria 1883
195 Ga0075428_100004648 3300006844 Bacteria 15196
196 Ga0075428_100015898 3300006844 Bacteria 8327
197 Ga0075428_100059134 3300006844 Bacteria 4197
198 Ga0075428_100168638 3300006844 Bacteria 2374
199 Ga0075430_100007192 3300006846 Bacteria 9388
200 Ga0075430_100019149 3300006846 Bacteria 5821
201 Ga0075430_100039626 3300006846 Bacteria 3988
202 Ga0075430_100045970 3300006846 Bacteria 3687
203 Ga0075431_100000082 3300006847 Bacteria 56660
204 Ga0075431_100000486 3300006847 Bacteria 32971
205 Ga0075431_100001687 3300006847 Bacteria 20728
206 Ga0075431_100022095 3300006847 Bacteria 6507
207 Ga0075431_100040956 3300006847 Bacteria 4775
208 Ga0075431_100094758 3300006847 Unclassified 3081
209 Ga0075431_100183036 3300006847 Bacteria 2150
210 Ga0075431_100188110 3300006847 Bacteria 2116
211 Ga0075433_10000427 3300006852 Bacteria 27010
212 Ga0075433_10000839 3300006852 Bacteria 21522
213 Ga0075433_10002893 3300006852 Bacteria 13158
214 Ga0075433_10005550 3300006852 Bacteria 9906
215 Ga0075433_10015829 3300006852 Bacteria 6200
216 Ga0075433_10051244 3300006852 Bacteria 3594
217 Ga0075433_10087738 3300006852 Bacteria 2748
218 Ga0075433_10132597 3300006852 Unclassified 2214
219 Ga0075434_100000180 3300006871 Bacteria 41040
220 Ga0075434_100001347 3300006871 Bacteria 20612
221 Ga0075434_100010601 3300006871 Bacteria 8647
222 Ga0075434_100022413 3300006871 Bacteria 6152
223 Ga0075434_100040271 3300006871 Bacteria 4627
224 Ga0075434_100060934 3300006871 Bacteria 3753
225 Ga0075434_100066897 3300006871 Bacteria 3580
226 Ga0075434_100114253 3300006871 Unclassified 2713
227 Ga0075434_100131672 3300006871 Bacteria 2520
228 Ga0075434_100327389 3300006871 Bacteria 1553
229 Ga0075429_100002798 3300006880 Bacteria 14762
230 Ga0075429_100045702 3300006880 Bacteria 3810
231 Ga0075429_100081107 3300006880 Bacteria 2829
232 Ga0075429_100099264 3300006880 Bacteria 2540
233 Ga0068865_100159805 3300006881 Bacteria 1718
234 Ga0075436_100018788 3300006914 Bacteria 4733
235 Ga0097620_100273969 3300006931 Bacteria 1780
236 Ga0075435_100022605 3300007076 Bacteria 4851
237 Ga0075435_100039959 3300007076 Bacteria 3745
238 Ga0075435_100048550 3300007076 Bacteria 3411
239 Ga0075435_100062337 3300007076 Bacteria 3026
240 Ga0099794_10021772 3300007265 Bacteria 2915
241 Ga0099794_10046698 3300007265 Unclassified 2075
242 Ga0105240_10006182 3300009093 Bacteria 17643
243 Ga0111539_10000463 3300009094 Bacteria 51027
244 Ga0111539_10001292 3300009094 Bacteria 33417
245 Ga0111539_10001789 3300009094 Bacteria 28570
246 Ga0111539_10002439 3300009094 Bacteria 24735
247 Ga0111539_10006594 3300009094 Bacteria 14961
248 Ga0111539_10022315 3300009094 Bacteria 7779
249 Ga0111539_10031709 3300009094 Bacteria 6420
250 Ga0111539_10053095 3300009094 Bacteria 4824
251 Ga0111539_10093292 3300009094 Bacteria 3536
252 Ga0111539_10128670 3300009094 Bacteria 2966
253 Ga0111539_10207545 3300009094 Unclassified 2283
254 Ga0105245_10000233 3300009098 Bacteria 52960
255 Ga0105245_10109242 3300009098 Bacteria 2570
256 Ga0105245_10141866 3300009098 Bacteria 2263
257 Ga0105245_10283097 3300009098 Bacteria 1621
258 Ga0105247_10057589 3300009101 Bacteria 2403
259 Ga0114129_10000110 3300009147 Bacteria 81178
260 Ga0114129_10001205 3300009147 Bacteria 34320
261 Ga0114129_10001511 3300009147 Bacteria 31462
262 Ga0114129_10003221 3300009147 Bacteria 22900
263 Ga0114129_10025730 3300009147 Bacteria 8337
264 Ga0114129_10031560 3300009147 Bacteria 7488
265 Ga0114129_10061418 3300009147 Bacteria 5251
266 Ga0114129_10073338 3300009147 Bacteria 4769
267 Ga0114129_10101502 3300009147 Bacteria 3980
268 Ga0114129_10117860 3300009147 Bacteria 3657
269 Ga0114129_10127799 3300009147 Bacteria 3493
270 Ga0114129_10128039 3300009147 Bacteria 3490
271 Ga0114129_10132239 3300009147 Unclassified 3426
272 Ga0114129_10233089 3300009147 Bacteria 2479
273 Ga0114129_10385374 3300009147 Bacteria 1850
274 Ga0105241_10001410 3300009174 Bacteria 18406
275 Ga0105241_10069582 3300009174 Bacteria 2729
276 Ga0105242_10002855 3300009176 Bacteria 13538
277 Ga0105242_10007792 3300009176 Bacteria 8241
278 Ga0105242_10015305 3300009176 Bacteria 5957
279 Ga0105242_10023761 3300009176 Bacteria 4835
280 Ga0105248_10110182 3300009177 Bacteria 3104
281 Ga0105248_10323173 3300009177 Bacteria 1738
282 Ga0105237_10000549 3300009545 Bacteria 52724
283 Ga0105238_10141696 3300009551 Bacteria 2381
284 Ga0105238_10165024 3300009551 Bacteria 2190
285 Ga0105249_10008153 3300009553 Bacteria 9132
286 Ga0105239_10071671 3300010375 Bacteria 3807
287 Ga0105246_10028242 3300011119 Bacteria 3684
288 Ga0157373_10069753 3300013100 Bacteria 2484
289 Ga0157369_10017116 3300013105 Bacteria 8146
290 Ga0157374_10223928 3300013296 Unclassified 1847
291 Ga0157378_10163632 3300013297 Bacteria 2082
292 Ga0163162_10022241 3300013306 Bacteria 6249
293 Ga0163162_10055520 3300013306 Bacteria 3988
294 Ga0157372_10008010 3300013307 Bacteria 11239
295 Ga0157375_10256242 3300013308 Bacteria 1911
296 Ga0157375_10268348 3300013308 Unclassified 1868
297 Ga0157380_10001243 3300014326 Bacteria 16534
298 Ga0157380_10003226 3300014326 Bacteria 11146
299 Ga0157377_10008351 3300014745 Bacteria 5047
300 Ga0157379_10000876 3300014968 Bacteria 24372
301 Ga0157376_10000809 3300014969 Bacteria 20511
302 Ga0163161_10015178 3300017792 Bacteria 5367
303 Ga0207697_10001435 3300025315 Bacteria 13051
304 Ga0207697_10004936 3300025315 Bacteria 6287
305 Ga0207656_10008015 3300025321 Bacteria 3873
306 Ga0207653_10013704 3300025885 Bacteria 2539
307 Ga0207682_10000953 3300025893 Bacteria 13423
308 Ga0207682_10016474 3300025893 Bacteria 2883
309 Ga0207710_10024134 3300025900 Bacteria 2617
310 Ga0207688_10001607 3300025901 Bacteria 11929
311 Ga0207688_10027388 3300025901 Bacteria 3135
312 Ga0207645_10000043 3300025907 Bacteria 85557
313 Ga0207645_10000400 3300025907 Bacteria 35898
314 Ga0207645_10016127 3300025907 Bacteria 4948
315 Ga0207645_10028198 3300025907 Bacteria 3625
316 Ga0207643_10000424 3300025908 Bacteria 27864
317 Ga0207643_10000489 3300025908 Bacteria 25451
318 Ga0207643_10000732 3300025908 Bacteria 20161
319 Ga0207643_10015996 3300025908 Bacteria 4086
320 Ga0207643_10024053 3300025908 Bacteria 3362
321 Ga0207684_10003777 3300025910 Bacteria 14629
322 Ga0207684_10011947 3300025910 Bacteria 7564
323 Ga0207684_10023037 3300025910 Bacteria 5319
324 Ga0207684_10043927 3300025910 Bacteria 3789
325 Ga0207684_10058826 3300025910 Bacteria 3262
326 Ga0207684_10113773 3300025910 Bacteria 2317
327 Ga0207654_10010692 3300025911 Bacteria 4674
328 Ga0207707_10000116 3300025912 Bacteria 81364
329 Ga0207707_10109336 3300025912 Bacteria 2417
330 Ga0207671_10004294 3300025914 Bacteria 13705
331 Ga0207693_10006943 3300025915 Bacteria 9356
332 Ga0207663_10018254 3300025916 Bacteria 3927
333 Ga0207662_10000043 3300025918 Bacteria 56727
334 Ga0207662_10000891 3300025918 Bacteria 13817
335 Ga0207662_10003651 3300025918 Bacteria 7968
336 Ga0207662_10003719 3300025918 Bacteria 7906
337 Ga0207662_10007198 3300025918 Bacteria 6051
338 Ga0207657_10000211 3300025919 Bacteria 60392
339 Ga0207657_10001235 3300025919 Bacteria 27312
340 Ga0207649_10002015 3300025920 Bacteria 11561
341 Ga0207649_10006395 3300025920 Bacteria 6398
342 Ga0207652_10003841 3300025921 Bacteria 12319
343 Ga0207646_10006951 3300025922 Bacteria 11608
344 Ga0207646_10027940 3300025922 Bacteria 5142
345 Ga0207646_10062784 3300025922 Bacteria 3316
346 Ga0207646_10123365 3300025922 Unclassified 2329
347 Ga0207681_10008695 3300025923 Bacteria 6201
348 Ga0207681_10011598 3300025923 Bacteria 5415
349 Ga0207694_10067456 3300025924 Bacteria 2792
350 Ga0207694_10103230 3300025924 Bacteria 2261
351 Ga0207650_10086341 3300025925 Bacteria 2389
352 Ga0207650_10135932 3300025925 Bacteria 1928
353 Ga0207659_10000351 3300025926 Bacteria 27522
354 Ga0207659_10002998 3300025926 Bacteria 10064
355 Ga0207659_10031425 3300025926 Bacteria 3634
356 Ga0207659_10166067 3300025926 Unclassified 1737
357 Ga0207659_10187184 3300025926 Bacteria 1645
358 Ga0207687_10014744 3300025927 Bacteria 5118
359 Ga0207687_10064136 3300025927 Bacteria 2604
360 Ga0207687_10079611 3300025927 Bacteria 2363
361 Ga0207690_10000823 3300025932 Bacteria 19912
362 Ga0207690_10001495 3300025932 Bacteria 14606
363 Ga0207706_10000162 3300025933 Bacteria 74975
364 Ga0207706_10004021 3300025933 Bacteria 13914
365 Ga0207706_10017429 3300025933 Bacteria 6469
366 Ga0207706_10020893 3300025933 Bacteria 5878
367 Ga0207706_10041882 3300025933 Bacteria 4058
368 Ga0207706_10159902 3300025933 Bacteria 1980
369 Ga0207686_10064513 3300025934 Bacteria 2332
370 Ga0207709_10074430 3300025935 Bacteria 2167
371 Ga0207709_10116300 3300025935 Bacteria 1798
372 Ga0207670_10048949 3300025936 Bacteria 2824
373 Ga0207670_10061086 3300025936 Unclassified 2570
374 Ga0207704_10071650 3300025938 Unclassified 2200
375 Ga0207665_10007130 3300025939 Bacteria 7399
376 Ga0207691_10000053 3300025940 Bacteria 91814
377 Ga0207691_10007695 3300025940 Bacteria 10370
378 Ga0207691_10010524 3300025940 Bacteria 8877
379 Ga0207691_10063428 3300025940 Bacteria 3351
380 Ga0207711_10000276 3300025941 Bacteria 55530
381 Ga0207711_10105861 3300025941 Bacteria 2495
382 Ga0207711_10247569 3300025941 Bacteria 1636
383 Ga0207689_10000026 3300025942 Bacteria 103610
384 Ga0207689_10000201 3300025942 Bacteria 52554
385 Ga0207689_10005325 3300025942 Bacteria 11533
386 Ga0207689_10006142 3300025942 Bacteria 10632
387 Ga0207689_10057840 3300025942 Bacteria 3189
388 Ga0207689_10111208 3300025942 Bacteria 2251
389 Ga0207661_10031217 3300025944 Bacteria 4112
390 Ga0207661_10031757 3300025944 Unclassified 4084
391 Ga0207679_10000449 3300025945 Bacteria 29072
392 Ga0207679_10006771 3300025945 Bacteria 7260
393 Ga0207667_10002107 3300025949 Bacteria 24946
394 Ga0207651_10002705 3300025960 Bacteria 8496
395 Ga0207651_10073549 3300025960 Bacteria 2430
396 Ga0207651_10102406 3300025960 Unclassified 2128
397 Ga0207651_10166804 3300025960 Bacteria 1732
398 Ga0207712_10066798 3300025961 Bacteria 2572
399 Ga0207668_10037148 3300025972 Bacteria 3258
400 Ga0207668_10046780 3300025972 Bacteria 2958
401 Ga0207640_10099415 3300025981 Bacteria 2036
402 Ga0207658_10001466 3300025986 Bacteria 18396
403 Ga0207658_10066628 3300025986 Unclassified 2709
404 Ga0207677_10039272 3300026023 Bacteria 3111
405 Ga0207677_10145629 3300026023 Bacteria 1820
406 Ga0207703_10000059 3300026035 Bacteria 134931
407 Ga0207703_10016319 3300026035 Bacteria 5789
408 Ga0207639_10004331 3300026041 Bacteria 9569
409 Ga0207639_10032200 3300026041 Bacteria 3858
410 Ga0207639_10119734 3300026041 Bacteria 2161
411 Ga0207678_10004271 3300026067 Bacteria 12812
412 Ga0207708_10012567 3300026075 Bacteria 6313
413 Ga0207708_10015376 3300026075 Bacteria 5740
414 Ga0207702_10001143 3300026078 Bacteria 27129
415 Ga0207641_10012977 3300026088 Bacteria 6835
416 Ga0207641_10025232 3300026088 Bacteria 4902
417 Ga0207648_10001530 3300026089 Bacteria 25466
418 Ga0207648_10003683 3300026089 Bacteria 16035
419 Ga0207648_10012060 3300026089 Bacteria 8105
420 Ga0207648_10012239 3300026089 Bacteria 8034
421 Ga0207648_10039622 3300026089 Bacteria 4143
422 Ga0207674_10000951 3300026116 Bacteria 37804
423 Ga0207674_10001221 3300026116 Bacteria 33487
424 Ga0207674_10121570 3300026116 Bacteria 2578
425 Ga0207674_10228190 3300026116 Bacteria 1810
426 Ga0207675_100000233 3300026118 Bacteria 52659
427 Ga0207675_100002501 3300026118 Bacteria 18185
428 Ga0207675_100016025 3300026118 Bacteria 6997
429 Ga0207675_100069969 3300026118 Bacteria 3280
430 Ga0207675_100236249 3300026118 Bacteria 1765
431 Ga0207683_10000624 3300026121 Bacteria 32521
432 Ga0207683_10007833 3300026121 Bacteria 9145
433 Ga0207683_10045698 3300026121 Bacteria 3830
434 Ga0209969_1001359 3300027360 Bacteria 3358
435 Ga0209984_1000634 3300027424 Bacteria 3780
436 Ga0209968_1000573 3300027526 Bacteria 5687
437 Ga0209970_1000407 3300027614 Bacteria 7263
438 Ga0209971_1000037 3300027682 Bacteria 45920
439 Ga0209966_1000378 3300027695 Bacteria 13523
440 Ga0209998_10000042 3300027717 Bacteria 51743
441 Ga0209974_10000465 3300027876 Bacteria 13444
442 Ga0207428_10000027 3300027907 Bacteria 250186
443 Ga0207428_10000245 3300027907 Bacteria 74009
444 Ga0207428_10000849 3300027907 Bacteria 34443
445 Ga0207428_10005064 3300027907 Bacteria 12382
446 Ga0207428_10007736 3300027907 Bacteria 9776
447 Ga0207428_10008043 3300027907 Bacteria 9569
448 Ga0207428_10023843 3300027907 Bacteria 5140
449 Ga0207428_10042406 3300027907 Bacteria 3680
450 Ga0207428_10188618 3300027907 Bacteria 1555
451 Ga0268266_10001681 3300028379 Bacteria 25466
452 Ga0268265_10005618 3300028380 Bacteria 8563
453 Ga0268265_10022805 3300028380 Unclassified 4404
454 Ga0268265_10061875 3300028380 Bacteria 2874
455 Ga0268264_10003233 3300028381 Bacteria 14106
456 Ga0307408_100058337 3300031548 Bacteria 2806
457 Ga0307405_10039995 3300031731 Bacteria 2838
458 Ga0307405_10074946 3300031731 Bacteria 2190
459 Ga0307416_100050470 3300032002 Bacteria 3316
460 Ga0307416_100122713 3300032002 Bacteria 2320
461 Ga0373940_0001611 3300035088 Bacteria 4141
462 Ga0373940_0013102 3300035088 Bacteria 1998
463 Ga0373949_0007232 3300035090 Bacteria 2432
464 Ga0373939_0007541 3300035114 Bacteria 2644
465 Ga0373939_0016739 3300035114 Bacteria 1937
466 Ga0373961_0007741 3300035241 Bacteria 2603
467 Ga0373933_0106003 3300035724 Bacteria 1749
468 Ga0373925_0092635 3300037068 Bacteria 2312
469 Ga0395900_0002273 3300037418 Bacteria 21347
470 Ga0395898_0005721 3300037466 Bacteria 13392
471 Ga0395901_0021074 3300038443 Bacteria 6676
472 Ga0439448_0005919 3300042005 Bacteria 3498
473 Ga0439435_0002235 3300042436 Bacteria 3796
474 Ga0439435_0004587 3300042436 Bacteria 2989
475 Ga0439459_0000110 3300042438 Bacteria 7701
476 Ga0439464_0000830 3300042439 Bacteria 6826
477 Ga0439460_0000197 3300042461 Bacteria 11816
478 Ga0451577_0002796 3300042876 Bacteria 20141
479 Ga0451577_0006253 3300042876 Bacteria 11929
480 Ga0451577_0053635 3300042876 Bacteria 3599
481 Ga0451577_0068274 3300042876 Bacteria 3170
482 Ga0439440_0009806 3300042993 Bacteria 1989
483 Ga0453683_0026123 3300044673 Bacteria 3708
484 Ga0453683_0050488 3300044673 Bacteria 2606
485 Ga0453684_0023625 3300044712 Bacteria 9036
486 Ga0453684_0058416 3300044712 Bacteria 4983
487 Ga0453684_0118568 3300044712 Bacteria 3201
488 Ga0453684_0272065 3300044712 Bacteria 1935
489 Ga0451576_0004364 3300045051 Bacteria 18442
490 Ga0451576_0005141 3300045051 Bacteria 16570
491 Ga0451576_0005764 3300045051 Bacteria 15422
492 Ga0451576_0019775 3300045051 Bacteria 7347
493 Ga0451576_0026087 3300045051 Bacteria 6287
494 Ga0451576_0045920 3300045051 Bacteria 4599
495 Ga0451576_0065829 3300045051 Bacteria 3773
496 Ga0451576_0084972 3300045051 Unclassified 3291
497 Ga0451576_0181174 3300045051 Bacteria 2199
498 Ga0495603_0017434 3300046455 Bacteria 4345
499 Ga0495629_0016857 3300046459 Bacteria 5243
500 Ga0495580_0000727 3300046472 Bacteria 28206
501 Ga0495628_0055710 3300046516 Bacteria 3114
502 Ga0495633_0025371 3300046558 Bacteria 2919
503 Ga0495667_0000367 3300046559 Bacteria 28503
504 Ga0495656_0064340 3300046615 Unclassified 1610
505 Ga0495659_0003220 3300046664 Bacteria 5230
506 Ga0495659_0019150 3300046664 Bacteria 2289
507 Ga0495669_0030073 3300046684 Bacteria 2384
508 Ga0495674_0088115 3300047319 Bacteria 2655
509 Ga0496106_0000637 3300048909 Bacteria 25174
510 Ga0496112_0012711 3300048915 Bacteria 7742
511 Ga0496112_0073778 3300048915 Bacteria 3373
512 Ga0501031_0023404 3300049568 Bacteria 4027
513 Ga0501033_0025025 3300049570 Bacteria 4498
514 Ga0501033_0106442 3300049570 Unclassified 2043
515 Ga0501034_0006093 3300049571 Bacteria 13017
516 Ga0501034_0190474 3300049571 Bacteria 2013
517 Ga0501036_0000997 3300049572 Bacteria 21389
518 Ga0501036_0050451 3300049572 Unclassified 3524
519 Ga0501037_0086148 3300049573 Bacteria 2274
520 Ga0501038_0000877 3300049574 Bacteria 26657
521 Ga0501038_0054489 3300049574 Bacteria 3440
522 Ga0501039_0000306 3300049575 Bacteria 34767
523 Ga0501039_0012641 3300049575 Bacteria 6453
524 Ga0501039_0072161 3300049575 Bacteria 2683
525 Ga0501040_0000832 3300049576 Bacteria 19300
526 Ga0501040_0002340 3300049576 Bacteria 12167
527 Ga0501040_0015254 3300049576 Bacteria 5078
528 Ga0501040_0047905 3300049576 Bacteria 2920
529 Ga0501040_0156538 3300049576 Bacteria 1609
530 Ga0501041_0006125 3300049577 Bacteria 7033
531 Ga0501041_0006839 3300049577 Bacteria 6683
532 Ga0501041_0013389 3300049577 Bacteria 4862
533 Ga0501042_0006874 3300049578 Bacteria 7423
534 Ga0501042_0014338 3300049578 Bacteria 5409
535 Ga0501042_0034409 3300049578 Bacteria 3593
536 Ga0501042_0157396 3300049578 Bacteria 1639
537 Ga0501046_0033137 3300049580 Bacteria 4177
538 Ga0501046_0075277 3300049580 Bacteria 2617
539 Ga0501046_0114920 3300049580 Bacteria 2053
540 Ga0501047_0109507 3300049581 Bacteria 2645
541 Ga0501047_0221891 3300049581 Bacteria 1746
542 Ga0501048_0001234 3300049582 Bacteria 19386
543 Ga0501048_0024994 3300049582 Bacteria 4357
544 Ga0501048_0083670 3300049582 Bacteria 2250
545 Ga0501068_0001222 3300049584 Bacteria 13619
546 Ga0501068_0031832 3300049584 Bacteria 3134
547 Ga0501070_0013626 3300049586 Bacteria 6852
548 Ga0501072_0002438 3300049588 Bacteria 13931
549 Ga0501072_0027727 3300049588 Bacteria 4418
550 Ga0501072_0035451 3300049588 Bacteria 3908
551 Ga0501072_0078538 3300049588 Bacteria 2613
552 Ga0501072_0132229 3300049588 Bacteria 1989
553 Ga0501073_0106623 3300049589 Bacteria 1944
554 Ga0501074_0000224 3300049590 Bacteria 31333
555 Ga0501074_0032375 3300049590 Bacteria 3787
556 Ga0501074_0164172 3300049590 Bacteria 1586
557 Ga0501075_0001171 3300049591 Bacteria 16961
558 Ga0501075_0006351 3300049591 Bacteria 8129
559 Ga0501075_0007121 3300049591 Bacteria 7737
560 Ga0501075_0043634 3300049591 Bacteria 3363
561 Ga0501075_0055523 3300049591 Bacteria 2980
562 Ga0501075_0093010 3300049591 Bacteria 2289
563 Ga0501076_0001587 3300049592 Bacteria 15287
564 Ga0501076_0029084 3300049592 Bacteria 4295
565 Ga0501076_0069071 3300049592 Bacteria 2823
566 Ga0501076_0118503 3300049592 Bacteria 2143
567 Ga0501077_0009200 3300049593 Bacteria 6134
568 Ga0501077_0009822 3300049593 Bacteria 5953
569 Ga0501077_0079258 3300049593 Unclassified 2081
570 Ga0501077_0080278 3300049593 Bacteria 2067
571 Ga0501079_0001398 3300049741 Bacteria 17010
572 Ga0501079_0011415 3300049741 Bacteria 6780
573 Ga0501079_0012871 3300049741 Bacteria 6386
574 Ga0501079_0033516 3300049741 Bacteria 3951
575 Ga0501079_0056218 3300049741 Bacteria 3036
576 Ga0501079_0085288 3300049741 Bacteria 2444
577 Ga0501080_0003252 3300049742 Bacteria 14335
578 Ga0501080_0162053 3300049742 Bacteria 2065
579 Ga0501081_0003382 3300049743 Bacteria 10153
580 Ga0501081_0005258 3300049743 Bacteria 8341
581 Ga0501081_0011638 3300049743 Bacteria 5758
582 Ga0501081_0013942 3300049743 Bacteria 5292
583 Ga0501081_0028626 3300049743 Bacteria 3760
584 Ga0501081_0055063 3300049743 Bacteria 2748
585 Ga0501081_0151553 3300049743 Unclassified 1666
586 Ga0501083_0014659 3300049744 Bacteria 5480
587 Ga0501045_0001152 3300049824 Bacteria 17508
588 Ga0501045_0018435 3300049824 Bacteria 4964
589 Ga0501045_0019119 3300049824 Bacteria 4880
590 Ga0501045_0035209 3300049824 Bacteria 3634
591 Ga0501045_0039549 3300049824 Bacteria 3432
592 Ga0501045_0230241 3300049824 Bacteria 1380
593 nmdc:mga03683_2028_c1 3300050489 Bacteria 6198
594 nmdc:mga00v17_2153_c1 3300050491 Bacteria 10125
595 nmdc:mga0k408_19033_c1 3300050493 Bacteria 3834
596 nmdc:mga0k408_7123_c1 3300050493 Bacteria 5975
597 nmdc:mga05p37_11414_c1 3300050507 Bacteria 10575
598 nmdc:mga05p37_14939_c1 3300050507 Bacteria 6685
599 nmdc:mga05p37_174216_c1 3300050507 Unclassified 2622
600 nmdc:mga05p37_183619_c1 3300050507 Bacteria 2543
601 nmdc:mga05p37_19057_c1 3300050507 Bacteria 8299
602 nmdc:mga05p37_208119_c1 3300050507 Bacteria 2365
603 nmdc:mga05p37_250013_c1 3300050507 Bacteria 2127
604 nmdc:mga05p37_67675_c2 3300050507 Bacteria 1529
605 nmdc:mga05p37_70532_c1 3300050507 Bacteria 4298
606 nmdc:mga05p37_7406_c1 3300050507 Bacteria 12949
607 nmdc:mga05p37_7480_c1 3300050507 Bacteria 12877
608 nmdc:mga09592_17484_c1 3300050508 Bacteria 5875
609 nmdc:mga09592_190943_c1 3300050508 Bacteria 1773
610 nmdc:mga09592_244269_c1 3300050508 Bacteria 1556
611 nmdc:mga09592_28662_c1 3300050508 Bacteria 3669
612 nmdc:mga09592_3878_c1 3300050508 Bacteria 12046
613 nmdc:mga09592_48767_c1 3300050508 Bacteria 3570
614 nmdc:mga0qj67_22405_c1 3300050509 Bacteria 4853
615 nmdc:mga0qj67_54944_c1 3300050509 Bacteria 3154
616 nmdc:mga0qj67_7809_c1 3300050509 Bacteria 7907
617 nmdc:mga06r32_1744_c1 3300050510 Bacteria 19568
618 nmdc:mga06r32_174880_c1 3300050510 Bacteria 2131
619 nmdc:mga06r32_39458_c1 3300050510 Bacteria 4480
620 nmdc:mga06r32_71500_c1 3300050510 Bacteria 3357
621 nmdc:mga06r32_7977_c1 3300050510 Bacteria 9516
622 nmdc:mga06r32_89056_c1 3300050510 Unclassified 3013
623 nmdc:mga08y16_11754_c1 3300050511 Bacteria 9196
624 nmdc:mga08y16_1306_c1 3300050511 Bacteria 24771
625 nmdc:mga08y16_17787_c1 3300050511 Bacteria 7488
626 nmdc:mga08y16_201006_c1 3300050511 Bacteria 2065
627 nmdc:mga08y16_24924_c1 3300050511 Bacteria 6310
628 nmdc:mga08y16_2919_c1 3300050511 Bacteria 17590
629 nmdc:mga08y16_31120_c1 3300050511 Bacteria 5614
630 nmdc:mga08y16_52414_c1 3300050511 Bacteria 4269
631 nmdc:mga08y16_597_c1 3300050511 Bacteria 33660
632 nmdc:mga0n895_14004_c1 3300050512 Bacteria 7265
633 nmdc:mga0n895_1895_c1 3300050512 Bacteria 16010
634 nmdc:mga0n895_24005_c1 3300050512 Bacteria 5740
635 nmdc:mga0n895_43435_c1 3300050512 Bacteria 4380
636 nmdc:mga0n895_477_c1 3300050512 Bacteria 26935
637 nmdc:mga0n895_53201_c1 3300050512 Bacteria 3978
638 nmdc:mga0n895_57467_c1 3300050512 Bacteria 3835
639 nmdc:mga0n895_60869_c1 3300050512 Bacteria 3726
640 nmdc:mga0n895_77660_c1 3300050512 Bacteria 3303
641 nmdc:mga0n895_83684_c1 3300050512 Bacteria 3183
642 nmdc:mga0rr50_109889_c1 3300050513 Bacteria 2180
643 nmdc:mga0rr50_27543_c1 3300050513 Bacteria 3981
644 nmdc:mga0rr50_34073_c1 3300050513 Bacteria 3644
645 nmdc:mga0rr50_35406_c1 3300050513 Bacteria 3585
646 nmdc:mga0rr50_7633_c1 3300050513 Bacteria 6688
647 nmdc:mga08x19_17737_c1 3300050514 Bacteria 4359
648 nmdc:mga08x19_57107_c1 3300050514 Bacteria 2521
649 nmdc:mga0a205_11142_c1 3300050515 Bacteria 8275
650 nmdc:mga0a205_112429_c1 3300050515 Bacteria 2623
651 nmdc:mga0a205_133836_c1 3300050515 Bacteria 2380
652 nmdc:mga0a205_13783_c1 3300050515 Bacteria 7537
653 nmdc:mga0a205_139255_c1 3300050515 Unclassified 2327
654 nmdc:mga0a205_17339_c1 3300050515 Bacteria 6748
655 nmdc:mga0a205_196715_c1 3300050515 Bacteria 1907
656 nmdc:mga0a205_1991_c1 3300050515 Bacteria 17807
657 nmdc:mga0a205_227_c1 3300050515 Bacteria 39744
658 nmdc:mga0a205_58581_c1 3300050515 Bacteria 3720
659 nmdc:mga0a205_646_c1 3300050515 Bacteria 27674
660 nmdc:mga0a205_66283_c1 3300050515 Bacteria 3489
661 Ga0501084_0001523 3300054114 Bacteria 18387
662 Ga0501084_0014381 3300054114 Bacteria 6558
663 Ga0501084_0017452 3300054114 Bacteria 5967
664 Ga0501082_0000243 3300060353 Bacteria 47694
665 Ga0501082_0005963 3300060353 Bacteria 10570
666 Ga0530510_0001138 3300061734 Bacteria 17692
667 Ga0530510_0005834 3300061734 Bacteria 8533
668 Ga0530510_0006581 3300061734 Bacteria 8100
669 Ga0530510_0022799 3300061734 Bacteria 4461
670 Ga0530510_0047130 3300061734 Bacteria 3114
671 Ga0530510_0057599 3300061734 Bacteria 2808
672 Ga0530510_0099475 3300061734 Bacteria 2126
673 Ga0530510_0138480 3300061734 Bacteria 1792

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061734 Ga0530510_0005834 Ga0530510_0005834_1084_2487 383
2 3300009551 Ga0105238_10141696 Ga0105238_101416961 400
3 3300025942 Ga0207689_10057840 Ga0207689_100578403 414
4 3300049568 Ga0501031_0023404 Ga0501031_0023404_2331_3737 415
5 3300049570 Ga0501033_0025025 Ga0501033_0025025_1090_2496 415
6 3300049572 Ga0501036_0000997 Ga0501036_0000997_10003_11409 415
7 3300049573 Ga0501037_0086148 Ga0501037_0086148_281_1687 415
8 3300049574 Ga0501038_0000877 Ga0501038_0000877_10797_12203 415
9 3300049575 Ga0501039_0000306 Ga0501039_0000306_9001_10407 415
10 3300049576 Ga0501040_0000832 Ga0501040_0000832_9587_10993 415
11 3300049577 Ga0501041_0006839 Ga0501041_0006839_5182_6588 415
12 3300049582 Ga0501048_0001234 Ga0501048_0001234_15665_17071 415
13 3300049584 Ga0501068_0001222 Ga0501068_0001222_11930_13336 415
14 3300049586 Ga0501070_0013626 Ga0501070_0013626_1781_3187 415
15 3300049588 Ga0501072_0002438 Ga0501072_0002438_1789_3195 415
16 3300049589 Ga0501073_0106623 Ga0501073_0106623_138_1544 415
17 3300049590 Ga0501074_0000224 Ga0501074_0000224_18150_19556 415
18 3300049591 Ga0501075_0001171 Ga0501075_0001171_150_1556 415
19 3300049592 Ga0501076_0001587 Ga0501076_0001587_10737_12143 415
20 3300049593 Ga0501077_0009822 Ga0501077_0009822_2029_3435 415
21 3300049741 Ga0501079_0001398 Ga0501079_0001398_2002_3408 415
22 3300049742 Ga0501080_0003252 Ga0501080_0003252_10898_12304 415
23 3300049743 Ga0501081_0003382 Ga0501081_0003382_3189_4595 415
24 3300049824 Ga0501045_0001152 Ga0501045_0001152_13262_14668 415
25 3300054114 Ga0501084_0001523 Ga0501084_0001523_2099_3505 415
26 3300060353 Ga0501082_0000243 Ga0501082_0000243_24109_25515 415
27 3300061734 Ga0530510_0001138 Ga0530510_0001138_13262_14668 415
28 3300009147 Ga0114129_10233089 Ga0114129_102330892 416
29 3300050507 nmdc:mga05p37_208119_c1 nmdc:mga05p37_208119_c1_331_1740 416
30 3300050513 nmdc:mga0rr50_27543_c1 nmdc:mga0rr50_27543_c1_1814_3223 416
31 3300009098 Ga0105245_10283097 Ga0105245_102830971 417
32 3300009147 Ga0114129_10001205 Ga0114129_1000120534 417
33 3300050507 nmdc:mga05p37_7480_c1 nmdc:mga05p37_7480_c1_7452_8858 417
34 3300003203 JGI25406J46586_10002349 JGI25406J46586_100023497 421
35 3300005985 Ga0081539_10000096 Ga0081539_10000096104 421
36 3300035724 Ga0373933_0106003 Ga0373933_0106003_366_1739 421
37 3300003203 JGI25406J46586_10000120 JGI25406J46586_1000012014 422
38 3300005549 Ga0070704_100161853 Ga0070704_1001618532 422
39 3300005985 Ga0081539_10000024 Ga0081539_1000002441 422
40 3300006051 Ga0075364_10015737 Ga0075364_100157372 423
41 3300006177 Ga0075362_10000233 Ga0075362_100002332 423
42 3300006195 Ga0075366_10009293 Ga0075366_100092932 423
43 3300050489 nmdc:mga03683_2028_c1 nmdc:mga03683_2028_c1_2864_4264 423
44 3300050491 nmdc:mga00v17_2153_c1 nmdc:mga00v17_2153_c1_629_2029 423
45 3300050493 nmdc:mga0k408_7123_c1 nmdc:mga0k408_7123_c1_631_2031 423
46 3300027907 Ga0207428_10188618 Ga0207428_101886182 425
47 3300046558 Ga0495633_0025371 Ga0495633_0025371_1144_2592 425
48 3300046664 Ga0495659_0003220 Ga0495659_0003220_37_1485 425
49 3300050515 nmdc:mga0a205_112429_c1 nmdc:mga0a205_112429_c1_1234_2577 425
50 3300006847 Ga0075431_100183036 Ga0075431_1001830362 426
51 3300050507 nmdc:mga05p37_250013_c1 nmdc:mga05p37_250013_c1_669_2081 426
52 3300050510 nmdc:mga06r32_174880_c1 nmdc:mga06r32_174880_c1_85_1497 426
53 3300006195 Ga0075366_10007412 Ga0075366_100074126 428
54 3300006844 Ga0075428_100168638 Ga0075428_1001686382 428
55 3300006846 Ga0075430_100007192 Ga0075430_1000071929 428
56 3300009094 Ga0111539_10001789 Ga0111539_1000178913 428
57 3300027907 Ga0207428_10000849 Ga0207428_1000084922 428
58 3300045051 Ga0451576_0181174 Ga0451576_0181174_767_2179 428
59 3300046472 Ga0495580_0000727 Ga0495580_0000727_11374_12786 428
60 3300050493 nmdc:mga0k408_19033_c1 nmdc:mga0k408_19033_c1_556_1956 428
61 3300050511 nmdc:mga08y16_24924_c1 nmdc:mga08y16_24924_c1_3568_4983 428
62 3300006852 Ga0075433_10000427 Ga0075433_1000042719 430
63 3300006871 Ga0075434_100000180 Ga0075434_10000018019 430
64 3300006880 Ga0075429_100002798 Ga0075429_1000027988 430
65 3300009147 Ga0114129_10000110 Ga0114129_1000011032 430
66 3300049591 Ga0501075_0093010 Ga0501075_0093010_838_2259 430
67 3300049592 Ga0501076_0029084 Ga0501076_0029084_17_1438 430
68 3300050507 nmdc:mga05p37_7406_c1 nmdc:mga05p37_7406_c1_3851_5263 430
69 3300050508 nmdc:mga09592_3878_c1 nmdc:mga09592_3878_c1_4759_6171 430
70 3300050512 nmdc:mga0n895_14004_c1 nmdc:mga0n895_14004_c1_524_1936 430
71 3300050515 nmdc:mga0a205_227_c1 nmdc:mga0a205_227_c1_32943_34355 430
72 3300006852 Ga0075433_10051244 Ga0075433_100512445 431
73 3300046664 Ga0495659_0019150 Ga0495659_0019150_722_2134 431
74 3300049580 Ga0501046_0033137 Ga0501046_0033137_330_1736 431
75 3300049741 Ga0501079_0085288 Ga0501079_0085288_598_2004 431
76 3300049824 Ga0501045_0019119 Ga0501045_0019119_2122_3528 431
77 3300050507 nmdc:mga05p37_70532_c1 nmdc:mga05p37_70532_c1_757_2169 431
78 3300050515 nmdc:mga0a205_17339_c1 nmdc:mga0a205_17339_c1_804_2216 431
79 3300005347 Ga0070668_100214214 Ga0070668_1002142141 432
80 3300005445 Ga0070708_100046013 Ga0070708_1000460132 432
81 3300005518 Ga0070699_100068977 Ga0070699_1000689772 432
82 3300025972 Ga0207668_10037148 Ga0207668_100371483 432
83 3300042436 Ga0439435_0002235 Ga0439435_0002235_1706_3133 432
84 3300049824 Ga0501045_0230241 Ga0501045_0230241_20_1336 432
85 3300005329 Ga0070683_100001902 Ga0070683_10000190216 433
86 3300005330 Ga0070690_100003636 Ga0070690_1000036361 433
87 3300005335 Ga0070666_10004927 Ga0070666_100049272 433
88 3300005343 Ga0070687_100000488 Ga0070687_1000004884 433
89 3300005344 Ga0070661_100015343 Ga0070661_1000153434 433
90 3300005347 Ga0070668_100001246 Ga0070668_1000012462 433
91 3300005354 Ga0070675_100167651 Ga0070675_1001676512 433
92 3300005356 Ga0070674_100010071 Ga0070674_1000100715 433
93 3300005365 Ga0070688_100099993 Ga0070688_1000999932 433
94 3300005366 Ga0070659_100002251 Ga0070659_1000022512 433
95 3300005441 Ga0070700_100039984 Ga0070700_1000399842 433
96 3300005455 Ga0070663_100051172 Ga0070663_1000511722 433
97 3300005466 Ga0070685_10000264 Ga0070685_1000026413 433
98 3300005539 Ga0068853_100015316 Ga0068853_1000153163 433
99 3300005543 Ga0070672_100002079 Ga0070672_1000020793 433
100 3300005547 Ga0070693_100009077 Ga0070693_1000090772 433
101 3300005563 Ga0068855_100000331 Ga0068855_10000033155 433
102 3300005577 Ga0068857_100000030 Ga0068857_1000000305 433
103 3300005616 Ga0068852_100000767 Ga0068852_10000076720 433
104 3300005718 Ga0068866_10000083 Ga0068866_1000008320 433
105 3300005719 Ga0068861_100000212 Ga0068861_10000021229 433
106 3300005840 Ga0068870_10000633 Ga0068870_1000063310 433
107 3300005841 Ga0068863_100004918 Ga0068863_10000491813 433
108 3300005844 Ga0068862_100002125 Ga0068862_10000212518 433
109 3300006358 Ga0068871_100018934 Ga0068871_1000189343 433
110 3300009093 Ga0105240_10006182 Ga0105240_1000618217 433
111 3300009098 Ga0105245_10000233 Ga0105245_1000023323 433
112 3300009101 Ga0105247_10057589 Ga0105247_100575892 433
113 3300009176 Ga0105242_10002855 Ga0105242_1000285513 433
114 3300009545 Ga0105237_10000549 Ga0105237_1000054930 433
115 3300013100 Ga0157373_10069753 Ga0157373_100697532 433
116 3300013296 Ga0157374_10223928 Ga0157374_102239282 433
117 3300013297 Ga0157378_10163632 Ga0157378_101636322 433
118 3300013306 Ga0163162_10055520 Ga0163162_100555202 433
119 3300014745 Ga0157377_10008351 Ga0157377_100083513 433
120 3300014968 Ga0157379_10000876 Ga0157379_1000087623 433
121 3300014969 Ga0157376_10000809 Ga0157376_1000080915 433
122 3300025315 Ga0207697_10004936 Ga0207697_100049365 433
123 3300025321 Ga0207656_10008015 Ga0207656_100080153 433
124 3300025893 Ga0207682_10000953 Ga0207682_100009536 433
125 3300025900 Ga0207710_10024134 Ga0207710_100241342 433
126 3300025907 Ga0207645_10000043 Ga0207645_1000004358 433
127 3300025908 Ga0207643_10000489 Ga0207643_1000048923 433
128 3300025914 Ga0207671_10004294 Ga0207671_100042942 433
129 3300025918 Ga0207662_10000043 Ga0207662_1000004351 433
130 3300025919 Ga0207657_10001235 Ga0207657_1000123523 433
131 3300025924 Ga0207694_10067456 Ga0207694_100674562 433
132 3300025926 Ga0207659_10000351 Ga0207659_1000035123 433
133 3300025927 Ga0207687_10014744 Ga0207687_100147442 433
134 3300025932 Ga0207690_10000823 Ga0207690_1000082317 433
135 3300025933 Ga0207706_10000162 Ga0207706_1000016277 433
136 3300025940 Ga0207691_10000053 Ga0207691_1000005315 433
137 3300025941 Ga0207711_10000276 Ga0207711_100002762 433
138 3300025942 Ga0207689_10000026 Ga0207689_1000002669 433
139 3300025944 Ga0207661_10031217 Ga0207661_100312172 433
140 3300025960 Ga0207651_10002705 Ga0207651_100027054 433
141 3300025972 Ga0207668_10046780 Ga0207668_100467802 433
142 3300025981 Ga0207640_10099415 Ga0207640_100994152 433
143 3300025986 Ga0207658_10001466 Ga0207658_1000146614 433
144 3300026035 Ga0207703_10000059 Ga0207703_1000005955 433
145 3300026041 Ga0207639_10032200 Ga0207639_100322003 433
146 3300026067 Ga0207678_10004271 Ga0207678_100042712 433
147 3300026088 Ga0207641_10012977 Ga0207641_100129776 433
148 3300026089 Ga0207648_10001530 Ga0207648_100015303 433
149 3300026116 Ga0207674_10001221 Ga0207674_100012219 433
150 3300026118 Ga0207675_100000233 Ga0207675_10000023322 433
151 3300026121 Ga0207683_10000624 Ga0207683_100006249 433
152 3300028379 Ga0268266_10001681 Ga0268266_100016813 433
153 3300048909 Ga0496106_0000637 Ga0496106_0000637_1425_2885 433
154 3300048915 Ga0496112_0012711 Ga0496112_0012711_5641_7101 433
155 3300005983 Ga0081540_1000146 Ga0081540_100014618 435
156 3300006358 Ga0068871_100152573 Ga0068871_1001525732 436
157 3300007265 Ga0099794_10021772 Ga0099794_100217722 436
158 3300005290 Ga0065712_10081843 Ga0065712_100818431 437
159 3300048915 Ga0496112_0073778 Ga0496112_0073778_44_1474 437
160 3300050515 nmdc:mga0a205_58581_c1 nmdc:mga0a205_58581_c1_2338_3708 437
161 3300005341 Ga0070691_10018250 Ga0070691_100182503 438
162 3300005406 Ga0070703_10003809 Ga0070703_100038094 438
163 3300005444 Ga0070694_100026892 Ga0070694_1000268923 438
164 3300005518 Ga0070699_100035333 Ga0070699_1000353333 438
165 3300005546 Ga0070696_100043193 Ga0070696_1000431932 438
166 3300005577 Ga0068857_100113601 Ga0068857_1001136012 438
167 3300005843 Ga0068860_100129469 Ga0068860_1001294692 438
168 3300009176 Ga0105242_10015305 Ga0105242_100153052 438
169 3300009177 Ga0105248_10323173 Ga0105248_103231731 438
170 3300025885 Ga0207653_10013704 Ga0207653_100137041 438
171 3300025935 Ga0207709_10074430 Ga0207709_100744302 438
172 3300026116 Ga0207674_10228190 Ga0207674_102281902 438
173 3300050512 nmdc:mga0n895_43435_c1 nmdc:mga0n895_43435_c1_1426_2838 438
174 3300050513 nmdc:mga0rr50_34073_c1 nmdc:mga0rr50_34073_c1_199_1611 438
175 3300005719 Ga0068861_100188320 Ga0068861_1001883202 439
176 3300005985 Ga0081539_10002353 Ga0081539_1000235311 439
177 3300009094 Ga0111539_10093292 Ga0111539_100932922 439
178 3300009147 Ga0114129_10031560 Ga0114129_100315607 439
179 3300025926 Ga0207659_10187184 Ga0207659_101871841 439
180 3300026118 Ga0207675_100236249 Ga0207675_1002362492 439
181 3300027907 Ga0207428_10042406 Ga0207428_100424063 439
182 3300050508 nmdc:mga09592_244269_c1 nmdc:mga09592_244269_c1_51_1463 439
183 3300050511 nmdc:mga08y16_52414_c1 nmdc:mga08y16_52414_c1_654_2066 439
184 3300046684 Ga0495669_0030073 Ga0495669_0030073_576_1994 440
185 3300061734 Ga0530510_0138480 Ga0530510_0138480_341_1750 441
186 3300005617 Ga0068859_100273956 Ga0068859_1002739561 443
187 3300006931 Ga0097620_100273969 Ga0097620_1002739691 443
188 3300005356 Ga0070674_100017360 Ga0070674_1000173603 445
189 3300037068 Ga0373925_0092635 Ga0373925_0092635_553_2013 445
190 3300049571 Ga0501034_0006093 Ga0501034_0006093_8011_9432 445
191 3300049574 Ga0501038_0054489 Ga0501038_0054489_805_2214 445
192 3300049576 Ga0501040_0015254 Ga0501040_0015254_2985_4394 445
193 3300049577 Ga0501041_0013389 Ga0501041_0013389_1433_2842 445
194 3300049578 Ga0501042_0006874 Ga0501042_0006874_1003_2397 445
195 3300049588 Ga0501072_0078538 Ga0501072_0078538_506_1915 445
196 3300049741 Ga0501079_0056218 Ga0501079_0056218_1395_2804 445
197 3300049742 Ga0501080_0162053 Ga0501080_0162053_22_1431 445
198 3300049743 Ga0501081_0011638 Ga0501081_0011638_4300_5709 445
199 3300049824 Ga0501045_0035209 Ga0501045_0035209_1426_2835 445
200 3300060353 Ga0501082_0005963 Ga0501082_0005963_7127_8536 445
201 3300061734 Ga0530510_0006581 Ga0530510_0006581_2975_4384 445
202 3300005467 Ga0070706_100006413 Ga0070706_10000641314 446
203 3300005543 Ga0070672_100019254 Ga0070672_1000192543 446
204 3300006871 Ga0075434_100066897 Ga0075434_1000668972 446
205 3300025910 Ga0207684_10043927 Ga0207684_100439273 446
206 3300045051 Ga0451576_0026087 Ga0451576_0026087_2221_3681 446
207 3300050507 nmdc:mga05p37_67675_c2 nmdc:mga05p37_67675_c2_61_1401 446
208 3300050513 nmdc:mga0rr50_7633_c1 nmdc:mga0rr50_7633_c1_2799_4220 446
209 3300005353 Ga0070669_100105021 Ga0070669_1001050212 447
210 3300005364 Ga0070673_100004953 Ga0070673_1000049535 447
211 3300005367 Ga0070667_100111783 Ga0070667_1001117832 447
212 3300007076 Ga0075435_100022605 Ga0075435_1000226054 447
213 3300009551 Ga0105238_10165024 Ga0105238_101650241 447
214 3300010375 Ga0105239_10071671 Ga0105239_100716711 447
215 3300025901 Ga0207688_10027388 Ga0207688_100273882 447
216 3300025918 Ga0207662_10000891 Ga0207662_1000089114 447
217 3300025924 Ga0207694_10103230 Ga0207694_101032302 447
218 3300025960 Ga0207651_10073549 Ga0207651_100735491 447
219 3300049575 Ga0501039_0072161 Ga0501039_0072161_534_1937 447
220 3300049576 Ga0501040_0047905 Ga0501040_0047905_360_1763 447
221 3300049591 Ga0501075_0055523 Ga0501075_0055523_1327_2730 447
222 3300049592 Ga0501076_0069071 Ga0501076_0069071_622_2025 447
223 3300054114 Ga0501084_0017452 Ga0501084_0017452_3198_4601 447
224 3300006880 Ga0075429_100099264 Ga0075429_1000992642 448
225 3300009147 Ga0114129_10117860 Ga0114129_101178602 448
226 3300009147 Ga0114129_10385374 Ga0114129_103853742 448
227 3300035088 Ga0373940_0001611 Ga0373940_0001611_148_1560 448
228 3300035114 Ga0373939_0016739 Ga0373939_0016739_304_1716 448
229 3300050508 nmdc:mga09592_17484_c1 nmdc:mga09592_17484_c1_2855_4267 448
230 3300050509 nmdc:mga0qj67_22405_c1 nmdc:mga0qj67_22405_c1_355_1767 448
231 3300005354 Ga0070675_100003563 Ga0070675_1000035634 449
232 3300005543 Ga0070672_100153097 Ga0070672_1001530972 449
233 3300005840 Ga0068870_10024726 Ga0068870_100247263 449
234 3300005981 Ga0081538_10003260 Ga0081538_1000326014 449
235 3300025907 Ga0207645_10028198 Ga0207645_100281984 449
236 3300025908 Ga0207643_10024053 Ga0207643_100240533 449
237 3300025918 Ga0207662_10003651 Ga0207662_100036514 449
238 3300025923 Ga0207681_10011598 Ga0207681_100115984 449
239 3300026089 Ga0207648_10003683 Ga0207648_100036838 449
240 3300027907 Ga0207428_10007736 Ga0207428_100077363 449
241 3300049590 Ga0501074_0164172 Ga0501074_0164172_66_1481 449
242 3300050511 nmdc:mga08y16_1306_c1 nmdc:mga08y16_1306_c1_16782_18230 449
243 3300005844 Ga0068862_100008232 Ga0068862_10000823211 450
244 3300006852 Ga0075433_10015829 Ga0075433_100158294 450
245 3300009094 Ga0111539_10000463 Ga0111539_1000046351 450
246 3300027907 Ga0207428_10000245 Ga0207428_1000024542 450
247 3300042876 Ga0451577_0006253 Ga0451577_0006253_3144_4553 450
248 3300044712 Ga0453684_0023625 Ga0453684_0023625_5847_7256 450
249 3300045051 Ga0451576_0004364 Ga0451576_0004364_11446_12855 450
250 3300049572 Ga0501036_0050451 Ga0501036_0050451_1261_2748 450
251 3300049578 Ga0501042_0014338 Ga0501042_0014338_1909_3396 450
252 3300049743 Ga0501081_0013942 Ga0501081_0013942_2816_4303 450
253 3300049824 Ga0501045_0039549 Ga0501045_0039549_1633_3120 450
254 3300050511 nmdc:mga08y16_597_c1 nmdc:mga08y16_597_c1_17561_18970 450
255 3300050512 nmdc:mga0n895_77660_c1 nmdc:mga0n895_77660_c1_487_1896 450
256 3300050512 nmdc:mga0n895_83684_c1 nmdc:mga0n895_83684_c1_965_2392 450
257 3300050515 nmdc:mga0a205_13783_c1 nmdc:mga0a205_13783_c1_5170_6597 450
258 3300050515 nmdc:mga0a205_1991_c1 nmdc:mga0a205_1991_c1_5883_7292 450
259 3300061734 Ga0530510_0022799 Ga0530510_0022799_949_2436 450
260 3300005288 Ga0065714_10071211 Ga0065714_100712111 451
261 3300005290 Ga0065712_10068087 Ga0065712_100680875 451
262 3300005354 Ga0070675_100012585 Ga0070675_1000125855 451
263 3300006844 Ga0075428_100015898 Ga0075428_1000158983 451
264 3300006847 Ga0075431_100022095 Ga0075431_1000220956 451
265 3300009147 Ga0114129_10025730 Ga0114129_100257307 451
266 3300013308 Ga0157375_10256242 Ga0157375_102562421 451
267 3300025926 Ga0207659_10031425 Ga0207659_100314251 451
268 3300025933 Ga0207706_10159902 Ga0207706_101599021 451
269 3300045051 Ga0451576_0045920 Ga0451576_0045920_638_2059 451
270 3300050507 nmdc:mga05p37_11414_c1 nmdc:mga05p37_11414_c1_7531_8988 451
271 3300005344 Ga0070661_100006598 Ga0070661_1000065985 452
272 3300005564 Ga0070664_100001341 Ga0070664_10000134115 452
273 3300006846 Ga0075430_100019149 Ga0075430_1000191494 452
274 3300006847 Ga0075431_100040956 Ga0075431_1000409562 452
275 3300006847 Ga0075431_100094758 Ga0075431_1000947582 452
276 3300006880 Ga0075429_100081107 Ga0075429_1000811071 452
277 3300025920 Ga0207649_10002015 Ga0207649_1000201510 452
278 3300025925 Ga0207650_10086341 Ga0207650_100863412 452
279 3300025945 Ga0207679_10000449 Ga0207679_100004497 452
280 3300044712 Ga0453684_0118568 Ga0453684_0118568_692_2152 452
281 3300047319 Ga0495674_0088115 Ga0495674_0088115_321_1742 452
282 3300049571 Ga0501034_0190474 Ga0501034_0190474_355_1773 452
283 3300049578 Ga0501042_0157396 Ga0501042_0157396_162_1571 452
284 3300049582 Ga0501048_0083670 Ga0501048_0083670_783_2198 452
285 3300049591 Ga0501075_0007121 Ga0501075_0007121_5504_6919 452
286 3300049741 Ga0501079_0011415 Ga0501079_0011415_3359_4774 452
287 3300049743 Ga0501081_0151553 Ga0501081_0151553_158_1567 452
288 3300050509 nmdc:mga0qj67_54944_c1 nmdc:mga0qj67_54944_c1_867_2330 452
289 3300050510 nmdc:mga06r32_71500_c1 nmdc:mga06r32_71500_c1_1094_2503 452
290 3300050510 nmdc:mga06r32_89056_c1 nmdc:mga06r32_89056_c1_405_1868 452
291 3300050511 nmdc:mga08y16_201006_c1 nmdc:mga08y16_201006_c1_571_2031 452
292 3300005334 Ga0068869_100063299 Ga0068869_1000632991 453
293 3300005467 Ga0070706_100042411 Ga0070706_1000424112 453
294 3300005471 Ga0070698_100016413 Ga0070698_1000164138 453
295 3300005518 Ga0070699_100008791 Ga0070699_1000087919 453
296 3300005536 Ga0070697_100042024 Ga0070697_1000420243 453
297 3300006173 Ga0070716_100056184 Ga0070716_1000561842 453
298 3300006852 Ga0075433_10002893 Ga0075433_100028932 453
299 3300009147 Ga0114129_10128039 Ga0114129_101280392 453
300 3300009147 Ga0114129_10132239 Ga0114129_101322392 453
301 3300025910 Ga0207684_10011947 Ga0207684_100119477 453
302 3300025910 Ga0207684_10023037 Ga0207684_100230374 453
303 3300025939 Ga0207665_10007130 Ga0207665_100071307 453
304 3300031548 Ga0307408_100058337 Ga0307408_1000583372 453
305 3300050507 nmdc:mga05p37_174216_c1 nmdc:mga05p37_174216_c1_682_2160 453
306 3300050512 nmdc:mga0n895_57467_c1 nmdc:mga0n895_57467_c1_639_2066 453
307 3300050514 nmdc:mga08x19_17737_c1 nmdc:mga08x19_17737_c1_2144_3571 453
308 3300050515 nmdc:mga0a205_11142_c1 nmdc:mga0a205_11142_c1_1770_3197 453
309 3300005546 Ga0070696_100038365 Ga0070696_1000383652 454
310 3300005844 Ga0068862_100093277 Ga0068862_1000932772 454
311 3300009094 Ga0111539_10001292 Ga0111539_1000129230 454
312 3300027907 Ga0207428_10023843 Ga0207428_100238433 454
313 3300005341 Ga0070691_10022284 Ga0070691_100222842 455
314 3300005354 Ga0070675_100007060 Ga0070675_1000070605 455
315 3300005364 Ga0070673_100081131 Ga0070673_1000811312 455
316 3300005444 Ga0070694_100015289 Ga0070694_1000152895 455
317 3300005518 Ga0070699_100003941 Ga0070699_1000039411 455
318 3300005545 Ga0070695_100000112 Ga0070695_10000011214 455
319 3300005546 Ga0070696_100017675 Ga0070696_1000176755 455
320 3300005577 Ga0068857_100231573 Ga0068857_1002315731 455
321 3300006852 Ga0075433_10000839 Ga0075433_1000083921 455
322 3300006871 Ga0075434_100001347 Ga0075434_10000134720 455
323 3300007076 Ga0075435_100062337 Ga0075435_1000623372 455
324 3300009176 Ga0105242_10023761 Ga0105242_100237615 455
325 3300025926 Ga0207659_10166067 Ga0207659_101660671 455
326 3300025934 Ga0207686_10064513 Ga0207686_100645132 455
327 3300025960 Ga0207651_10102406 Ga0207651_101024062 455
328 3300026118 Ga0207675_100069969 Ga0207675_1000699692 455
329 3300042436 Ga0439435_0004587 Ga0439435_0004587_65_1480 455
330 3300046459 Ga0495629_0016857 Ga0495629_0016857_2368_3795 455
331 3300050512 nmdc:mga0n895_477_c1 nmdc:mga0n895_477_c1_4580_6007 455
332 3300050513 nmdc:mga0rr50_35406_c1 nmdc:mga0rr50_35406_c1_937_2364 455
333 3300050515 nmdc:mga0a205_646_c1 nmdc:mga0a205_646_c1_12796_14223 455
334 3300006846 Ga0075430_100045970 Ga0075430_1000459701 456
335 3300006880 Ga0075429_100045702 Ga0075429_1000457022 456
336 3300007265 Ga0099794_10046698 Ga0099794_100466981 456
337 3300044712 Ga0453684_0272065 Ga0453684_0272065_20_1390 456
338 3300046559 Ga0495667_0000367 Ga0495667_0000367_19887_21305 456
339 3300050508 nmdc:mga09592_28662_c1 nmdc:mga09592_28662_c1_1937_3355 456
340 3300050514 nmdc:mga08x19_57107_c1 nmdc:mga08x19_57107_c1_736_2169 456
341 3300005295 Ga0065707_10136991 Ga0065707_101369912 457
342 3300005338 Ga0068868_100078630 Ga0068868_1000786302 457
343 3300005457 Ga0070662_100055135 Ga0070662_1000551352 457
344 3300005467 Ga0070706_100039995 Ga0070706_1000399953 457
345 3300005471 Ga0070698_100296282 Ga0070698_1002962822 457
346 3300005518 Ga0070699_100038913 Ga0070699_1000389132 457
347 3300025922 Ga0207646_10062784 Ga0207646_100627843 457
348 3300025933 Ga0207706_10041882 Ga0207706_100418824 457
349 3300026023 Ga0207677_10145629 Ga0207677_101456292 457
350 3300049588 Ga0501072_0132229 Ga0501072_0132229_96_1505 457
351 3300050508 nmdc:mga09592_48767_c1 nmdc:mga09592_48767_c1_1047_2462 457
352 3300005354 Ga0070675_100131236 Ga0070675_1001312361 458
353 3300006038 Ga0075365_10022819 Ga0075365_100228192 458
354 3300006353 Ga0075370_10066752 Ga0075370_100667521 458
355 3300006871 Ga0075434_100010601 Ga0075434_1000106013 458
356 3300007076 Ga0075435_100048550 Ga0075435_1000485502 458
357 3300009094 Ga0111539_10053095 Ga0111539_100530952 458
358 3300049582 Ga0501048_0024994 Ga0501048_0024994_2791_4218 458
359 3300050512 nmdc:mga0n895_1895_c1 nmdc:mga0n895_1895_c1_1367_2848 458
360 3300050515 nmdc:mga0a205_133836_c1 nmdc:mga0a205_133836_c1_525_2006 458
361 3300061734 Ga0530510_0047130 Ga0530510_0047130_1155_2582 458
362 3300005290 Ga0065712_10002361 Ga0065712_100023612 460
363 3300005293 Ga0065715_10002974 Ga0065715_100029743 460
364 3300005329 Ga0070683_100145792 Ga0070683_1001457921 460
365 3300005331 Ga0070670_100097543 Ga0070670_1000975431 460
366 3300005343 Ga0070687_100012791 Ga0070687_1000127912 460
367 3300006358 Ga0068871_100167268 Ga0068871_1001672681 460
368 3300006844 Ga0075428_100059134 Ga0075428_1000591341 460
369 3300006847 Ga0075431_100188110 Ga0075431_1001881102 460
370 3300006881 Ga0068865_100159805 Ga0068865_1001598052 460
371 3300009094 Ga0111539_10031709 Ga0111539_100317096 460
372 3300009147 Ga0114129_10127799 Ga0114129_101277992 460
373 3300025893 Ga0207682_10016474 Ga0207682_100164744 460
374 3300025940 Ga0207691_10063428 Ga0207691_100634283 460
375 3300025944 Ga0207661_10031757 Ga0207661_100317573 460
376 3300026089 Ga0207648_10039622 Ga0207648_100396223 460
377 3300050511 nmdc:mga08y16_11754_c1 nmdc:mga08y16_11754_c1_2887_4308 460
378 3300009147 Ga0114129_10061418 Ga0114129_100614185 461
379 3300005335 Ga0070666_10035192 Ga0070666_100351922 462
380 3300005338 Ga0068868_100082588 Ga0068868_1000825882 462
381 3300005366 Ga0070659_100061265 Ga0070659_1000612652 462
382 3300005441 Ga0070700_100182237 Ga0070700_1001822371 462
383 3300005456 Ga0070678_100053178 Ga0070678_1000531781 462
384 3300005459 Ga0068867_100006014 Ga0068867_1000060146 462
385 3300005539 Ga0068853_100144928 Ga0068853_1001449282 462
386 3300005547 Ga0070693_100008457 Ga0070693_1000084572 462
387 3300005842 Ga0068858_100209763 Ga0068858_1002097632 462
388 3300005983 Ga0081540_1010521 Ga0081540_10105213 462
389 3300009094 Ga0111539_10022315 Ga0111539_100223153 462
390 3300009098 Ga0105245_10141866 Ga0105245_101418661 462
391 3300009147 Ga0114129_10101502 Ga0114129_101015021 462
392 3300009174 Ga0105241_10069582 Ga0105241_100695822 462
393 3300009176 Ga0105242_10007792 Ga0105242_100077922 462
394 3300025907 Ga0207645_10016127 Ga0207645_100161272 462
395 3300025927 Ga0207687_10079611 Ga0207687_100796112 462
396 3300025935 Ga0207709_10116300 Ga0207709_101163001 462
397 3300026023 Ga0207677_10039272 Ga0207677_100392722 462
398 3300026041 Ga0207639_10119734 Ga0207639_101197342 462
399 3300026075 Ga0207708_10012567 Ga0207708_100125674 462
400 3300026089 Ga0207648_10012239 Ga0207648_100122393 462
401 3300026118 Ga0207675_100016025 Ga0207675_1000160252 462
402 3300037418 Ga0395900_0002273 Ga0395900_0002273_13481_14896 462
403 3300037466 Ga0395898_0005721 Ga0395898_0005721_1785_3200 462
404 3300038443 Ga0395901_0021074 Ga0395901_0021074_2050_3465 462
405 3300050511 nmdc:mga08y16_31120_c1 nmdc:mga08y16_31120_c1_3618_5057 462
406 3300050513 nmdc:mga0rr50_109889_c1 nmdc:mga0rr50_109889_c1_70_1602 462
407 3300006871 Ga0075434_100060934 Ga0075434_1000609342 463
408 3300026121 Ga0207683_10045698 Ga0207683_100456983 463
409 3300042876 Ga0451577_0002796 Ga0451577_0002796_2719_4128 463
410 3300005356 Ga0070674_100000988 Ga0070674_10000098810 464
411 3300014326 Ga0157380_10001243 Ga0157380_1000124311 464
412 3300026116 Ga0207674_10121570 Ga0207674_101215702 464
413 3300005445 Ga0070708_100040319 Ga0070708_1000403192 465
414 3300005467 Ga0070706_100061910 Ga0070706_1000619102 465
415 3300042993 Ga0439440_0009806 Ga0439440_0009806_371_1813 465
416 3300049576 Ga0501040_0156538 Ga0501040_0156538_193_1590 465
417 3300005295 Ga0065707_10002595 Ga0065707_100025951 466
418 3300005330 Ga0070690_100034765 Ga0070690_1000347654 466
419 3300005331 Ga0070670_100226873 Ga0070670_1002268732 466
420 3300005340 Ga0070689_100016519 Ga0070689_1000165194 466
421 3300005577 Ga0068857_100030695 Ga0068857_1000306952 466
422 3300005840 Ga0068870_10011935 Ga0068870_100119352 466
423 3300005843 Ga0068860_100031285 Ga0068860_1000312852 466
424 3300009094 Ga0111539_10128670 Ga0111539_101286703 466
425 3300025908 Ga0207643_10015996 Ga0207643_100159962 466
426 3300025940 Ga0207691_10007695 Ga0207691_100076953 466
427 3300025942 Ga0207689_10111208 Ga0207689_101112082 466
428 3300025960 Ga0207651_10166804 Ga0207651_101668041 466
429 3300026035 Ga0207703_10016319 Ga0207703_100163192 466
430 3300028381 Ga0268264_10003233 Ga0268264_100032332 466
431 3300006847 Ga0075431_100000486 Ga0075431_1000004863 469
432 3300027907 Ga0207428_10000027 Ga0207428_10000027200 469
433 3300046516 Ga0495628_0055710 Ga0495628_0055710_1226_2644 469
434 3300049576 Ga0501040_0002340 Ga0501040_0002340_63_1472 469
435 3300050510 nmdc:mga06r32_1744_c1 nmdc:mga06r32_1744_c1_17079_18488 469
436 3300050511 nmdc:mga08y16_17787_c1 nmdc:mga08y16_17787_c1_5976_7388 469
437 3300050512 nmdc:mga0n895_60869_c1 nmdc:mga0n895_60869_c1_98_1507 469
438 3300005444 Ga0070694_100026765 Ga0070694_1000267651 470
439 3300005841 Ga0068863_100030248 Ga0068863_1000302485 470
440 3300006175 Ga0070712_100003836 Ga0070712_1000038367 470
441 3300006847 Ga0075431_100000082 Ga0075431_1000000828 470
442 3300006852 Ga0075433_10132597 Ga0075433_101325972 470
443 3300006871 Ga0075434_100327389 Ga0075434_1003273892 470
444 3300006914 Ga0075436_100018788 Ga0075436_1000187886 470
445 3300009147 Ga0114129_10001511 Ga0114129_100015116 470
446 3300025915 Ga0207693_10006943 Ga0207693_100069437 470
447 3300025916 Ga0207663_10018254 Ga0207663_100182543 470
448 3300042876 Ga0451577_0053635 Ga0451577_0053635_445_1860 470
449 3300045051 Ga0451576_0065829 Ga0451576_0065829_1061_2473 470
450 3300046455 Ga0495603_0017434 Ga0495603_0017434_1156_2610 470
451 3300049588 Ga0501072_0027727 Ga0501072_0027727_1683_3098 470
452 3300049593 Ga0501077_0080278 Ga0501077_0080278_625_2040 470
453 3300050507 nmdc:mga05p37_19057_c1 nmdc:mga05p37_19057_c1_5668_7158 470
454 3300050510 nmdc:mga06r32_7977_c1 nmdc:mga06r32_7977_c1_6454_7869 470
455 3300050515 nmdc:mga0a205_139255_c1 nmdc:mga0a205_139255_c1_631_2121 470
456 3300061734 Ga0530510_0057599 Ga0530510_0057599_481_1896 470
457 3300006852 Ga0075433_10087738 Ga0075433_100877382 471
458 3300009094 Ga0111539_10002439 Ga0111539_1000243919 471
459 3300009147 Ga0114129_10073338 Ga0114129_100733384 471
460 3300027907 Ga0207428_10005064 Ga0207428_1000506410 471
461 3300031731 Ga0307405_10074946 Ga0307405_100749461 471
462 3300032002 Ga0307416_100122713 Ga0307416_1001227131 471
463 3300046615 Ga0495656_0064340 Ga0495656_0064340_60_1481 471
464 3300049581 Ga0501047_0221891 Ga0501047_0221891_83_1504 471
465 3300050511 nmdc:mga08y16_2919_c1 nmdc:mga08y16_2919_c1_9137_10555 471
466 3300050515 nmdc:mga0a205_196715_c1 nmdc:mga0a205_196715_c1_378_1796 471
467 3300005328 Ga0070676_10002255 Ga0070676_100022553 472
468 3300005331 Ga0070670_100004978 Ga0070670_1000049783 472
469 3300005334 Ga0068869_100001496 Ga0068869_1000014964 472
470 3300005336 Ga0070680_100002109 Ga0070680_10000210910 472
471 3300005337 Ga0070682_100000365 Ga0070682_1000003652 472
472 3300005339 Ga0070660_100018271 Ga0070660_1000182713 472
473 3300005340 Ga0070689_100026025 Ga0070689_1000260254 472
474 3300005341 Ga0070691_10014935 Ga0070691_100149352 472
475 3300005343 Ga0070687_100005532 Ga0070687_1000055323 472
476 3300005344 Ga0070661_100002514 Ga0070661_1000025143 472
477 3300005345 Ga0070692_10001897 Ga0070692_100018978 472
478 3300005366 Ga0070659_100001505 Ga0070659_10000150519 472
479 3300005444 Ga0070694_100000345 Ga0070694_1000003455 472
480 3300005445 Ga0070708_100071343 Ga0070708_1000713433 472
481 3300005455 Ga0070663_100001711 Ga0070663_10000171112 472
482 3300005457 Ga0070662_100059219 Ga0070662_1000592192 472
483 3300005459 Ga0068867_100007131 Ga0068867_1000071318 472
484 3300005468 Ga0070707_100010381 Ga0070707_1000103816 472
485 3300005535 Ga0070684_100046398 Ga0070684_1000463982 472
486 3300005539 Ga0068853_100010976 Ga0068853_1000109767 472
487 3300005546 Ga0070696_100004871 Ga0070696_1000048712 472
488 3300005547 Ga0070693_100000189 Ga0070693_10000018930 472
489 3300005563 Ga0068855_100015855 Ga0068855_1000158558 472
490 3300005614 Ga0068856_100000923 Ga0068856_1000009233 472
491 3300005618 Ga0068864_100017773 Ga0068864_1000177735 472
492 3300005834 Ga0068851_10038131 Ga0068851_100381313 472
493 3300005840 Ga0068870_10005126 Ga0068870_100051263 472
494 3300005841 Ga0068863_100046577 Ga0068863_1000465773 472
495 3300005843 Ga0068860_100042597 Ga0068860_1000425972 472
496 3300005844 Ga0068862_100016417 Ga0068862_1000164173 472
497 3300006871 Ga0075434_100022413 Ga0075434_1000224131 472
498 3300007076 Ga0075435_100039959 Ga0075435_1000399592 472
499 3300009174 Ga0105241_10001410 Ga0105241_1000141016 472
500 3300013105 Ga0157369_10017116 Ga0157369_100171163 472
501 3300013307 Ga0157372_10008010 Ga0157372_100080108 472
502 3300025907 Ga0207645_10000400 Ga0207645_1000040010 472
503 3300025908 Ga0207643_10000424 Ga0207643_1000042427 472
504 3300025910 Ga0207684_10113773 Ga0207684_101137732 472
505 3300025911 Ga0207654_10010692 Ga0207654_100106922 472
506 3300025912 Ga0207707_10000116 Ga0207707_1000011626 472
507 3300025918 Ga0207662_10007198 Ga0207662_100071985 472
508 3300025919 Ga0207657_10000211 Ga0207657_1000021137 472
509 3300025920 Ga0207649_10006395 Ga0207649_100063953 472
510 3300025921 Ga0207652_10003841 Ga0207652_1000384112 472
511 3300025922 Ga0207646_10027940 Ga0207646_100279403 472
512 3300025923 Ga0207681_10008695 Ga0207681_100086956 472
513 3300025925 Ga0207650_10135932 Ga0207650_101359321 472
514 3300025932 Ga0207690_10001495 Ga0207690_100014953 472
515 3300025933 Ga0207706_10004021 Ga0207706_100040218 472
516 3300025936 Ga0207670_10048949 Ga0207670_100489494 472
517 3300025941 Ga0207711_10105861 Ga0207711_101058612 472
518 3300025942 Ga0207689_10000201 Ga0207689_1000020126 472
519 3300025945 Ga0207679_10006771 Ga0207679_100067715 472
520 3300025949 Ga0207667_10002107 Ga0207667_100021073 472
521 3300026041 Ga0207639_10004331 Ga0207639_100043318 472
522 3300026078 Ga0207702_10001143 Ga0207702_100011434 472
523 3300026088 Ga0207641_10025232 Ga0207641_100252323 472
524 3300026089 Ga0207648_10012060 Ga0207648_100120608 472
525 3300026116 Ga0207674_10000951 Ga0207674_100009518 472
526 3300028380 Ga0268265_10005618 Ga0268265_100056182 472
527 3300035088 Ga0373940_0013102 Ga0373940_0013102_74_1495 472
528 3300035090 Ga0373949_0007232 Ga0373949_0007232_144_1565 472
529 3300035114 Ga0373939_0007541 Ga0373939_0007541_895_2316 472
530 3300035241 Ga0373961_0007741 Ga0373961_0007741_1150_2571 472
531 3300042438 Ga0439459_0000110 Ga0439459_0000110_4871_6292 472
532 3300044712 Ga0453684_0058416 Ga0453684_0058416_3445_4866 472
533 3300045051 Ga0451576_0005764 Ga0451576_0005764_2232_3653 472
534 3300050512 nmdc:mga0n895_53201_c1 nmdc:mga0n895_53201_c1_1683_3104 472
535 3300005444 Ga0070694_100073558 Ga0070694_1000735582 473
536 3300005545 Ga0070695_100029138 Ga0070695_1000291382 473
537 3300005546 Ga0070696_100040971 Ga0070696_1000409712 473
538 3300005718 Ga0068866_10054606 Ga0068866_100546062 473
539 3300006844 Ga0075428_100004648 Ga0075428_10000464815 473
540 3300006846 Ga0075430_100039626 Ga0075430_1000396261 473
541 3300006847 Ga0075431_100001687 Ga0075431_10000168721 473
542 3300006871 Ga0075434_100040271 Ga0075434_1000402716 473
543 3300025941 Ga0207711_10247569 Ga0207711_102475691 473
544 3300050508 nmdc:mga09592_190943_c1 nmdc:mga09592_190943_c1_147_1589 473
545 3300050509 nmdc:mga0qj67_7809_c1 nmdc:mga0qj67_7809_c1_6292_7734 473
546 3300050510 nmdc:mga06r32_39458_c1 nmdc:mga06r32_39458_c1_146_1588 473
547 3300050512 nmdc:mga0n895_24005_c1 nmdc:mga0n895_24005_c1_1395_2819 473
548 3300005328 Ga0070676_10037385 Ga0070676_100373851 474
549 3300005334 Ga0068869_100002011 Ga0068869_1000020119 474
550 3300005444 Ga0070694_100006735 Ga0070694_1000067353 474
551 3300005444 Ga0070694_100011586 Ga0070694_1000115862 474
552 3300005445 Ga0070708_100085474 Ga0070708_1000854742 474
553 3300005457 Ga0070662_100026986 Ga0070662_1000269863 474
554 3300005459 Ga0068867_100052159 Ga0068867_1000521592 474
555 3300005467 Ga0070706_100003928 Ga0070706_1000039282 474
556 3300005467 Ga0070706_100137563 Ga0070706_1001375632 474
557 3300005468 Ga0070707_100001862 Ga0070707_10000186223 474
558 3300005468 Ga0070707_100149336 Ga0070707_1001493362 474
559 3300005471 Ga0070698_100049291 Ga0070698_1000492913 474
560 3300005518 Ga0070699_100005248 Ga0070699_1000052487 474
561 3300005536 Ga0070697_100054351 Ga0070697_1000543512 474
562 3300005545 Ga0070695_100042978 Ga0070695_1000429781 474
563 3300005546 Ga0070696_100021801 Ga0070696_1000218014 474
564 3300005549 Ga0070704_100056342 Ga0070704_1000563422 474
565 3300005549 Ga0070704_100067970 Ga0070704_1000679702 474
566 3300005937 Ga0081455_10000868 Ga0081455_100008683 474
567 3300009098 Ga0105245_10109242 Ga0105245_101092422 474
568 3300025910 Ga0207684_10003777 Ga0207684_1000377710 474
569 3300025910 Ga0207684_10058826 Ga0207684_100588263 474
570 3300025922 Ga0207646_10006951 Ga0207646_100069517 474
571 3300025922 Ga0207646_10123365 Ga0207646_101233652 474
572 3300025927 Ga0207687_10064136 Ga0207687_100641362 474
573 3300025933 Ga0207706_10020893 Ga0207706_100208932 474
574 3300025942 Ga0207689_10006142 Ga0207689_1000614212 474
575 3300027360 Ga0209969_1001359 Ga0209969_10013593 474
576 3300027424 Ga0209984_1000634 Ga0209984_10006343 474
577 3300027526 Ga0209968_1000573 Ga0209968_10005735 474
578 3300027614 Ga0209970_1000407 Ga0209970_10004072 474
579 3300027682 Ga0209971_1000037 Ga0209971_100003742 474
580 3300027695 Ga0209966_1000378 Ga0209966_10003786 474
581 3300027717 Ga0209998_10000042 Ga0209998_1000004214 474
582 3300027876 Ga0209974_10000465 Ga0209974_100004652 474
583 3300028380 Ga0268265_10061875 Ga0268265_100618752 474
584 3300042005 Ga0439448_0005919 Ga0439448_0005919_1608_3035 474
585 3300042439 Ga0439464_0000830 Ga0439464_0000830_1604_3031 474
586 3300042461 Ga0439460_0000197 Ga0439460_0000197_967_2394 474
587 3300042876 Ga0451577_0068274 Ga0451577_0068274_199_1626 474
588 3300044673 Ga0453683_0026123 Ga0453683_0026123_764_2191 474
589 3300044673 Ga0453683_0050488 Ga0453683_0050488_1075_2499 474
590 3300045051 Ga0451576_0005141 Ga0451576_0005141_14419_15846 474
591 3300045051 Ga0451576_0019775 Ga0451576_0019775_1402_2829 474
592 3300049570 Ga0501033_0106442 Ga0501033_0106442_559_1986 474
593 3300049575 Ga0501039_0012641 Ga0501039_0012641_3866_5293 474
594 3300049577 Ga0501041_0006125 Ga0501041_0006125_4903_6330 474
595 3300049578 Ga0501042_0034409 Ga0501042_0034409_1492_2919 474
596 3300049580 Ga0501046_0075277 Ga0501046_0075277_338_1765 474
597 3300049580 Ga0501046_0114920 Ga0501046_0114920_68_1495 474
598 3300049581 Ga0501047_0109507 Ga0501047_0109507_1165_2592 474
599 3300049584 Ga0501068_0031832 Ga0501068_0031832_105_1532 474
600 3300049588 Ga0501072_0035451 Ga0501072_0035451_842_2269 474
601 3300049590 Ga0501074_0032375 Ga0501074_0032375_748_2175 474
602 3300049591 Ga0501075_0006351 Ga0501075_0006351_1297_2724 474
603 3300049591 Ga0501075_0043634 Ga0501075_0043634_737_2164 474
604 3300049592 Ga0501076_0118503 Ga0501076_0118503_670_2097 474
605 3300049593 Ga0501077_0009200 Ga0501077_0009200_3816_5243 474
606 3300049593 Ga0501077_0079258 Ga0501077_0079258_528_1955 474
607 3300049741 Ga0501079_0012871 Ga0501079_0012871_1700_3127 474
608 3300049741 Ga0501079_0033516 Ga0501079_0033516_347_1774 474
609 3300049743 Ga0501081_0005258 Ga0501081_0005258_963_2390 474
610 3300049743 Ga0501081_0028626 Ga0501081_0028626_1851_3278 474
611 3300049743 Ga0501081_0055063 Ga0501081_0055063_401_1828 474
612 3300049744 Ga0501083_0014659 Ga0501083_0014659_2823_4250 474
613 3300049824 Ga0501045_0018435 Ga0501045_0018435_2949_4376 474
614 3300054114 Ga0501084_0014381 Ga0501084_0014381_5099_6526 474
615 3300061734 Ga0530510_0099475 Ga0530510_0099475_341_1768 474
616 3300031731 Ga0307405_10039995 Ga0307405_100399951 476
617 3300032002 Ga0307416_100050470 Ga0307416_1000504702 476
618 3300005471 Ga0070698_100007713 Ga0070698_1000077132 478
619 3300005518 Ga0070699_100000712 Ga0070699_10000071217 478
620 3300005546 Ga0070696_100050366 Ga0070696_1000503662 478
621 3300009147 Ga0114129_10003221 Ga0114129_1000322124 478
622 3300050507 nmdc:mga05p37_14939_c1 nmdc:mga05p37_14939_c1_3688_5154 478
623 3300005518 Ga0070699_100026173 Ga0070699_1000261735 479
624 3300001977 JGI24746J21847_1000779 JGI24746J21847_10007793 480
625 3300005293 Ga0065715_10005150 Ga0065715_100051503 480
626 3300005334 Ga0068869_100010384 Ga0068869_1000103845 480
627 3300005340 Ga0070689_100006307 Ga0070689_1000063073 480
628 3300005343 Ga0070687_100013316 Ga0070687_1000133162 480
629 3300005347 Ga0070668_100057079 Ga0070668_1000570792 480
630 3300005438 Ga0070701_10026049 Ga0070701_100260492 480
631 3300005441 Ga0070700_100009311 Ga0070700_1000093114 480
632 3300005457 Ga0070662_100027076 Ga0070662_1000270762 480
633 3300005458 Ga0070681_10045040 Ga0070681_100450403 480
634 3300005564 Ga0070664_100006931 Ga0070664_1000069312 480
635 3300005564 Ga0070664_100064670 Ga0070664_1000646703 480
636 3300005618 Ga0068864_100086867 Ga0068864_1000868672 480
637 3300005719 Ga0068861_100016033 Ga0068861_1000160332 480
638 3300005840 Ga0068870_10002979 Ga0068870_100029792 480
639 3300005841 Ga0068863_100072573 Ga0068863_1000725733 480
640 3300005844 Ga0068862_100011482 Ga0068862_1000114823 480
641 3300006852 Ga0075433_10005550 Ga0075433_100055503 480
642 3300006871 Ga0075434_100114253 Ga0075434_1001142532 480
643 3300006871 Ga0075434_100131672 Ga0075434_1001316722 480
644 3300009094 Ga0111539_10006594 Ga0111539_100065945 480
645 3300009094 Ga0111539_10207545 Ga0111539_102075453 480
646 3300009177 Ga0105248_10110182 Ga0105248_101101822 480
647 3300009553 Ga0105249_10008153 Ga0105249_1000815310 480
648 3300011119 Ga0105246_10028242 Ga0105246_100282422 480
649 3300013306 Ga0163162_10022241 Ga0163162_100222414 480
650 3300013308 Ga0157375_10268348 Ga0157375_102683482 480
651 3300014326 Ga0157380_10003226 Ga0157380_100032262 480
652 3300017792 Ga0163161_10015178 Ga0163161_100151782 480
653 3300025315 Ga0207697_10001435 Ga0207697_100014354 480
654 3300025901 Ga0207688_10001607 Ga0207688_100016077 480
655 3300025908 Ga0207643_10000732 Ga0207643_100007327 480
656 3300025912 Ga0207707_10109336 Ga0207707_101093362 480
657 3300025918 Ga0207662_10003719 Ga0207662_100037194 480
658 3300025926 Ga0207659_10002998 Ga0207659_100029985 480
659 3300025933 Ga0207706_10017429 Ga0207706_100174292 480
660 3300025936 Ga0207670_10061086 Ga0207670_100610862 480
661 3300025938 Ga0207704_10071650 Ga0207704_100716502 480
662 3300025940 Ga0207691_10010524 Ga0207691_100105242 480
663 3300025942 Ga0207689_10005325 Ga0207689_100053254 480
664 3300025961 Ga0207712_10066798 Ga0207712_100667981 480
665 3300025986 Ga0207658_10066628 Ga0207658_100666282 480
666 3300026075 Ga0207708_10015376 Ga0207708_100153762 480
667 3300026118 Ga0207675_100002501 Ga0207675_1000025019 480
668 3300026121 Ga0207683_10007833 Ga0207683_100078337 480
669 3300027907 Ga0207428_10008043 Ga0207428_100080438 480
670 3300028380 Ga0268265_10022805 Ga0268265_100228053 480
671 3300045051 Ga0451576_0084972 Ga0451576_0084972_1423_2865 480
672 3300050507 nmdc:mga05p37_183619_c1 nmdc:mga05p37_183619_c1_369_1904 480
673 3300050515 nmdc:mga0a205_66283_c1 nmdc:mga0a205_66283_c1_323_1765 480

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

158

449

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7aqq-assembly1.cif.gz_N cryo-em structure of arabidopsis thaliana complex-i (membrane core) 0.9295 8 475
8e73-assembly1.cif.gz_2M vigna radiata supercomplex i+iii2 (full bridge) 0.9179 8 476
6khj-assembly1.cif.gz_B supercomplex for electron transfer 0.9143 8 473
7aqq-assembly1.cif.gz_N cryo-em structure of arabidopsis thaliana complex-i (membrane core) 0.9125 8 475
7f9o-assembly1.cif.gz_M psi-ndh supercomplex of barley 0.9116 9 469
ID Description Score Start End Superfamily
af_Q8IIQ6_781_1032_1.25.40.660 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein 35, helical subcomplex Vps35-C 0.344 8 245 1.25.40.660
af_I1LLV0_1_234_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.3315 40 268 1.20.1410.10
af_F4HWQ7_36_219_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3253 4 229 1.20.1070.10
af_I1LLV0_1_234_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.3248 40 268 1.20.1410.10
af_F4HWQ7_36_219_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3224 4 229 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A661UT51-F1-model_v4 NADH-quinone oxidoreductase subunit N 0.9673 292 476 GO:0012505
GO:0016020
GO:0048038
AF-A0A351XEN3-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter transmembrane domain-containing protein 0.9666 258 475 GO:0012505
GO:0016020
AF-A0A3N5QKU7-F1-model_v4 NADH-quinone oxidoreductase subunit N 0.9666 320 475 GO:0012505
GO:0016020
AF-A0A6L3AAY0-F1-model_v4 NADH-quinone oxidoreductase subunit N 0.9577 82 475 GO:0008137
GO:0012505
GO:0016020
GO:0042773
AF-A0A2G8MKL7-F1-model_v4 deleted 0.9574 227 476

Feature Viewer

pLDDT pTM Quality
85.04 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map