F474286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 673 | 255 | 673 | 460 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10045040|Ga0070681_100450403 |
| Length | 518 |
| Sequence | MTIDLGTPMVAEVAVFGLMVLVLFVGLLRKPPVPIGPTFEPRIPDPGSRPSTRSGRPEALEGRIPDSGHASAAGWITLIGLLVTFVLMFFARDGATLLGGSFVNDSLAIFSKKLFVAAAALSVLASLTLRNSSFRRRAAEYHFVLLASVLGMMVLASARDLILLFVSFELMSIPLYVLTGFVKRDGAAPEAALKFFLVGTASSAVIVYGISFIIGVTGTTDLSAIPSALVANDSIMLLGMTLLLAGLGFKIAAFPFHMWAPDTYEAASTPFVAWLAVAPKAAGFIAIIRLYVEGVGASTLVWMPVVAAVAGMTIITGNLMAIPQHNIKRLLAYSGIAHIGYMLIGLAALTSNGIAMVLFYLLAYMFGNMGAFFVVEAVARSEQSDEIDAYKGLAQRSPVLALAMLVFLLSLGGIPFVAGFWAKLYVFLAAVDRGMYGLVFLGAVLTVVALYXXXXVARRMYIEAPVRTERVHVPALLGVAIFICIAGVVGMGAWPGPWVNATQRAAASVFAASAASIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 187 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 194 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 195 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 196 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 197 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 198 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 199 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 200 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 201 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 214 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 215 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 242 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 243 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 244 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.49 |
| Nodule | 0 |
| Rhizoplane | 0.45 |
| Rhizosphere | 98.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000779 | 3300001977 | Bacteria | 4908 |
| 2 | JGI25406J46586_10000120 | 3300003203 | Bacteria | 34396 |
| 3 | JGI25406J46586_10002349 | 3300003203 | Bacteria | 8944 |
| 4 | Ga0065714_10071211 | 3300005288 | Bacteria | 3637 |
| 5 | Ga0065712_10002361 | 3300005290 | Bacteria | 8212 |
| 6 | Ga0065712_10068087 | 3300005290 | Bacteria | 15101 |
| 7 | Ga0065712_10081843 | 3300005290 | Bacteria | 2960 |
| 8 | Ga0065715_10002974 | 3300005293 | Bacteria | 4577 |
| 9 | Ga0065715_10005150 | 3300005293 | Bacteria | 6305 |
| 10 | Ga0065707_10002595 | 3300005295 | Bacteria | 6960 |
| 11 | Ga0065707_10136991 | 3300005295 | Bacteria | 1826 |
| 12 | Ga0070676_10002255 | 3300005328 | Bacteria | 9831 |
| 13 | Ga0070676_10037385 | 3300005328 | Unclassified | 2800 |
| 14 | Ga0070683_100001902 | 3300005329 | Bacteria | 16331 |
| 15 | Ga0070683_100145792 | 3300005329 | Unclassified | 2243 |
| 16 | Ga0070690_100003636 | 3300005330 | Bacteria | 8490 |
| 17 | Ga0070690_100034765 | 3300005330 | Unclassified | 3159 |
| 18 | Ga0070670_100004978 | 3300005331 | Bacteria | 11177 |
| 19 | Ga0070670_100097543 | 3300005331 | Bacteria | 2528 |
| 20 | Ga0070670_100226873 | 3300005331 | Bacteria | 1625 |
| 21 | Ga0068869_100001496 | 3300005334 | Bacteria | 13845 |
| 22 | Ga0068869_100002011 | 3300005334 | Bacteria | 12219 |
| 23 | Ga0068869_100010384 | 3300005334 | Bacteria | 6073 |
| 24 | Ga0068869_100063299 | 3300005334 | Bacteria | 2717 |
| 25 | Ga0070666_10004927 | 3300005335 | Bacteria | 8165 |
| 26 | Ga0070666_10035192 | 3300005335 | Bacteria | 3321 |
| 27 | Ga0070680_100002109 | 3300005336 | Bacteria | 14680 |
| 28 | Ga0070682_100000365 | 3300005337 | Bacteria | 30423 |
| 29 | Ga0068868_100078630 | 3300005338 | Bacteria | 2641 |
| 30 | Ga0068868_100082588 | 3300005338 | Bacteria | 2577 |
| 31 | Ga0070660_100018271 | 3300005339 | Bacteria | 5122 |
| 32 | Ga0070689_100006307 | 3300005340 | Bacteria | 8192 |
| 33 | Ga0070689_100016519 | 3300005340 | Bacteria | 5401 |
| 34 | Ga0070689_100026025 | 3300005340 | Bacteria | 4401 |
| 35 | Ga0070691_10014935 | 3300005341 | Bacteria | 3566 |
| 36 | Ga0070691_10018250 | 3300005341 | Bacteria | 3234 |
| 37 | Ga0070691_10022284 | 3300005341 | Bacteria | 2938 |
| 38 | Ga0070687_100000488 | 3300005343 | Bacteria | 13208 |
| 39 | Ga0070687_100005532 | 3300005343 | Bacteria | 5122 |
| 40 | Ga0070687_100012791 | 3300005343 | Bacteria | 3718 |
| 41 | Ga0070687_100013316 | 3300005343 | Bacteria | 3662 |
| 42 | Ga0070661_100002514 | 3300005344 | Bacteria | 12556 |
| 43 | Ga0070661_100006598 | 3300005344 | Bacteria | 8003 |
| 44 | Ga0070661_100015343 | 3300005344 | Bacteria | 5407 |
| 45 | Ga0070692_10001897 | 3300005345 | Bacteria | 7888 |
| 46 | Ga0070668_100001246 | 3300005347 | Bacteria | 18156 |
| 47 | Ga0070668_100057079 | 3300005347 | Unclassified | 3016 |
| 48 | Ga0070668_100214214 | 3300005347 | Bacteria | 1586 |
| 49 | Ga0070669_100105021 | 3300005353 | Bacteria | 2136 |
| 50 | Ga0070675_100003563 | 3300005354 | Bacteria | 11830 |
| 51 | Ga0070675_100007060 | 3300005354 | Bacteria | 8639 |
| 52 | Ga0070675_100012585 | 3300005354 | Bacteria | 6634 |
| 53 | Ga0070675_100131236 | 3300005354 | Bacteria | 2135 |
| 54 | Ga0070675_100167651 | 3300005354 | Unclassified | 1892 |
| 55 | Ga0070674_100000988 | 3300005356 | Bacteria | 14828 |
| 56 | Ga0070674_100010071 | 3300005356 | Bacteria | 5693 |
| 57 | Ga0070674_100017360 | 3300005356 | Bacteria | 4525 |
| 58 | Ga0070673_100004953 | 3300005364 | Bacteria | 8487 |
| 59 | Ga0070673_100081131 | 3300005364 | Unclassified | 2630 |
| 60 | Ga0070688_100099993 | 3300005365 | Unclassified | 1910 |
| 61 | Ga0070659_100001505 | 3300005366 | Bacteria | 16800 |
| 62 | Ga0070659_100002251 | 3300005366 | Bacteria | 13737 |
| 63 | Ga0070659_100061265 | 3300005366 | Bacteria | 2974 |
| 64 | Ga0070667_100111783 | 3300005367 | Bacteria | 2370 |
| 65 | Ga0070703_10003809 | 3300005406 | Bacteria | 4268 |
| 66 | Ga0070701_10026049 | 3300005438 | Unclassified | 2847 |
| 67 | Ga0070700_100009311 | 3300005441 | Bacteria | 5383 |
| 68 | Ga0070700_100039984 | 3300005441 | Bacteria | 2868 |
| 69 | Ga0070700_100182237 | 3300005441 | Bacteria | 1462 |
| 70 | Ga0070694_100000345 | 3300005444 | Bacteria | 24871 |
| 71 | Ga0070694_100006735 | 3300005444 | Bacteria | 6979 |
| 72 | Ga0070694_100011586 | 3300005444 | Bacteria | 5461 |
| 73 | Ga0070694_100015289 | 3300005444 | Bacteria | 4816 |
| 74 | Ga0070694_100026765 | 3300005444 | Bacteria | 3740 |
| 75 | Ga0070694_100026892 | 3300005444 | Bacteria | 3733 |
| 76 | Ga0070694_100073558 | 3300005444 | Bacteria | 2361 |
| 77 | Ga0070708_100040319 | 3300005445 | Bacteria | 4089 |
| 78 | Ga0070708_100046013 | 3300005445 | Bacteria | 3848 |
| 79 | Ga0070708_100071343 | 3300005445 | Bacteria | 3127 |
| 80 | Ga0070708_100085474 | 3300005445 | Bacteria | 2863 |
| 81 | Ga0070663_100001711 | 3300005455 | Bacteria | 12179 |
| 82 | Ga0070663_100051172 | 3300005455 | Bacteria | 2941 |
| 83 | Ga0070678_100053178 | 3300005456 | Bacteria | 2944 |
| 84 | Ga0070662_100026986 | 3300005457 | Bacteria | 3982 |
| 85 | Ga0070662_100027076 | 3300005457 | Bacteria | 3976 |
| 86 | Ga0070662_100055135 | 3300005457 | Bacteria | 2883 |
| 87 | Ga0070662_100059219 | 3300005457 | Bacteria | 2790 |
| 88 | Ga0070681_10045040 | 3300005458 | Bacteria | 4415 |
| 89 | Ga0068867_100006014 | 3300005459 | Bacteria | 8602 |
| 90 | Ga0068867_100007131 | 3300005459 | Bacteria | 7897 |
| 91 | Ga0068867_100052159 | 3300005459 | Bacteria | 3018 |
| 92 | Ga0070685_10000264 | 3300005466 | Bacteria | 33696 |
| 93 | Ga0070706_100003928 | 3300005467 | Bacteria | 14483 |
| 94 | Ga0070706_100006413 | 3300005467 | Bacteria | 11121 |
| 95 | Ga0070706_100039995 | 3300005467 | Bacteria | 4328 |
| 96 | Ga0070706_100042411 | 3300005467 | Bacteria | 4203 |
| 97 | Ga0070706_100061910 | 3300005467 | Unclassified | 3456 |
| 98 | Ga0070706_100137563 | 3300005467 | Bacteria | 2279 |
| 99 | Ga0070707_100001862 | 3300005468 | Bacteria | 20267 |
| 100 | Ga0070707_100010381 | 3300005468 | Bacteria | 8670 |
| 101 | Ga0070707_100149336 | 3300005468 | Unclassified | 2275 |
| 102 | Ga0070698_100007713 | 3300005471 | Bacteria | 11640 |
| 103 | Ga0070698_100016413 | 3300005471 | Bacteria | 7815 |
| 104 | Ga0070698_100049291 | 3300005471 | Bacteria | 4299 |
| 105 | Ga0070698_100296282 | 3300005471 | Unclassified | 1548 |
| 106 | Ga0070699_100000712 | 3300005518 | Bacteria | 30836 |
| 107 | Ga0070699_100003941 | 3300005518 | Bacteria | 13112 |
| 108 | Ga0070699_100005248 | 3300005518 | Bacteria | 11376 |
| 109 | Ga0070699_100008791 | 3300005518 | Bacteria | 8753 |
| 110 | Ga0070699_100026173 | 3300005518 | Bacteria | 5032 |
| 111 | Ga0070699_100035333 | 3300005518 | Bacteria | 4320 |
| 112 | Ga0070699_100038913 | 3300005518 | Bacteria | 4117 |
| 113 | Ga0070699_100068977 | 3300005518 | Bacteria | 3072 |
| 114 | Ga0070684_100046398 | 3300005535 | Bacteria | 3765 |
| 115 | Ga0070697_100042024 | 3300005536 | Bacteria | 3700 |
| 116 | Ga0070697_100054351 | 3300005536 | Bacteria | 3255 |
| 117 | Ga0068853_100010976 | 3300005539 | Bacteria | 7342 |
| 118 | Ga0068853_100015316 | 3300005539 | Bacteria | 6301 |
| 119 | Ga0068853_100144928 | 3300005539 | Bacteria | 2134 |
| 120 | Ga0070672_100002079 | 3300005543 | Bacteria | 12608 |
| 121 | Ga0070672_100019254 | 3300005543 | Bacteria | 4951 |
| 122 | Ga0070672_100153097 | 3300005543 | Bacteria | 1908 |
| 123 | Ga0070695_100000112 | 3300005545 | Bacteria | 36134 |
| 124 | Ga0070695_100029138 | 3300005545 | Bacteria | 3429 |
| 125 | Ga0070695_100042978 | 3300005545 | Bacteria | 2872 |
| 126 | Ga0070696_100004871 | 3300005546 | Bacteria | 8970 |
| 127 | Ga0070696_100017675 | 3300005546 | Bacteria | 4816 |
| 128 | Ga0070696_100021801 | 3300005546 | Bacteria | 4345 |
| 129 | Ga0070696_100038365 | 3300005546 | Bacteria | 3306 |
| 130 | Ga0070696_100040971 | 3300005546 | Bacteria | 3199 |
| 131 | Ga0070696_100043193 | 3300005546 | Bacteria | 3118 |
| 132 | Ga0070696_100050366 | 3300005546 | Bacteria | 2895 |
| 133 | Ga0070693_100000189 | 3300005547 | Bacteria | 28531 |
| 134 | Ga0070693_100008457 | 3300005547 | Bacteria | 5076 |
| 135 | Ga0070693_100009077 | 3300005547 | Bacteria | 4936 |
| 136 | Ga0070704_100056342 | 3300005549 | Bacteria | 2791 |
| 137 | Ga0070704_100067970 | 3300005549 | Bacteria | 2575 |
| 138 | Ga0070704_100161853 | 3300005549 | Bacteria | 1771 |
| 139 | Ga0068855_100000331 | 3300005563 | Bacteria | 58972 |
| 140 | Ga0068855_100015855 | 3300005563 | Bacteria | 9066 |
| 141 | Ga0070664_100001341 | 3300005564 | Bacteria | 19628 |
| 142 | Ga0070664_100006931 | 3300005564 | Bacteria | 9131 |
| 143 | Ga0070664_100064670 | 3300005564 | Bacteria | 3120 |
| 144 | Ga0068857_100000030 | 3300005577 | Bacteria | 76781 |
| 145 | Ga0068857_100030695 | 3300005577 | Bacteria | 4747 |
| 146 | Ga0068857_100113601 | 3300005577 | Bacteria | 2435 |
| 147 | Ga0068857_100231573 | 3300005577 | Bacteria | 1690 |
| 148 | Ga0068856_100000923 | 3300005614 | Bacteria | 31463 |
| 149 | Ga0068852_100000767 | 3300005616 | Bacteria | 21142 |
| 150 | Ga0068859_100273956 | 3300005617 | Bacteria | 1780 |
| 151 | Ga0068864_100017773 | 3300005618 | Bacteria | 5932 |
| 152 | Ga0068864_100086867 | 3300005618 | Unclassified | 2752 |
| 153 | Ga0068866_10000083 | 3300005718 | Bacteria | 38582 |
| 154 | Ga0068866_10054606 | 3300005718 | Bacteria | 2047 |
| 155 | Ga0068861_100000212 | 3300005719 | Bacteria | 31389 |
| 156 | Ga0068861_100016033 | 3300005719 | Bacteria | 5291 |
| 157 | Ga0068861_100188320 | 3300005719 | Bacteria | 1723 |
| 158 | Ga0068851_10038131 | 3300005834 | Bacteria | 2410 |
| 159 | Ga0068870_10000633 | 3300005840 | Bacteria | 13428 |
| 160 | Ga0068870_10002979 | 3300005840 | Bacteria | 7138 |
| 161 | Ga0068870_10005126 | 3300005840 | Bacteria | 5702 |
| 162 | Ga0068870_10011935 | 3300005840 | Bacteria | 4044 |
| 163 | Ga0068870_10024726 | 3300005840 | Bacteria | 2973 |
| 164 | Ga0068863_100004918 | 3300005841 | Bacteria | 13169 |
| 165 | Ga0068863_100030248 | 3300005841 | Bacteria | 5172 |
| 166 | Ga0068863_100046577 | 3300005841 | Bacteria | 4116 |
| 167 | Ga0068863_100072573 | 3300005841 | Unclassified | 3256 |
| 168 | Ga0068858_100209763 | 3300005842 | Bacteria | 1843 |
| 169 | Ga0068860_100031285 | 3300005843 | Bacteria | 5116 |
| 170 | Ga0068860_100042597 | 3300005843 | Bacteria | 4334 |
| 171 | Ga0068860_100129469 | 3300005843 | Bacteria | 2421 |
| 172 | Ga0068862_100002125 | 3300005844 | Bacteria | 17860 |
| 173 | Ga0068862_100008232 | 3300005844 | Bacteria | 8626 |
| 174 | Ga0068862_100011482 | 3300005844 | Bacteria | 7312 |
| 175 | Ga0068862_100016417 | 3300005844 | Bacteria | 6161 |
| 176 | Ga0068862_100093277 | 3300005844 | Bacteria | 2625 |
| 177 | Ga0081455_10000868 | 3300005937 | Bacteria | 39013 |
| 178 | Ga0081538_10003260 | 3300005981 | Bacteria | 15419 |
| 179 | Ga0081540_1000146 | 3300005983 | Bacteria | 72830 |
| 180 | Ga0081540_1010521 | 3300005983 | Bacteria | 6252 |
| 181 | Ga0081539_10000024 | 3300005985 | Bacteria | 354702 |
| 182 | Ga0081539_10000096 | 3300005985 | Bacteria | 204059 |
| 183 | Ga0081539_10002353 | 3300005985 | Bacteria | 27164 |
| 184 | Ga0075365_10022819 | 3300006038 | Bacteria | 3927 |
| 185 | Ga0075364_10015737 | 3300006051 | Bacteria | 4695 |
| 186 | Ga0070716_100056184 | 3300006173 | Bacteria | 2256 |
| 187 | Ga0070712_100003836 | 3300006175 | Bacteria | 9254 |
| 188 | Ga0075362_10000233 | 3300006177 | Bacteria | 15482 |
| 189 | Ga0075366_10007412 | 3300006195 | Bacteria | 6059 |
| 190 | Ga0075366_10009293 | 3300006195 | Bacteria | 5490 |
| 191 | Ga0075370_10066752 | 3300006353 | Bacteria | 2052 |
| 192 | Ga0068871_100018934 | 3300006358 | Bacteria | 5247 |
| 193 | Ga0068871_100152573 | 3300006358 | Bacteria | 1971 |
| 194 | Ga0068871_100167268 | 3300006358 | Bacteria | 1883 |
| 195 | Ga0075428_100004648 | 3300006844 | Bacteria | 15196 |
| 196 | Ga0075428_100015898 | 3300006844 | Bacteria | 8327 |
| 197 | Ga0075428_100059134 | 3300006844 | Bacteria | 4197 |
| 198 | Ga0075428_100168638 | 3300006844 | Bacteria | 2374 |
| 199 | Ga0075430_100007192 | 3300006846 | Bacteria | 9388 |
| 200 | Ga0075430_100019149 | 3300006846 | Bacteria | 5821 |
| 201 | Ga0075430_100039626 | 3300006846 | Bacteria | 3988 |
| 202 | Ga0075430_100045970 | 3300006846 | Bacteria | 3687 |
| 203 | Ga0075431_100000082 | 3300006847 | Bacteria | 56660 |
| 204 | Ga0075431_100000486 | 3300006847 | Bacteria | 32971 |
| 205 | Ga0075431_100001687 | 3300006847 | Bacteria | 20728 |
| 206 | Ga0075431_100022095 | 3300006847 | Bacteria | 6507 |
| 207 | Ga0075431_100040956 | 3300006847 | Bacteria | 4775 |
| 208 | Ga0075431_100094758 | 3300006847 | Unclassified | 3081 |
| 209 | Ga0075431_100183036 | 3300006847 | Bacteria | 2150 |
| 210 | Ga0075431_100188110 | 3300006847 | Bacteria | 2116 |
| 211 | Ga0075433_10000427 | 3300006852 | Bacteria | 27010 |
| 212 | Ga0075433_10000839 | 3300006852 | Bacteria | 21522 |
| 213 | Ga0075433_10002893 | 3300006852 | Bacteria | 13158 |
| 214 | Ga0075433_10005550 | 3300006852 | Bacteria | 9906 |
| 215 | Ga0075433_10015829 | 3300006852 | Bacteria | 6200 |
| 216 | Ga0075433_10051244 | 3300006852 | Bacteria | 3594 |
| 217 | Ga0075433_10087738 | 3300006852 | Bacteria | 2748 |
| 218 | Ga0075433_10132597 | 3300006852 | Unclassified | 2214 |
| 219 | Ga0075434_100000180 | 3300006871 | Bacteria | 41040 |
| 220 | Ga0075434_100001347 | 3300006871 | Bacteria | 20612 |
| 221 | Ga0075434_100010601 | 3300006871 | Bacteria | 8647 |
| 222 | Ga0075434_100022413 | 3300006871 | Bacteria | 6152 |
| 223 | Ga0075434_100040271 | 3300006871 | Bacteria | 4627 |
| 224 | Ga0075434_100060934 | 3300006871 | Bacteria | 3753 |
| 225 | Ga0075434_100066897 | 3300006871 | Bacteria | 3580 |
| 226 | Ga0075434_100114253 | 3300006871 | Unclassified | 2713 |
| 227 | Ga0075434_100131672 | 3300006871 | Bacteria | 2520 |
| 228 | Ga0075434_100327389 | 3300006871 | Bacteria | 1553 |
| 229 | Ga0075429_100002798 | 3300006880 | Bacteria | 14762 |
| 230 | Ga0075429_100045702 | 3300006880 | Bacteria | 3810 |
| 231 | Ga0075429_100081107 | 3300006880 | Bacteria | 2829 |
| 232 | Ga0075429_100099264 | 3300006880 | Bacteria | 2540 |
| 233 | Ga0068865_100159805 | 3300006881 | Bacteria | 1718 |
| 234 | Ga0075436_100018788 | 3300006914 | Bacteria | 4733 |
| 235 | Ga0097620_100273969 | 3300006931 | Bacteria | 1780 |
| 236 | Ga0075435_100022605 | 3300007076 | Bacteria | 4851 |
| 237 | Ga0075435_100039959 | 3300007076 | Bacteria | 3745 |
| 238 | Ga0075435_100048550 | 3300007076 | Bacteria | 3411 |
| 239 | Ga0075435_100062337 | 3300007076 | Bacteria | 3026 |
| 240 | Ga0099794_10021772 | 3300007265 | Bacteria | 2915 |
| 241 | Ga0099794_10046698 | 3300007265 | Unclassified | 2075 |
| 242 | Ga0105240_10006182 | 3300009093 | Bacteria | 17643 |
| 243 | Ga0111539_10000463 | 3300009094 | Bacteria | 51027 |
| 244 | Ga0111539_10001292 | 3300009094 | Bacteria | 33417 |
| 245 | Ga0111539_10001789 | 3300009094 | Bacteria | 28570 |
| 246 | Ga0111539_10002439 | 3300009094 | Bacteria | 24735 |
| 247 | Ga0111539_10006594 | 3300009094 | Bacteria | 14961 |
| 248 | Ga0111539_10022315 | 3300009094 | Bacteria | 7779 |
| 249 | Ga0111539_10031709 | 3300009094 | Bacteria | 6420 |
| 250 | Ga0111539_10053095 | 3300009094 | Bacteria | 4824 |
| 251 | Ga0111539_10093292 | 3300009094 | Bacteria | 3536 |
| 252 | Ga0111539_10128670 | 3300009094 | Bacteria | 2966 |
| 253 | Ga0111539_10207545 | 3300009094 | Unclassified | 2283 |
| 254 | Ga0105245_10000233 | 3300009098 | Bacteria | 52960 |
| 255 | Ga0105245_10109242 | 3300009098 | Bacteria | 2570 |
| 256 | Ga0105245_10141866 | 3300009098 | Bacteria | 2263 |
| 257 | Ga0105245_10283097 | 3300009098 | Bacteria | 1621 |
| 258 | Ga0105247_10057589 | 3300009101 | Bacteria | 2403 |
| 259 | Ga0114129_10000110 | 3300009147 | Bacteria | 81178 |
| 260 | Ga0114129_10001205 | 3300009147 | Bacteria | 34320 |
| 261 | Ga0114129_10001511 | 3300009147 | Bacteria | 31462 |
| 262 | Ga0114129_10003221 | 3300009147 | Bacteria | 22900 |
| 263 | Ga0114129_10025730 | 3300009147 | Bacteria | 8337 |
| 264 | Ga0114129_10031560 | 3300009147 | Bacteria | 7488 |
| 265 | Ga0114129_10061418 | 3300009147 | Bacteria | 5251 |
| 266 | Ga0114129_10073338 | 3300009147 | Bacteria | 4769 |
| 267 | Ga0114129_10101502 | 3300009147 | Bacteria | 3980 |
| 268 | Ga0114129_10117860 | 3300009147 | Bacteria | 3657 |
| 269 | Ga0114129_10127799 | 3300009147 | Bacteria | 3493 |
| 270 | Ga0114129_10128039 | 3300009147 | Bacteria | 3490 |
| 271 | Ga0114129_10132239 | 3300009147 | Unclassified | 3426 |
| 272 | Ga0114129_10233089 | 3300009147 | Bacteria | 2479 |
| 273 | Ga0114129_10385374 | 3300009147 | Bacteria | 1850 |
| 274 | Ga0105241_10001410 | 3300009174 | Bacteria | 18406 |
| 275 | Ga0105241_10069582 | 3300009174 | Bacteria | 2729 |
| 276 | Ga0105242_10002855 | 3300009176 | Bacteria | 13538 |
| 277 | Ga0105242_10007792 | 3300009176 | Bacteria | 8241 |
| 278 | Ga0105242_10015305 | 3300009176 | Bacteria | 5957 |
| 279 | Ga0105242_10023761 | 3300009176 | Bacteria | 4835 |
| 280 | Ga0105248_10110182 | 3300009177 | Bacteria | 3104 |
| 281 | Ga0105248_10323173 | 3300009177 | Bacteria | 1738 |
| 282 | Ga0105237_10000549 | 3300009545 | Bacteria | 52724 |
| 283 | Ga0105238_10141696 | 3300009551 | Bacteria | 2381 |
| 284 | Ga0105238_10165024 | 3300009551 | Bacteria | 2190 |
| 285 | Ga0105249_10008153 | 3300009553 | Bacteria | 9132 |
| 286 | Ga0105239_10071671 | 3300010375 | Bacteria | 3807 |
| 287 | Ga0105246_10028242 | 3300011119 | Bacteria | 3684 |
| 288 | Ga0157373_10069753 | 3300013100 | Bacteria | 2484 |
| 289 | Ga0157369_10017116 | 3300013105 | Bacteria | 8146 |
| 290 | Ga0157374_10223928 | 3300013296 | Unclassified | 1847 |
| 291 | Ga0157378_10163632 | 3300013297 | Bacteria | 2082 |
| 292 | Ga0163162_10022241 | 3300013306 | Bacteria | 6249 |
| 293 | Ga0163162_10055520 | 3300013306 | Bacteria | 3988 |
| 294 | Ga0157372_10008010 | 3300013307 | Bacteria | 11239 |
| 295 | Ga0157375_10256242 | 3300013308 | Bacteria | 1911 |
| 296 | Ga0157375_10268348 | 3300013308 | Unclassified | 1868 |
| 297 | Ga0157380_10001243 | 3300014326 | Bacteria | 16534 |
| 298 | Ga0157380_10003226 | 3300014326 | Bacteria | 11146 |
| 299 | Ga0157377_10008351 | 3300014745 | Bacteria | 5047 |
| 300 | Ga0157379_10000876 | 3300014968 | Bacteria | 24372 |
| 301 | Ga0157376_10000809 | 3300014969 | Bacteria | 20511 |
| 302 | Ga0163161_10015178 | 3300017792 | Bacteria | 5367 |
| 303 | Ga0207697_10001435 | 3300025315 | Bacteria | 13051 |
| 304 | Ga0207697_10004936 | 3300025315 | Bacteria | 6287 |
| 305 | Ga0207656_10008015 | 3300025321 | Bacteria | 3873 |
| 306 | Ga0207653_10013704 | 3300025885 | Bacteria | 2539 |
| 307 | Ga0207682_10000953 | 3300025893 | Bacteria | 13423 |
| 308 | Ga0207682_10016474 | 3300025893 | Bacteria | 2883 |
| 309 | Ga0207710_10024134 | 3300025900 | Bacteria | 2617 |
| 310 | Ga0207688_10001607 | 3300025901 | Bacteria | 11929 |
| 311 | Ga0207688_10027388 | 3300025901 | Bacteria | 3135 |
| 312 | Ga0207645_10000043 | 3300025907 | Bacteria | 85557 |
| 313 | Ga0207645_10000400 | 3300025907 | Bacteria | 35898 |
| 314 | Ga0207645_10016127 | 3300025907 | Bacteria | 4948 |
| 315 | Ga0207645_10028198 | 3300025907 | Bacteria | 3625 |
| 316 | Ga0207643_10000424 | 3300025908 | Bacteria | 27864 |
| 317 | Ga0207643_10000489 | 3300025908 | Bacteria | 25451 |
| 318 | Ga0207643_10000732 | 3300025908 | Bacteria | 20161 |
| 319 | Ga0207643_10015996 | 3300025908 | Bacteria | 4086 |
| 320 | Ga0207643_10024053 | 3300025908 | Bacteria | 3362 |
| 321 | Ga0207684_10003777 | 3300025910 | Bacteria | 14629 |
| 322 | Ga0207684_10011947 | 3300025910 | Bacteria | 7564 |
| 323 | Ga0207684_10023037 | 3300025910 | Bacteria | 5319 |
| 324 | Ga0207684_10043927 | 3300025910 | Bacteria | 3789 |
| 325 | Ga0207684_10058826 | 3300025910 | Bacteria | 3262 |
| 326 | Ga0207684_10113773 | 3300025910 | Bacteria | 2317 |
| 327 | Ga0207654_10010692 | 3300025911 | Bacteria | 4674 |
| 328 | Ga0207707_10000116 | 3300025912 | Bacteria | 81364 |
| 329 | Ga0207707_10109336 | 3300025912 | Bacteria | 2417 |
| 330 | Ga0207671_10004294 | 3300025914 | Bacteria | 13705 |
| 331 | Ga0207693_10006943 | 3300025915 | Bacteria | 9356 |
| 332 | Ga0207663_10018254 | 3300025916 | Bacteria | 3927 |
| 333 | Ga0207662_10000043 | 3300025918 | Bacteria | 56727 |
| 334 | Ga0207662_10000891 | 3300025918 | Bacteria | 13817 |
| 335 | Ga0207662_10003651 | 3300025918 | Bacteria | 7968 |
| 336 | Ga0207662_10003719 | 3300025918 | Bacteria | 7906 |
| 337 | Ga0207662_10007198 | 3300025918 | Bacteria | 6051 |
| 338 | Ga0207657_10000211 | 3300025919 | Bacteria | 60392 |
| 339 | Ga0207657_10001235 | 3300025919 | Bacteria | 27312 |
| 340 | Ga0207649_10002015 | 3300025920 | Bacteria | 11561 |
| 341 | Ga0207649_10006395 | 3300025920 | Bacteria | 6398 |
| 342 | Ga0207652_10003841 | 3300025921 | Bacteria | 12319 |
| 343 | Ga0207646_10006951 | 3300025922 | Bacteria | 11608 |
| 344 | Ga0207646_10027940 | 3300025922 | Bacteria | 5142 |
| 345 | Ga0207646_10062784 | 3300025922 | Bacteria | 3316 |
| 346 | Ga0207646_10123365 | 3300025922 | Unclassified | 2329 |
| 347 | Ga0207681_10008695 | 3300025923 | Bacteria | 6201 |
| 348 | Ga0207681_10011598 | 3300025923 | Bacteria | 5415 |
| 349 | Ga0207694_10067456 | 3300025924 | Bacteria | 2792 |
| 350 | Ga0207694_10103230 | 3300025924 | Bacteria | 2261 |
| 351 | Ga0207650_10086341 | 3300025925 | Bacteria | 2389 |
| 352 | Ga0207650_10135932 | 3300025925 | Bacteria | 1928 |
| 353 | Ga0207659_10000351 | 3300025926 | Bacteria | 27522 |
| 354 | Ga0207659_10002998 | 3300025926 | Bacteria | 10064 |
| 355 | Ga0207659_10031425 | 3300025926 | Bacteria | 3634 |
| 356 | Ga0207659_10166067 | 3300025926 | Unclassified | 1737 |
| 357 | Ga0207659_10187184 | 3300025926 | Bacteria | 1645 |
| 358 | Ga0207687_10014744 | 3300025927 | Bacteria | 5118 |
| 359 | Ga0207687_10064136 | 3300025927 | Bacteria | 2604 |
| 360 | Ga0207687_10079611 | 3300025927 | Bacteria | 2363 |
| 361 | Ga0207690_10000823 | 3300025932 | Bacteria | 19912 |
| 362 | Ga0207690_10001495 | 3300025932 | Bacteria | 14606 |
| 363 | Ga0207706_10000162 | 3300025933 | Bacteria | 74975 |
| 364 | Ga0207706_10004021 | 3300025933 | Bacteria | 13914 |
| 365 | Ga0207706_10017429 | 3300025933 | Bacteria | 6469 |
| 366 | Ga0207706_10020893 | 3300025933 | Bacteria | 5878 |
| 367 | Ga0207706_10041882 | 3300025933 | Bacteria | 4058 |
| 368 | Ga0207706_10159902 | 3300025933 | Bacteria | 1980 |
| 369 | Ga0207686_10064513 | 3300025934 | Bacteria | 2332 |
| 370 | Ga0207709_10074430 | 3300025935 | Bacteria | 2167 |
| 371 | Ga0207709_10116300 | 3300025935 | Bacteria | 1798 |
| 372 | Ga0207670_10048949 | 3300025936 | Bacteria | 2824 |
| 373 | Ga0207670_10061086 | 3300025936 | Unclassified | 2570 |
| 374 | Ga0207704_10071650 | 3300025938 | Unclassified | 2200 |
| 375 | Ga0207665_10007130 | 3300025939 | Bacteria | 7399 |
| 376 | Ga0207691_10000053 | 3300025940 | Bacteria | 91814 |
| 377 | Ga0207691_10007695 | 3300025940 | Bacteria | 10370 |
| 378 | Ga0207691_10010524 | 3300025940 | Bacteria | 8877 |
| 379 | Ga0207691_10063428 | 3300025940 | Bacteria | 3351 |
| 380 | Ga0207711_10000276 | 3300025941 | Bacteria | 55530 |
| 381 | Ga0207711_10105861 | 3300025941 | Bacteria | 2495 |
| 382 | Ga0207711_10247569 | 3300025941 | Bacteria | 1636 |
| 383 | Ga0207689_10000026 | 3300025942 | Bacteria | 103610 |
| 384 | Ga0207689_10000201 | 3300025942 | Bacteria | 52554 |
| 385 | Ga0207689_10005325 | 3300025942 | Bacteria | 11533 |
| 386 | Ga0207689_10006142 | 3300025942 | Bacteria | 10632 |
| 387 | Ga0207689_10057840 | 3300025942 | Bacteria | 3189 |
| 388 | Ga0207689_10111208 | 3300025942 | Bacteria | 2251 |
| 389 | Ga0207661_10031217 | 3300025944 | Bacteria | 4112 |
| 390 | Ga0207661_10031757 | 3300025944 | Unclassified | 4084 |
| 391 | Ga0207679_10000449 | 3300025945 | Bacteria | 29072 |
| 392 | Ga0207679_10006771 | 3300025945 | Bacteria | 7260 |
| 393 | Ga0207667_10002107 | 3300025949 | Bacteria | 24946 |
| 394 | Ga0207651_10002705 | 3300025960 | Bacteria | 8496 |
| 395 | Ga0207651_10073549 | 3300025960 | Bacteria | 2430 |
| 396 | Ga0207651_10102406 | 3300025960 | Unclassified | 2128 |
| 397 | Ga0207651_10166804 | 3300025960 | Bacteria | 1732 |
| 398 | Ga0207712_10066798 | 3300025961 | Bacteria | 2572 |
| 399 | Ga0207668_10037148 | 3300025972 | Bacteria | 3258 |
| 400 | Ga0207668_10046780 | 3300025972 | Bacteria | 2958 |
| 401 | Ga0207640_10099415 | 3300025981 | Bacteria | 2036 |
| 402 | Ga0207658_10001466 | 3300025986 | Bacteria | 18396 |
| 403 | Ga0207658_10066628 | 3300025986 | Unclassified | 2709 |
| 404 | Ga0207677_10039272 | 3300026023 | Bacteria | 3111 |
| 405 | Ga0207677_10145629 | 3300026023 | Bacteria | 1820 |
| 406 | Ga0207703_10000059 | 3300026035 | Bacteria | 134931 |
| 407 | Ga0207703_10016319 | 3300026035 | Bacteria | 5789 |
| 408 | Ga0207639_10004331 | 3300026041 | Bacteria | 9569 |
| 409 | Ga0207639_10032200 | 3300026041 | Bacteria | 3858 |
| 410 | Ga0207639_10119734 | 3300026041 | Bacteria | 2161 |
| 411 | Ga0207678_10004271 | 3300026067 | Bacteria | 12812 |
| 412 | Ga0207708_10012567 | 3300026075 | Bacteria | 6313 |
| 413 | Ga0207708_10015376 | 3300026075 | Bacteria | 5740 |
| 414 | Ga0207702_10001143 | 3300026078 | Bacteria | 27129 |
| 415 | Ga0207641_10012977 | 3300026088 | Bacteria | 6835 |
| 416 | Ga0207641_10025232 | 3300026088 | Bacteria | 4902 |
| 417 | Ga0207648_10001530 | 3300026089 | Bacteria | 25466 |
| 418 | Ga0207648_10003683 | 3300026089 | Bacteria | 16035 |
| 419 | Ga0207648_10012060 | 3300026089 | Bacteria | 8105 |
| 420 | Ga0207648_10012239 | 3300026089 | Bacteria | 8034 |
| 421 | Ga0207648_10039622 | 3300026089 | Bacteria | 4143 |
| 422 | Ga0207674_10000951 | 3300026116 | Bacteria | 37804 |
| 423 | Ga0207674_10001221 | 3300026116 | Bacteria | 33487 |
| 424 | Ga0207674_10121570 | 3300026116 | Bacteria | 2578 |
| 425 | Ga0207674_10228190 | 3300026116 | Bacteria | 1810 |
| 426 | Ga0207675_100000233 | 3300026118 | Bacteria | 52659 |
| 427 | Ga0207675_100002501 | 3300026118 | Bacteria | 18185 |
| 428 | Ga0207675_100016025 | 3300026118 | Bacteria | 6997 |
| 429 | Ga0207675_100069969 | 3300026118 | Bacteria | 3280 |
| 430 | Ga0207675_100236249 | 3300026118 | Bacteria | 1765 |
| 431 | Ga0207683_10000624 | 3300026121 | Bacteria | 32521 |
| 432 | Ga0207683_10007833 | 3300026121 | Bacteria | 9145 |
| 433 | Ga0207683_10045698 | 3300026121 | Bacteria | 3830 |
| 434 | Ga0209969_1001359 | 3300027360 | Bacteria | 3358 |
| 435 | Ga0209984_1000634 | 3300027424 | Bacteria | 3780 |
| 436 | Ga0209968_1000573 | 3300027526 | Bacteria | 5687 |
| 437 | Ga0209970_1000407 | 3300027614 | Bacteria | 7263 |
| 438 | Ga0209971_1000037 | 3300027682 | Bacteria | 45920 |
| 439 | Ga0209966_1000378 | 3300027695 | Bacteria | 13523 |
| 440 | Ga0209998_10000042 | 3300027717 | Bacteria | 51743 |
| 441 | Ga0209974_10000465 | 3300027876 | Bacteria | 13444 |
| 442 | Ga0207428_10000027 | 3300027907 | Bacteria | 250186 |
| 443 | Ga0207428_10000245 | 3300027907 | Bacteria | 74009 |
| 444 | Ga0207428_10000849 | 3300027907 | Bacteria | 34443 |
| 445 | Ga0207428_10005064 | 3300027907 | Bacteria | 12382 |
| 446 | Ga0207428_10007736 | 3300027907 | Bacteria | 9776 |
| 447 | Ga0207428_10008043 | 3300027907 | Bacteria | 9569 |
| 448 | Ga0207428_10023843 | 3300027907 | Bacteria | 5140 |
| 449 | Ga0207428_10042406 | 3300027907 | Bacteria | 3680 |
| 450 | Ga0207428_10188618 | 3300027907 | Bacteria | 1555 |
| 451 | Ga0268266_10001681 | 3300028379 | Bacteria | 25466 |
| 452 | Ga0268265_10005618 | 3300028380 | Bacteria | 8563 |
| 453 | Ga0268265_10022805 | 3300028380 | Unclassified | 4404 |
| 454 | Ga0268265_10061875 | 3300028380 | Bacteria | 2874 |
| 455 | Ga0268264_10003233 | 3300028381 | Bacteria | 14106 |
| 456 | Ga0307408_100058337 | 3300031548 | Bacteria | 2806 |
| 457 | Ga0307405_10039995 | 3300031731 | Bacteria | 2838 |
| 458 | Ga0307405_10074946 | 3300031731 | Bacteria | 2190 |
| 459 | Ga0307416_100050470 | 3300032002 | Bacteria | 3316 |
| 460 | Ga0307416_100122713 | 3300032002 | Bacteria | 2320 |
| 461 | Ga0373940_0001611 | 3300035088 | Bacteria | 4141 |
| 462 | Ga0373940_0013102 | 3300035088 | Bacteria | 1998 |
| 463 | Ga0373949_0007232 | 3300035090 | Bacteria | 2432 |
| 464 | Ga0373939_0007541 | 3300035114 | Bacteria | 2644 |
| 465 | Ga0373939_0016739 | 3300035114 | Bacteria | 1937 |
| 466 | Ga0373961_0007741 | 3300035241 | Bacteria | 2603 |
| 467 | Ga0373933_0106003 | 3300035724 | Bacteria | 1749 |
| 468 | Ga0373925_0092635 | 3300037068 | Bacteria | 2312 |
| 469 | Ga0395900_0002273 | 3300037418 | Bacteria | 21347 |
| 470 | Ga0395898_0005721 | 3300037466 | Bacteria | 13392 |
| 471 | Ga0395901_0021074 | 3300038443 | Bacteria | 6676 |
| 472 | Ga0439448_0005919 | 3300042005 | Bacteria | 3498 |
| 473 | Ga0439435_0002235 | 3300042436 | Bacteria | 3796 |
| 474 | Ga0439435_0004587 | 3300042436 | Bacteria | 2989 |
| 475 | Ga0439459_0000110 | 3300042438 | Bacteria | 7701 |
| 476 | Ga0439464_0000830 | 3300042439 | Bacteria | 6826 |
| 477 | Ga0439460_0000197 | 3300042461 | Bacteria | 11816 |
| 478 | Ga0451577_0002796 | 3300042876 | Bacteria | 20141 |
| 479 | Ga0451577_0006253 | 3300042876 | Bacteria | 11929 |
| 480 | Ga0451577_0053635 | 3300042876 | Bacteria | 3599 |
| 481 | Ga0451577_0068274 | 3300042876 | Bacteria | 3170 |
| 482 | Ga0439440_0009806 | 3300042993 | Bacteria | 1989 |
| 483 | Ga0453683_0026123 | 3300044673 | Bacteria | 3708 |
| 484 | Ga0453683_0050488 | 3300044673 | Bacteria | 2606 |
| 485 | Ga0453684_0023625 | 3300044712 | Bacteria | 9036 |
| 486 | Ga0453684_0058416 | 3300044712 | Bacteria | 4983 |
| 487 | Ga0453684_0118568 | 3300044712 | Bacteria | 3201 |
| 488 | Ga0453684_0272065 | 3300044712 | Bacteria | 1935 |
| 489 | Ga0451576_0004364 | 3300045051 | Bacteria | 18442 |
| 490 | Ga0451576_0005141 | 3300045051 | Bacteria | 16570 |
| 491 | Ga0451576_0005764 | 3300045051 | Bacteria | 15422 |
| 492 | Ga0451576_0019775 | 3300045051 | Bacteria | 7347 |
| 493 | Ga0451576_0026087 | 3300045051 | Bacteria | 6287 |
| 494 | Ga0451576_0045920 | 3300045051 | Bacteria | 4599 |
| 495 | Ga0451576_0065829 | 3300045051 | Bacteria | 3773 |
| 496 | Ga0451576_0084972 | 3300045051 | Unclassified | 3291 |
| 497 | Ga0451576_0181174 | 3300045051 | Bacteria | 2199 |
| 498 | Ga0495603_0017434 | 3300046455 | Bacteria | 4345 |
| 499 | Ga0495629_0016857 | 3300046459 | Bacteria | 5243 |
| 500 | Ga0495580_0000727 | 3300046472 | Bacteria | 28206 |
| 501 | Ga0495628_0055710 | 3300046516 | Bacteria | 3114 |
| 502 | Ga0495633_0025371 | 3300046558 | Bacteria | 2919 |
| 503 | Ga0495667_0000367 | 3300046559 | Bacteria | 28503 |
| 504 | Ga0495656_0064340 | 3300046615 | Unclassified | 1610 |
| 505 | Ga0495659_0003220 | 3300046664 | Bacteria | 5230 |
| 506 | Ga0495659_0019150 | 3300046664 | Bacteria | 2289 |
| 507 | Ga0495669_0030073 | 3300046684 | Bacteria | 2384 |
| 508 | Ga0495674_0088115 | 3300047319 | Bacteria | 2655 |
| 509 | Ga0496106_0000637 | 3300048909 | Bacteria | 25174 |
| 510 | Ga0496112_0012711 | 3300048915 | Bacteria | 7742 |
| 511 | Ga0496112_0073778 | 3300048915 | Bacteria | 3373 |
| 512 | Ga0501031_0023404 | 3300049568 | Bacteria | 4027 |
| 513 | Ga0501033_0025025 | 3300049570 | Bacteria | 4498 |
| 514 | Ga0501033_0106442 | 3300049570 | Unclassified | 2043 |
| 515 | Ga0501034_0006093 | 3300049571 | Bacteria | 13017 |
| 516 | Ga0501034_0190474 | 3300049571 | Bacteria | 2013 |
| 517 | Ga0501036_0000997 | 3300049572 | Bacteria | 21389 |
| 518 | Ga0501036_0050451 | 3300049572 | Unclassified | 3524 |
| 519 | Ga0501037_0086148 | 3300049573 | Bacteria | 2274 |
| 520 | Ga0501038_0000877 | 3300049574 | Bacteria | 26657 |
| 521 | Ga0501038_0054489 | 3300049574 | Bacteria | 3440 |
| 522 | Ga0501039_0000306 | 3300049575 | Bacteria | 34767 |
| 523 | Ga0501039_0012641 | 3300049575 | Bacteria | 6453 |
| 524 | Ga0501039_0072161 | 3300049575 | Bacteria | 2683 |
| 525 | Ga0501040_0000832 | 3300049576 | Bacteria | 19300 |
| 526 | Ga0501040_0002340 | 3300049576 | Bacteria | 12167 |
| 527 | Ga0501040_0015254 | 3300049576 | Bacteria | 5078 |
| 528 | Ga0501040_0047905 | 3300049576 | Bacteria | 2920 |
| 529 | Ga0501040_0156538 | 3300049576 | Bacteria | 1609 |
| 530 | Ga0501041_0006125 | 3300049577 | Bacteria | 7033 |
| 531 | Ga0501041_0006839 | 3300049577 | Bacteria | 6683 |
| 532 | Ga0501041_0013389 | 3300049577 | Bacteria | 4862 |
| 533 | Ga0501042_0006874 | 3300049578 | Bacteria | 7423 |
| 534 | Ga0501042_0014338 | 3300049578 | Bacteria | 5409 |
| 535 | Ga0501042_0034409 | 3300049578 | Bacteria | 3593 |
| 536 | Ga0501042_0157396 | 3300049578 | Bacteria | 1639 |
| 537 | Ga0501046_0033137 | 3300049580 | Bacteria | 4177 |
| 538 | Ga0501046_0075277 | 3300049580 | Bacteria | 2617 |
| 539 | Ga0501046_0114920 | 3300049580 | Bacteria | 2053 |
| 540 | Ga0501047_0109507 | 3300049581 | Bacteria | 2645 |
| 541 | Ga0501047_0221891 | 3300049581 | Bacteria | 1746 |
| 542 | Ga0501048_0001234 | 3300049582 | Bacteria | 19386 |
| 543 | Ga0501048_0024994 | 3300049582 | Bacteria | 4357 |
| 544 | Ga0501048_0083670 | 3300049582 | Bacteria | 2250 |
| 545 | Ga0501068_0001222 | 3300049584 | Bacteria | 13619 |
| 546 | Ga0501068_0031832 | 3300049584 | Bacteria | 3134 |
| 547 | Ga0501070_0013626 | 3300049586 | Bacteria | 6852 |
| 548 | Ga0501072_0002438 | 3300049588 | Bacteria | 13931 |
| 549 | Ga0501072_0027727 | 3300049588 | Bacteria | 4418 |
| 550 | Ga0501072_0035451 | 3300049588 | Bacteria | 3908 |
| 551 | Ga0501072_0078538 | 3300049588 | Bacteria | 2613 |
| 552 | Ga0501072_0132229 | 3300049588 | Bacteria | 1989 |
| 553 | Ga0501073_0106623 | 3300049589 | Bacteria | 1944 |
| 554 | Ga0501074_0000224 | 3300049590 | Bacteria | 31333 |
| 555 | Ga0501074_0032375 | 3300049590 | Bacteria | 3787 |
| 556 | Ga0501074_0164172 | 3300049590 | Bacteria | 1586 |
| 557 | Ga0501075_0001171 | 3300049591 | Bacteria | 16961 |
| 558 | Ga0501075_0006351 | 3300049591 | Bacteria | 8129 |
| 559 | Ga0501075_0007121 | 3300049591 | Bacteria | 7737 |
| 560 | Ga0501075_0043634 | 3300049591 | Bacteria | 3363 |
| 561 | Ga0501075_0055523 | 3300049591 | Bacteria | 2980 |
| 562 | Ga0501075_0093010 | 3300049591 | Bacteria | 2289 |
| 563 | Ga0501076_0001587 | 3300049592 | Bacteria | 15287 |
| 564 | Ga0501076_0029084 | 3300049592 | Bacteria | 4295 |
| 565 | Ga0501076_0069071 | 3300049592 | Bacteria | 2823 |
| 566 | Ga0501076_0118503 | 3300049592 | Bacteria | 2143 |
| 567 | Ga0501077_0009200 | 3300049593 | Bacteria | 6134 |
| 568 | Ga0501077_0009822 | 3300049593 | Bacteria | 5953 |
| 569 | Ga0501077_0079258 | 3300049593 | Unclassified | 2081 |
| 570 | Ga0501077_0080278 | 3300049593 | Bacteria | 2067 |
| 571 | Ga0501079_0001398 | 3300049741 | Bacteria | 17010 |
| 572 | Ga0501079_0011415 | 3300049741 | Bacteria | 6780 |
| 573 | Ga0501079_0012871 | 3300049741 | Bacteria | 6386 |
| 574 | Ga0501079_0033516 | 3300049741 | Bacteria | 3951 |
| 575 | Ga0501079_0056218 | 3300049741 | Bacteria | 3036 |
| 576 | Ga0501079_0085288 | 3300049741 | Bacteria | 2444 |
| 577 | Ga0501080_0003252 | 3300049742 | Bacteria | 14335 |
| 578 | Ga0501080_0162053 | 3300049742 | Bacteria | 2065 |
| 579 | Ga0501081_0003382 | 3300049743 | Bacteria | 10153 |
| 580 | Ga0501081_0005258 | 3300049743 | Bacteria | 8341 |
| 581 | Ga0501081_0011638 | 3300049743 | Bacteria | 5758 |
| 582 | Ga0501081_0013942 | 3300049743 | Bacteria | 5292 |
| 583 | Ga0501081_0028626 | 3300049743 | Bacteria | 3760 |
| 584 | Ga0501081_0055063 | 3300049743 | Bacteria | 2748 |
| 585 | Ga0501081_0151553 | 3300049743 | Unclassified | 1666 |
| 586 | Ga0501083_0014659 | 3300049744 | Bacteria | 5480 |
| 587 | Ga0501045_0001152 | 3300049824 | Bacteria | 17508 |
| 588 | Ga0501045_0018435 | 3300049824 | Bacteria | 4964 |
| 589 | Ga0501045_0019119 | 3300049824 | Bacteria | 4880 |
| 590 | Ga0501045_0035209 | 3300049824 | Bacteria | 3634 |
| 591 | Ga0501045_0039549 | 3300049824 | Bacteria | 3432 |
| 592 | Ga0501045_0230241 | 3300049824 | Bacteria | 1380 |
| 593 | nmdc:mga03683_2028_c1 | 3300050489 | Bacteria | 6198 |
| 594 | nmdc:mga00v17_2153_c1 | 3300050491 | Bacteria | 10125 |
| 595 | nmdc:mga0k408_19033_c1 | 3300050493 | Bacteria | 3834 |
| 596 | nmdc:mga0k408_7123_c1 | 3300050493 | Bacteria | 5975 |
| 597 | nmdc:mga05p37_11414_c1 | 3300050507 | Bacteria | 10575 |
| 598 | nmdc:mga05p37_14939_c1 | 3300050507 | Bacteria | 6685 |
| 599 | nmdc:mga05p37_174216_c1 | 3300050507 | Unclassified | 2622 |
| 600 | nmdc:mga05p37_183619_c1 | 3300050507 | Bacteria | 2543 |
| 601 | nmdc:mga05p37_19057_c1 | 3300050507 | Bacteria | 8299 |
| 602 | nmdc:mga05p37_208119_c1 | 3300050507 | Bacteria | 2365 |
| 603 | nmdc:mga05p37_250013_c1 | 3300050507 | Bacteria | 2127 |
| 604 | nmdc:mga05p37_67675_c2 | 3300050507 | Bacteria | 1529 |
| 605 | nmdc:mga05p37_70532_c1 | 3300050507 | Bacteria | 4298 |
| 606 | nmdc:mga05p37_7406_c1 | 3300050507 | Bacteria | 12949 |
| 607 | nmdc:mga05p37_7480_c1 | 3300050507 | Bacteria | 12877 |
| 608 | nmdc:mga09592_17484_c1 | 3300050508 | Bacteria | 5875 |
| 609 | nmdc:mga09592_190943_c1 | 3300050508 | Bacteria | 1773 |
| 610 | nmdc:mga09592_244269_c1 | 3300050508 | Bacteria | 1556 |
| 611 | nmdc:mga09592_28662_c1 | 3300050508 | Bacteria | 3669 |
| 612 | nmdc:mga09592_3878_c1 | 3300050508 | Bacteria | 12046 |
| 613 | nmdc:mga09592_48767_c1 | 3300050508 | Bacteria | 3570 |
| 614 | nmdc:mga0qj67_22405_c1 | 3300050509 | Bacteria | 4853 |
| 615 | nmdc:mga0qj67_54944_c1 | 3300050509 | Bacteria | 3154 |
| 616 | nmdc:mga0qj67_7809_c1 | 3300050509 | Bacteria | 7907 |
| 617 | nmdc:mga06r32_1744_c1 | 3300050510 | Bacteria | 19568 |
| 618 | nmdc:mga06r32_174880_c1 | 3300050510 | Bacteria | 2131 |
| 619 | nmdc:mga06r32_39458_c1 | 3300050510 | Bacteria | 4480 |
| 620 | nmdc:mga06r32_71500_c1 | 3300050510 | Bacteria | 3357 |
| 621 | nmdc:mga06r32_7977_c1 | 3300050510 | Bacteria | 9516 |
| 622 | nmdc:mga06r32_89056_c1 | 3300050510 | Unclassified | 3013 |
| 623 | nmdc:mga08y16_11754_c1 | 3300050511 | Bacteria | 9196 |
| 624 | nmdc:mga08y16_1306_c1 | 3300050511 | Bacteria | 24771 |
| 625 | nmdc:mga08y16_17787_c1 | 3300050511 | Bacteria | 7488 |
| 626 | nmdc:mga08y16_201006_c1 | 3300050511 | Bacteria | 2065 |
| 627 | nmdc:mga08y16_24924_c1 | 3300050511 | Bacteria | 6310 |
| 628 | nmdc:mga08y16_2919_c1 | 3300050511 | Bacteria | 17590 |
| 629 | nmdc:mga08y16_31120_c1 | 3300050511 | Bacteria | 5614 |
| 630 | nmdc:mga08y16_52414_c1 | 3300050511 | Bacteria | 4269 |
| 631 | nmdc:mga08y16_597_c1 | 3300050511 | Bacteria | 33660 |
| 632 | nmdc:mga0n895_14004_c1 | 3300050512 | Bacteria | 7265 |
| 633 | nmdc:mga0n895_1895_c1 | 3300050512 | Bacteria | 16010 |
| 634 | nmdc:mga0n895_24005_c1 | 3300050512 | Bacteria | 5740 |
| 635 | nmdc:mga0n895_43435_c1 | 3300050512 | Bacteria | 4380 |
| 636 | nmdc:mga0n895_477_c1 | 3300050512 | Bacteria | 26935 |
| 637 | nmdc:mga0n895_53201_c1 | 3300050512 | Bacteria | 3978 |
| 638 | nmdc:mga0n895_57467_c1 | 3300050512 | Bacteria | 3835 |
| 639 | nmdc:mga0n895_60869_c1 | 3300050512 | Bacteria | 3726 |
| 640 | nmdc:mga0n895_77660_c1 | 3300050512 | Bacteria | 3303 |
| 641 | nmdc:mga0n895_83684_c1 | 3300050512 | Bacteria | 3183 |
| 642 | nmdc:mga0rr50_109889_c1 | 3300050513 | Bacteria | 2180 |
| 643 | nmdc:mga0rr50_27543_c1 | 3300050513 | Bacteria | 3981 |
| 644 | nmdc:mga0rr50_34073_c1 | 3300050513 | Bacteria | 3644 |
| 645 | nmdc:mga0rr50_35406_c1 | 3300050513 | Bacteria | 3585 |
| 646 | nmdc:mga0rr50_7633_c1 | 3300050513 | Bacteria | 6688 |
| 647 | nmdc:mga08x19_17737_c1 | 3300050514 | Bacteria | 4359 |
| 648 | nmdc:mga08x19_57107_c1 | 3300050514 | Bacteria | 2521 |
| 649 | nmdc:mga0a205_11142_c1 | 3300050515 | Bacteria | 8275 |
| 650 | nmdc:mga0a205_112429_c1 | 3300050515 | Bacteria | 2623 |
| 651 | nmdc:mga0a205_133836_c1 | 3300050515 | Bacteria | 2380 |
| 652 | nmdc:mga0a205_13783_c1 | 3300050515 | Bacteria | 7537 |
| 653 | nmdc:mga0a205_139255_c1 | 3300050515 | Unclassified | 2327 |
| 654 | nmdc:mga0a205_17339_c1 | 3300050515 | Bacteria | 6748 |
| 655 | nmdc:mga0a205_196715_c1 | 3300050515 | Bacteria | 1907 |
| 656 | nmdc:mga0a205_1991_c1 | 3300050515 | Bacteria | 17807 |
| 657 | nmdc:mga0a205_227_c1 | 3300050515 | Bacteria | 39744 |
| 658 | nmdc:mga0a205_58581_c1 | 3300050515 | Bacteria | 3720 |
| 659 | nmdc:mga0a205_646_c1 | 3300050515 | Bacteria | 27674 |
| 660 | nmdc:mga0a205_66283_c1 | 3300050515 | Bacteria | 3489 |
| 661 | Ga0501084_0001523 | 3300054114 | Bacteria | 18387 |
| 662 | Ga0501084_0014381 | 3300054114 | Bacteria | 6558 |
| 663 | Ga0501084_0017452 | 3300054114 | Bacteria | 5967 |
| 664 | Ga0501082_0000243 | 3300060353 | Bacteria | 47694 |
| 665 | Ga0501082_0005963 | 3300060353 | Bacteria | 10570 |
| 666 | Ga0530510_0001138 | 3300061734 | Bacteria | 17692 |
| 667 | Ga0530510_0005834 | 3300061734 | Bacteria | 8533 |
| 668 | Ga0530510_0006581 | 3300061734 | Bacteria | 8100 |
| 669 | Ga0530510_0022799 | 3300061734 | Bacteria | 4461 |
| 670 | Ga0530510_0047130 | 3300061734 | Bacteria | 3114 |
| 671 | Ga0530510_0057599 | 3300061734 | Bacteria | 2808 |
| 672 | Ga0530510_0099475 | 3300061734 | Bacteria | 2126 |
| 673 | Ga0530510_0138480 | 3300061734 | Bacteria | 1792 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300061734 | Ga0530510_0005834 | Ga0530510_0005834_1084_2487 | 383 |
| 2 | 3300009551 | Ga0105238_10141696 | Ga0105238_101416961 | 400 |
| 3 | 3300025942 | Ga0207689_10057840 | Ga0207689_100578403 | 414 |
| 4 | 3300049568 | Ga0501031_0023404 | Ga0501031_0023404_2331_3737 | 415 |
| 5 | 3300049570 | Ga0501033_0025025 | Ga0501033_0025025_1090_2496 | 415 |
| 6 | 3300049572 | Ga0501036_0000997 | Ga0501036_0000997_10003_11409 | 415 |
| 7 | 3300049573 | Ga0501037_0086148 | Ga0501037_0086148_281_1687 | 415 |
| 8 | 3300049574 | Ga0501038_0000877 | Ga0501038_0000877_10797_12203 | 415 |
| 9 | 3300049575 | Ga0501039_0000306 | Ga0501039_0000306_9001_10407 | 415 |
| 10 | 3300049576 | Ga0501040_0000832 | Ga0501040_0000832_9587_10993 | 415 |
| 11 | 3300049577 | Ga0501041_0006839 | Ga0501041_0006839_5182_6588 | 415 |
| 12 | 3300049582 | Ga0501048_0001234 | Ga0501048_0001234_15665_17071 | 415 |
| 13 | 3300049584 | Ga0501068_0001222 | Ga0501068_0001222_11930_13336 | 415 |
| 14 | 3300049586 | Ga0501070_0013626 | Ga0501070_0013626_1781_3187 | 415 |
| 15 | 3300049588 | Ga0501072_0002438 | Ga0501072_0002438_1789_3195 | 415 |
| 16 | 3300049589 | Ga0501073_0106623 | Ga0501073_0106623_138_1544 | 415 |
| 17 | 3300049590 | Ga0501074_0000224 | Ga0501074_0000224_18150_19556 | 415 |
| 18 | 3300049591 | Ga0501075_0001171 | Ga0501075_0001171_150_1556 | 415 |
| 19 | 3300049592 | Ga0501076_0001587 | Ga0501076_0001587_10737_12143 | 415 |
| 20 | 3300049593 | Ga0501077_0009822 | Ga0501077_0009822_2029_3435 | 415 |
| 21 | 3300049741 | Ga0501079_0001398 | Ga0501079_0001398_2002_3408 | 415 |
| 22 | 3300049742 | Ga0501080_0003252 | Ga0501080_0003252_10898_12304 | 415 |
| 23 | 3300049743 | Ga0501081_0003382 | Ga0501081_0003382_3189_4595 | 415 |
| 24 | 3300049824 | Ga0501045_0001152 | Ga0501045_0001152_13262_14668 | 415 |
| 25 | 3300054114 | Ga0501084_0001523 | Ga0501084_0001523_2099_3505 | 415 |
| 26 | 3300060353 | Ga0501082_0000243 | Ga0501082_0000243_24109_25515 | 415 |
| 27 | 3300061734 | Ga0530510_0001138 | Ga0530510_0001138_13262_14668 | 415 |
| 28 | 3300009147 | Ga0114129_10233089 | Ga0114129_102330892 | 416 |
| 29 | 3300050507 | nmdc:mga05p37_208119_c1 | nmdc:mga05p37_208119_c1_331_1740 | 416 |
| 30 | 3300050513 | nmdc:mga0rr50_27543_c1 | nmdc:mga0rr50_27543_c1_1814_3223 | 416 |
| 31 | 3300009098 | Ga0105245_10283097 | Ga0105245_102830971 | 417 |
| 32 | 3300009147 | Ga0114129_10001205 | Ga0114129_1000120534 | 417 |
| 33 | 3300050507 | nmdc:mga05p37_7480_c1 | nmdc:mga05p37_7480_c1_7452_8858 | 417 |
| 34 | 3300003203 | JGI25406J46586_10002349 | JGI25406J46586_100023497 | 421 |
| 35 | 3300005985 | Ga0081539_10000096 | Ga0081539_10000096104 | 421 |
| 36 | 3300035724 | Ga0373933_0106003 | Ga0373933_0106003_366_1739 | 421 |
| 37 | 3300003203 | JGI25406J46586_10000120 | JGI25406J46586_1000012014 | 422 |
| 38 | 3300005549 | Ga0070704_100161853 | Ga0070704_1001618532 | 422 |
| 39 | 3300005985 | Ga0081539_10000024 | Ga0081539_1000002441 | 422 |
| 40 | 3300006051 | Ga0075364_10015737 | Ga0075364_100157372 | 423 |
| 41 | 3300006177 | Ga0075362_10000233 | Ga0075362_100002332 | 423 |
| 42 | 3300006195 | Ga0075366_10009293 | Ga0075366_100092932 | 423 |
| 43 | 3300050489 | nmdc:mga03683_2028_c1 | nmdc:mga03683_2028_c1_2864_4264 | 423 |
| 44 | 3300050491 | nmdc:mga00v17_2153_c1 | nmdc:mga00v17_2153_c1_629_2029 | 423 |
| 45 | 3300050493 | nmdc:mga0k408_7123_c1 | nmdc:mga0k408_7123_c1_631_2031 | 423 |
| 46 | 3300027907 | Ga0207428_10188618 | Ga0207428_101886182 | 425 |
| 47 | 3300046558 | Ga0495633_0025371 | Ga0495633_0025371_1144_2592 | 425 |
| 48 | 3300046664 | Ga0495659_0003220 | Ga0495659_0003220_37_1485 | 425 |
| 49 | 3300050515 | nmdc:mga0a205_112429_c1 | nmdc:mga0a205_112429_c1_1234_2577 | 425 |
| 50 | 3300006847 | Ga0075431_100183036 | Ga0075431_1001830362 | 426 |
| 51 | 3300050507 | nmdc:mga05p37_250013_c1 | nmdc:mga05p37_250013_c1_669_2081 | 426 |
| 52 | 3300050510 | nmdc:mga06r32_174880_c1 | nmdc:mga06r32_174880_c1_85_1497 | 426 |
| 53 | 3300006195 | Ga0075366_10007412 | Ga0075366_100074126 | 428 |
| 54 | 3300006844 | Ga0075428_100168638 | Ga0075428_1001686382 | 428 |
| 55 | 3300006846 | Ga0075430_100007192 | Ga0075430_1000071929 | 428 |
| 56 | 3300009094 | Ga0111539_10001789 | Ga0111539_1000178913 | 428 |
| 57 | 3300027907 | Ga0207428_10000849 | Ga0207428_1000084922 | 428 |
| 58 | 3300045051 | Ga0451576_0181174 | Ga0451576_0181174_767_2179 | 428 |
| 59 | 3300046472 | Ga0495580_0000727 | Ga0495580_0000727_11374_12786 | 428 |
| 60 | 3300050493 | nmdc:mga0k408_19033_c1 | nmdc:mga0k408_19033_c1_556_1956 | 428 |
| 61 | 3300050511 | nmdc:mga08y16_24924_c1 | nmdc:mga08y16_24924_c1_3568_4983 | 428 |
| 62 | 3300006852 | Ga0075433_10000427 | Ga0075433_1000042719 | 430 |
| 63 | 3300006871 | Ga0075434_100000180 | Ga0075434_10000018019 | 430 |
| 64 | 3300006880 | Ga0075429_100002798 | Ga0075429_1000027988 | 430 |
| 65 | 3300009147 | Ga0114129_10000110 | Ga0114129_1000011032 | 430 |
| 66 | 3300049591 | Ga0501075_0093010 | Ga0501075_0093010_838_2259 | 430 |
| 67 | 3300049592 | Ga0501076_0029084 | Ga0501076_0029084_17_1438 | 430 |
| 68 | 3300050507 | nmdc:mga05p37_7406_c1 | nmdc:mga05p37_7406_c1_3851_5263 | 430 |
| 69 | 3300050508 | nmdc:mga09592_3878_c1 | nmdc:mga09592_3878_c1_4759_6171 | 430 |
| 70 | 3300050512 | nmdc:mga0n895_14004_c1 | nmdc:mga0n895_14004_c1_524_1936 | 430 |
| 71 | 3300050515 | nmdc:mga0a205_227_c1 | nmdc:mga0a205_227_c1_32943_34355 | 430 |
| 72 | 3300006852 | Ga0075433_10051244 | Ga0075433_100512445 | 431 |
| 73 | 3300046664 | Ga0495659_0019150 | Ga0495659_0019150_722_2134 | 431 |
| 74 | 3300049580 | Ga0501046_0033137 | Ga0501046_0033137_330_1736 | 431 |
| 75 | 3300049741 | Ga0501079_0085288 | Ga0501079_0085288_598_2004 | 431 |
| 76 | 3300049824 | Ga0501045_0019119 | Ga0501045_0019119_2122_3528 | 431 |
| 77 | 3300050507 | nmdc:mga05p37_70532_c1 | nmdc:mga05p37_70532_c1_757_2169 | 431 |
| 78 | 3300050515 | nmdc:mga0a205_17339_c1 | nmdc:mga0a205_17339_c1_804_2216 | 431 |
| 79 | 3300005347 | Ga0070668_100214214 | Ga0070668_1002142141 | 432 |
| 80 | 3300005445 | Ga0070708_100046013 | Ga0070708_1000460132 | 432 |
| 81 | 3300005518 | Ga0070699_100068977 | Ga0070699_1000689772 | 432 |
| 82 | 3300025972 | Ga0207668_10037148 | Ga0207668_100371483 | 432 |
| 83 | 3300042436 | Ga0439435_0002235 | Ga0439435_0002235_1706_3133 | 432 |
| 84 | 3300049824 | Ga0501045_0230241 | Ga0501045_0230241_20_1336 | 432 |
| 85 | 3300005329 | Ga0070683_100001902 | Ga0070683_10000190216 | 433 |
| 86 | 3300005330 | Ga0070690_100003636 | Ga0070690_1000036361 | 433 |
| 87 | 3300005335 | Ga0070666_10004927 | Ga0070666_100049272 | 433 |
| 88 | 3300005343 | Ga0070687_100000488 | Ga0070687_1000004884 | 433 |
| 89 | 3300005344 | Ga0070661_100015343 | Ga0070661_1000153434 | 433 |
| 90 | 3300005347 | Ga0070668_100001246 | Ga0070668_1000012462 | 433 |
| 91 | 3300005354 | Ga0070675_100167651 | Ga0070675_1001676512 | 433 |
| 92 | 3300005356 | Ga0070674_100010071 | Ga0070674_1000100715 | 433 |
| 93 | 3300005365 | Ga0070688_100099993 | Ga0070688_1000999932 | 433 |
| 94 | 3300005366 | Ga0070659_100002251 | Ga0070659_1000022512 | 433 |
| 95 | 3300005441 | Ga0070700_100039984 | Ga0070700_1000399842 | 433 |
| 96 | 3300005455 | Ga0070663_100051172 | Ga0070663_1000511722 | 433 |
| 97 | 3300005466 | Ga0070685_10000264 | Ga0070685_1000026413 | 433 |
| 98 | 3300005539 | Ga0068853_100015316 | Ga0068853_1000153163 | 433 |
| 99 | 3300005543 | Ga0070672_100002079 | Ga0070672_1000020793 | 433 |
| 100 | 3300005547 | Ga0070693_100009077 | Ga0070693_1000090772 | 433 |
| 101 | 3300005563 | Ga0068855_100000331 | Ga0068855_10000033155 | 433 |
| 102 | 3300005577 | Ga0068857_100000030 | Ga0068857_1000000305 | 433 |
| 103 | 3300005616 | Ga0068852_100000767 | Ga0068852_10000076720 | 433 |
| 104 | 3300005718 | Ga0068866_10000083 | Ga0068866_1000008320 | 433 |
| 105 | 3300005719 | Ga0068861_100000212 | Ga0068861_10000021229 | 433 |
| 106 | 3300005840 | Ga0068870_10000633 | Ga0068870_1000063310 | 433 |
| 107 | 3300005841 | Ga0068863_100004918 | Ga0068863_10000491813 | 433 |
| 108 | 3300005844 | Ga0068862_100002125 | Ga0068862_10000212518 | 433 |
| 109 | 3300006358 | Ga0068871_100018934 | Ga0068871_1000189343 | 433 |
| 110 | 3300009093 | Ga0105240_10006182 | Ga0105240_1000618217 | 433 |
| 111 | 3300009098 | Ga0105245_10000233 | Ga0105245_1000023323 | 433 |
| 112 | 3300009101 | Ga0105247_10057589 | Ga0105247_100575892 | 433 |
| 113 | 3300009176 | Ga0105242_10002855 | Ga0105242_1000285513 | 433 |
| 114 | 3300009545 | Ga0105237_10000549 | Ga0105237_1000054930 | 433 |
| 115 | 3300013100 | Ga0157373_10069753 | Ga0157373_100697532 | 433 |
| 116 | 3300013296 | Ga0157374_10223928 | Ga0157374_102239282 | 433 |
| 117 | 3300013297 | Ga0157378_10163632 | Ga0157378_101636322 | 433 |
| 118 | 3300013306 | Ga0163162_10055520 | Ga0163162_100555202 | 433 |
| 119 | 3300014745 | Ga0157377_10008351 | Ga0157377_100083513 | 433 |
| 120 | 3300014968 | Ga0157379_10000876 | Ga0157379_1000087623 | 433 |
| 121 | 3300014969 | Ga0157376_10000809 | Ga0157376_1000080915 | 433 |
| 122 | 3300025315 | Ga0207697_10004936 | Ga0207697_100049365 | 433 |
| 123 | 3300025321 | Ga0207656_10008015 | Ga0207656_100080153 | 433 |
| 124 | 3300025893 | Ga0207682_10000953 | Ga0207682_100009536 | 433 |
| 125 | 3300025900 | Ga0207710_10024134 | Ga0207710_100241342 | 433 |
| 126 | 3300025907 | Ga0207645_10000043 | Ga0207645_1000004358 | 433 |
| 127 | 3300025908 | Ga0207643_10000489 | Ga0207643_1000048923 | 433 |
| 128 | 3300025914 | Ga0207671_10004294 | Ga0207671_100042942 | 433 |
| 129 | 3300025918 | Ga0207662_10000043 | Ga0207662_1000004351 | 433 |
| 130 | 3300025919 | Ga0207657_10001235 | Ga0207657_1000123523 | 433 |
| 131 | 3300025924 | Ga0207694_10067456 | Ga0207694_100674562 | 433 |
| 132 | 3300025926 | Ga0207659_10000351 | Ga0207659_1000035123 | 433 |
| 133 | 3300025927 | Ga0207687_10014744 | Ga0207687_100147442 | 433 |
| 134 | 3300025932 | Ga0207690_10000823 | Ga0207690_1000082317 | 433 |
| 135 | 3300025933 | Ga0207706_10000162 | Ga0207706_1000016277 | 433 |
| 136 | 3300025940 | Ga0207691_10000053 | Ga0207691_1000005315 | 433 |
| 137 | 3300025941 | Ga0207711_10000276 | Ga0207711_100002762 | 433 |
| 138 | 3300025942 | Ga0207689_10000026 | Ga0207689_1000002669 | 433 |
| 139 | 3300025944 | Ga0207661_10031217 | Ga0207661_100312172 | 433 |
| 140 | 3300025960 | Ga0207651_10002705 | Ga0207651_100027054 | 433 |
| 141 | 3300025972 | Ga0207668_10046780 | Ga0207668_100467802 | 433 |
| 142 | 3300025981 | Ga0207640_10099415 | Ga0207640_100994152 | 433 |
| 143 | 3300025986 | Ga0207658_10001466 | Ga0207658_1000146614 | 433 |
| 144 | 3300026035 | Ga0207703_10000059 | Ga0207703_1000005955 | 433 |
| 145 | 3300026041 | Ga0207639_10032200 | Ga0207639_100322003 | 433 |
| 146 | 3300026067 | Ga0207678_10004271 | Ga0207678_100042712 | 433 |
| 147 | 3300026088 | Ga0207641_10012977 | Ga0207641_100129776 | 433 |
| 148 | 3300026089 | Ga0207648_10001530 | Ga0207648_100015303 | 433 |
| 149 | 3300026116 | Ga0207674_10001221 | Ga0207674_100012219 | 433 |
| 150 | 3300026118 | Ga0207675_100000233 | Ga0207675_10000023322 | 433 |
| 151 | 3300026121 | Ga0207683_10000624 | Ga0207683_100006249 | 433 |
| 152 | 3300028379 | Ga0268266_10001681 | Ga0268266_100016813 | 433 |
| 153 | 3300048909 | Ga0496106_0000637 | Ga0496106_0000637_1425_2885 | 433 |
| 154 | 3300048915 | Ga0496112_0012711 | Ga0496112_0012711_5641_7101 | 433 |
| 155 | 3300005983 | Ga0081540_1000146 | Ga0081540_100014618 | 435 |
| 156 | 3300006358 | Ga0068871_100152573 | Ga0068871_1001525732 | 436 |
| 157 | 3300007265 | Ga0099794_10021772 | Ga0099794_100217722 | 436 |
| 158 | 3300005290 | Ga0065712_10081843 | Ga0065712_100818431 | 437 |
| 159 | 3300048915 | Ga0496112_0073778 | Ga0496112_0073778_44_1474 | 437 |
| 160 | 3300050515 | nmdc:mga0a205_58581_c1 | nmdc:mga0a205_58581_c1_2338_3708 | 437 |
| 161 | 3300005341 | Ga0070691_10018250 | Ga0070691_100182503 | 438 |
| 162 | 3300005406 | Ga0070703_10003809 | Ga0070703_100038094 | 438 |
| 163 | 3300005444 | Ga0070694_100026892 | Ga0070694_1000268923 | 438 |
| 164 | 3300005518 | Ga0070699_100035333 | Ga0070699_1000353333 | 438 |
| 165 | 3300005546 | Ga0070696_100043193 | Ga0070696_1000431932 | 438 |
| 166 | 3300005577 | Ga0068857_100113601 | Ga0068857_1001136012 | 438 |
| 167 | 3300005843 | Ga0068860_100129469 | Ga0068860_1001294692 | 438 |
| 168 | 3300009176 | Ga0105242_10015305 | Ga0105242_100153052 | 438 |
| 169 | 3300009177 | Ga0105248_10323173 | Ga0105248_103231731 | 438 |
| 170 | 3300025885 | Ga0207653_10013704 | Ga0207653_100137041 | 438 |
| 171 | 3300025935 | Ga0207709_10074430 | Ga0207709_100744302 | 438 |
| 172 | 3300026116 | Ga0207674_10228190 | Ga0207674_102281902 | 438 |
| 173 | 3300050512 | nmdc:mga0n895_43435_c1 | nmdc:mga0n895_43435_c1_1426_2838 | 438 |
| 174 | 3300050513 | nmdc:mga0rr50_34073_c1 | nmdc:mga0rr50_34073_c1_199_1611 | 438 |
| 175 | 3300005719 | Ga0068861_100188320 | Ga0068861_1001883202 | 439 |
| 176 | 3300005985 | Ga0081539_10002353 | Ga0081539_1000235311 | 439 |
| 177 | 3300009094 | Ga0111539_10093292 | Ga0111539_100932922 | 439 |
| 178 | 3300009147 | Ga0114129_10031560 | Ga0114129_100315607 | 439 |
| 179 | 3300025926 | Ga0207659_10187184 | Ga0207659_101871841 | 439 |
| 180 | 3300026118 | Ga0207675_100236249 | Ga0207675_1002362492 | 439 |
| 181 | 3300027907 | Ga0207428_10042406 | Ga0207428_100424063 | 439 |
| 182 | 3300050508 | nmdc:mga09592_244269_c1 | nmdc:mga09592_244269_c1_51_1463 | 439 |
| 183 | 3300050511 | nmdc:mga08y16_52414_c1 | nmdc:mga08y16_52414_c1_654_2066 | 439 |
| 184 | 3300046684 | Ga0495669_0030073 | Ga0495669_0030073_576_1994 | 440 |
| 185 | 3300061734 | Ga0530510_0138480 | Ga0530510_0138480_341_1750 | 441 |
| 186 | 3300005617 | Ga0068859_100273956 | Ga0068859_1002739561 | 443 |
| 187 | 3300006931 | Ga0097620_100273969 | Ga0097620_1002739691 | 443 |
| 188 | 3300005356 | Ga0070674_100017360 | Ga0070674_1000173603 | 445 |
| 189 | 3300037068 | Ga0373925_0092635 | Ga0373925_0092635_553_2013 | 445 |
| 190 | 3300049571 | Ga0501034_0006093 | Ga0501034_0006093_8011_9432 | 445 |
| 191 | 3300049574 | Ga0501038_0054489 | Ga0501038_0054489_805_2214 | 445 |
| 192 | 3300049576 | Ga0501040_0015254 | Ga0501040_0015254_2985_4394 | 445 |
| 193 | 3300049577 | Ga0501041_0013389 | Ga0501041_0013389_1433_2842 | 445 |
| 194 | 3300049578 | Ga0501042_0006874 | Ga0501042_0006874_1003_2397 | 445 |
| 195 | 3300049588 | Ga0501072_0078538 | Ga0501072_0078538_506_1915 | 445 |
| 196 | 3300049741 | Ga0501079_0056218 | Ga0501079_0056218_1395_2804 | 445 |
| 197 | 3300049742 | Ga0501080_0162053 | Ga0501080_0162053_22_1431 | 445 |
| 198 | 3300049743 | Ga0501081_0011638 | Ga0501081_0011638_4300_5709 | 445 |
| 199 | 3300049824 | Ga0501045_0035209 | Ga0501045_0035209_1426_2835 | 445 |
| 200 | 3300060353 | Ga0501082_0005963 | Ga0501082_0005963_7127_8536 | 445 |
| 201 | 3300061734 | Ga0530510_0006581 | Ga0530510_0006581_2975_4384 | 445 |
| 202 | 3300005467 | Ga0070706_100006413 | Ga0070706_10000641314 | 446 |
| 203 | 3300005543 | Ga0070672_100019254 | Ga0070672_1000192543 | 446 |
| 204 | 3300006871 | Ga0075434_100066897 | Ga0075434_1000668972 | 446 |
| 205 | 3300025910 | Ga0207684_10043927 | Ga0207684_100439273 | 446 |
| 206 | 3300045051 | Ga0451576_0026087 | Ga0451576_0026087_2221_3681 | 446 |
| 207 | 3300050507 | nmdc:mga05p37_67675_c2 | nmdc:mga05p37_67675_c2_61_1401 | 446 |
| 208 | 3300050513 | nmdc:mga0rr50_7633_c1 | nmdc:mga0rr50_7633_c1_2799_4220 | 446 |
| 209 | 3300005353 | Ga0070669_100105021 | Ga0070669_1001050212 | 447 |
| 210 | 3300005364 | Ga0070673_100004953 | Ga0070673_1000049535 | 447 |
| 211 | 3300005367 | Ga0070667_100111783 | Ga0070667_1001117832 | 447 |
| 212 | 3300007076 | Ga0075435_100022605 | Ga0075435_1000226054 | 447 |
| 213 | 3300009551 | Ga0105238_10165024 | Ga0105238_101650241 | 447 |
| 214 | 3300010375 | Ga0105239_10071671 | Ga0105239_100716711 | 447 |
| 215 | 3300025901 | Ga0207688_10027388 | Ga0207688_100273882 | 447 |
| 216 | 3300025918 | Ga0207662_10000891 | Ga0207662_1000089114 | 447 |
| 217 | 3300025924 | Ga0207694_10103230 | Ga0207694_101032302 | 447 |
| 218 | 3300025960 | Ga0207651_10073549 | Ga0207651_100735491 | 447 |
| 219 | 3300049575 | Ga0501039_0072161 | Ga0501039_0072161_534_1937 | 447 |
| 220 | 3300049576 | Ga0501040_0047905 | Ga0501040_0047905_360_1763 | 447 |
| 221 | 3300049591 | Ga0501075_0055523 | Ga0501075_0055523_1327_2730 | 447 |
| 222 | 3300049592 | Ga0501076_0069071 | Ga0501076_0069071_622_2025 | 447 |
| 223 | 3300054114 | Ga0501084_0017452 | Ga0501084_0017452_3198_4601 | 447 |
| 224 | 3300006880 | Ga0075429_100099264 | Ga0075429_1000992642 | 448 |
| 225 | 3300009147 | Ga0114129_10117860 | Ga0114129_101178602 | 448 |
| 226 | 3300009147 | Ga0114129_10385374 | Ga0114129_103853742 | 448 |
| 227 | 3300035088 | Ga0373940_0001611 | Ga0373940_0001611_148_1560 | 448 |
| 228 | 3300035114 | Ga0373939_0016739 | Ga0373939_0016739_304_1716 | 448 |
| 229 | 3300050508 | nmdc:mga09592_17484_c1 | nmdc:mga09592_17484_c1_2855_4267 | 448 |
| 230 | 3300050509 | nmdc:mga0qj67_22405_c1 | nmdc:mga0qj67_22405_c1_355_1767 | 448 |
| 231 | 3300005354 | Ga0070675_100003563 | Ga0070675_1000035634 | 449 |
| 232 | 3300005543 | Ga0070672_100153097 | Ga0070672_1001530972 | 449 |
| 233 | 3300005840 | Ga0068870_10024726 | Ga0068870_100247263 | 449 |
| 234 | 3300005981 | Ga0081538_10003260 | Ga0081538_1000326014 | 449 |
| 235 | 3300025907 | Ga0207645_10028198 | Ga0207645_100281984 | 449 |
| 236 | 3300025908 | Ga0207643_10024053 | Ga0207643_100240533 | 449 |
| 237 | 3300025918 | Ga0207662_10003651 | Ga0207662_100036514 | 449 |
| 238 | 3300025923 | Ga0207681_10011598 | Ga0207681_100115984 | 449 |
| 239 | 3300026089 | Ga0207648_10003683 | Ga0207648_100036838 | 449 |
| 240 | 3300027907 | Ga0207428_10007736 | Ga0207428_100077363 | 449 |
| 241 | 3300049590 | Ga0501074_0164172 | Ga0501074_0164172_66_1481 | 449 |
| 242 | 3300050511 | nmdc:mga08y16_1306_c1 | nmdc:mga08y16_1306_c1_16782_18230 | 449 |
| 243 | 3300005844 | Ga0068862_100008232 | Ga0068862_10000823211 | 450 |
| 244 | 3300006852 | Ga0075433_10015829 | Ga0075433_100158294 | 450 |
| 245 | 3300009094 | Ga0111539_10000463 | Ga0111539_1000046351 | 450 |
| 246 | 3300027907 | Ga0207428_10000245 | Ga0207428_1000024542 | 450 |
| 247 | 3300042876 | Ga0451577_0006253 | Ga0451577_0006253_3144_4553 | 450 |
| 248 | 3300044712 | Ga0453684_0023625 | Ga0453684_0023625_5847_7256 | 450 |
| 249 | 3300045051 | Ga0451576_0004364 | Ga0451576_0004364_11446_12855 | 450 |
| 250 | 3300049572 | Ga0501036_0050451 | Ga0501036_0050451_1261_2748 | 450 |
| 251 | 3300049578 | Ga0501042_0014338 | Ga0501042_0014338_1909_3396 | 450 |
| 252 | 3300049743 | Ga0501081_0013942 | Ga0501081_0013942_2816_4303 | 450 |
| 253 | 3300049824 | Ga0501045_0039549 | Ga0501045_0039549_1633_3120 | 450 |
| 254 | 3300050511 | nmdc:mga08y16_597_c1 | nmdc:mga08y16_597_c1_17561_18970 | 450 |
| 255 | 3300050512 | nmdc:mga0n895_77660_c1 | nmdc:mga0n895_77660_c1_487_1896 | 450 |
| 256 | 3300050512 | nmdc:mga0n895_83684_c1 | nmdc:mga0n895_83684_c1_965_2392 | 450 |
| 257 | 3300050515 | nmdc:mga0a205_13783_c1 | nmdc:mga0a205_13783_c1_5170_6597 | 450 |
| 258 | 3300050515 | nmdc:mga0a205_1991_c1 | nmdc:mga0a205_1991_c1_5883_7292 | 450 |
| 259 | 3300061734 | Ga0530510_0022799 | Ga0530510_0022799_949_2436 | 450 |
| 260 | 3300005288 | Ga0065714_10071211 | Ga0065714_100712111 | 451 |
| 261 | 3300005290 | Ga0065712_10068087 | Ga0065712_100680875 | 451 |
| 262 | 3300005354 | Ga0070675_100012585 | Ga0070675_1000125855 | 451 |
| 263 | 3300006844 | Ga0075428_100015898 | Ga0075428_1000158983 | 451 |
| 264 | 3300006847 | Ga0075431_100022095 | Ga0075431_1000220956 | 451 |
| 265 | 3300009147 | Ga0114129_10025730 | Ga0114129_100257307 | 451 |
| 266 | 3300013308 | Ga0157375_10256242 | Ga0157375_102562421 | 451 |
| 267 | 3300025926 | Ga0207659_10031425 | Ga0207659_100314251 | 451 |
| 268 | 3300025933 | Ga0207706_10159902 | Ga0207706_101599021 | 451 |
| 269 | 3300045051 | Ga0451576_0045920 | Ga0451576_0045920_638_2059 | 451 |
| 270 | 3300050507 | nmdc:mga05p37_11414_c1 | nmdc:mga05p37_11414_c1_7531_8988 | 451 |
| 271 | 3300005344 | Ga0070661_100006598 | Ga0070661_1000065985 | 452 |
| 272 | 3300005564 | Ga0070664_100001341 | Ga0070664_10000134115 | 452 |
| 273 | 3300006846 | Ga0075430_100019149 | Ga0075430_1000191494 | 452 |
| 274 | 3300006847 | Ga0075431_100040956 | Ga0075431_1000409562 | 452 |
| 275 | 3300006847 | Ga0075431_100094758 | Ga0075431_1000947582 | 452 |
| 276 | 3300006880 | Ga0075429_100081107 | Ga0075429_1000811071 | 452 |
| 277 | 3300025920 | Ga0207649_10002015 | Ga0207649_1000201510 | 452 |
| 278 | 3300025925 | Ga0207650_10086341 | Ga0207650_100863412 | 452 |
| 279 | 3300025945 | Ga0207679_10000449 | Ga0207679_100004497 | 452 |
| 280 | 3300044712 | Ga0453684_0118568 | Ga0453684_0118568_692_2152 | 452 |
| 281 | 3300047319 | Ga0495674_0088115 | Ga0495674_0088115_321_1742 | 452 |
| 282 | 3300049571 | Ga0501034_0190474 | Ga0501034_0190474_355_1773 | 452 |
| 283 | 3300049578 | Ga0501042_0157396 | Ga0501042_0157396_162_1571 | 452 |
| 284 | 3300049582 | Ga0501048_0083670 | Ga0501048_0083670_783_2198 | 452 |
| 285 | 3300049591 | Ga0501075_0007121 | Ga0501075_0007121_5504_6919 | 452 |
| 286 | 3300049741 | Ga0501079_0011415 | Ga0501079_0011415_3359_4774 | 452 |
| 287 | 3300049743 | Ga0501081_0151553 | Ga0501081_0151553_158_1567 | 452 |
| 288 | 3300050509 | nmdc:mga0qj67_54944_c1 | nmdc:mga0qj67_54944_c1_867_2330 | 452 |
| 289 | 3300050510 | nmdc:mga06r32_71500_c1 | nmdc:mga06r32_71500_c1_1094_2503 | 452 |
| 290 | 3300050510 | nmdc:mga06r32_89056_c1 | nmdc:mga06r32_89056_c1_405_1868 | 452 |
| 291 | 3300050511 | nmdc:mga08y16_201006_c1 | nmdc:mga08y16_201006_c1_571_2031 | 452 |
| 292 | 3300005334 | Ga0068869_100063299 | Ga0068869_1000632991 | 453 |
| 293 | 3300005467 | Ga0070706_100042411 | Ga0070706_1000424112 | 453 |
| 294 | 3300005471 | Ga0070698_100016413 | Ga0070698_1000164138 | 453 |
| 295 | 3300005518 | Ga0070699_100008791 | Ga0070699_1000087919 | 453 |
| 296 | 3300005536 | Ga0070697_100042024 | Ga0070697_1000420243 | 453 |
| 297 | 3300006173 | Ga0070716_100056184 | Ga0070716_1000561842 | 453 |
| 298 | 3300006852 | Ga0075433_10002893 | Ga0075433_100028932 | 453 |
| 299 | 3300009147 | Ga0114129_10128039 | Ga0114129_101280392 | 453 |
| 300 | 3300009147 | Ga0114129_10132239 | Ga0114129_101322392 | 453 |
| 301 | 3300025910 | Ga0207684_10011947 | Ga0207684_100119477 | 453 |
| 302 | 3300025910 | Ga0207684_10023037 | Ga0207684_100230374 | 453 |
| 303 | 3300025939 | Ga0207665_10007130 | Ga0207665_100071307 | 453 |
| 304 | 3300031548 | Ga0307408_100058337 | Ga0307408_1000583372 | 453 |
| 305 | 3300050507 | nmdc:mga05p37_174216_c1 | nmdc:mga05p37_174216_c1_682_2160 | 453 |
| 306 | 3300050512 | nmdc:mga0n895_57467_c1 | nmdc:mga0n895_57467_c1_639_2066 | 453 |
| 307 | 3300050514 | nmdc:mga08x19_17737_c1 | nmdc:mga08x19_17737_c1_2144_3571 | 453 |
| 308 | 3300050515 | nmdc:mga0a205_11142_c1 | nmdc:mga0a205_11142_c1_1770_3197 | 453 |
| 309 | 3300005546 | Ga0070696_100038365 | Ga0070696_1000383652 | 454 |
| 310 | 3300005844 | Ga0068862_100093277 | Ga0068862_1000932772 | 454 |
| 311 | 3300009094 | Ga0111539_10001292 | Ga0111539_1000129230 | 454 |
| 312 | 3300027907 | Ga0207428_10023843 | Ga0207428_100238433 | 454 |
| 313 | 3300005341 | Ga0070691_10022284 | Ga0070691_100222842 | 455 |
| 314 | 3300005354 | Ga0070675_100007060 | Ga0070675_1000070605 | 455 |
| 315 | 3300005364 | Ga0070673_100081131 | Ga0070673_1000811312 | 455 |
| 316 | 3300005444 | Ga0070694_100015289 | Ga0070694_1000152895 | 455 |
| 317 | 3300005518 | Ga0070699_100003941 | Ga0070699_1000039411 | 455 |
| 318 | 3300005545 | Ga0070695_100000112 | Ga0070695_10000011214 | 455 |
| 319 | 3300005546 | Ga0070696_100017675 | Ga0070696_1000176755 | 455 |
| 320 | 3300005577 | Ga0068857_100231573 | Ga0068857_1002315731 | 455 |
| 321 | 3300006852 | Ga0075433_10000839 | Ga0075433_1000083921 | 455 |
| 322 | 3300006871 | Ga0075434_100001347 | Ga0075434_10000134720 | 455 |
| 323 | 3300007076 | Ga0075435_100062337 | Ga0075435_1000623372 | 455 |
| 324 | 3300009176 | Ga0105242_10023761 | Ga0105242_100237615 | 455 |
| 325 | 3300025926 | Ga0207659_10166067 | Ga0207659_101660671 | 455 |
| 326 | 3300025934 | Ga0207686_10064513 | Ga0207686_100645132 | 455 |
| 327 | 3300025960 | Ga0207651_10102406 | Ga0207651_101024062 | 455 |
| 328 | 3300026118 | Ga0207675_100069969 | Ga0207675_1000699692 | 455 |
| 329 | 3300042436 | Ga0439435_0004587 | Ga0439435_0004587_65_1480 | 455 |
| 330 | 3300046459 | Ga0495629_0016857 | Ga0495629_0016857_2368_3795 | 455 |
| 331 | 3300050512 | nmdc:mga0n895_477_c1 | nmdc:mga0n895_477_c1_4580_6007 | 455 |
| 332 | 3300050513 | nmdc:mga0rr50_35406_c1 | nmdc:mga0rr50_35406_c1_937_2364 | 455 |
| 333 | 3300050515 | nmdc:mga0a205_646_c1 | nmdc:mga0a205_646_c1_12796_14223 | 455 |
| 334 | 3300006846 | Ga0075430_100045970 | Ga0075430_1000459701 | 456 |
| 335 | 3300006880 | Ga0075429_100045702 | Ga0075429_1000457022 | 456 |
| 336 | 3300007265 | Ga0099794_10046698 | Ga0099794_100466981 | 456 |
| 337 | 3300044712 | Ga0453684_0272065 | Ga0453684_0272065_20_1390 | 456 |
| 338 | 3300046559 | Ga0495667_0000367 | Ga0495667_0000367_19887_21305 | 456 |
| 339 | 3300050508 | nmdc:mga09592_28662_c1 | nmdc:mga09592_28662_c1_1937_3355 | 456 |
| 340 | 3300050514 | nmdc:mga08x19_57107_c1 | nmdc:mga08x19_57107_c1_736_2169 | 456 |
| 341 | 3300005295 | Ga0065707_10136991 | Ga0065707_101369912 | 457 |
| 342 | 3300005338 | Ga0068868_100078630 | Ga0068868_1000786302 | 457 |
| 343 | 3300005457 | Ga0070662_100055135 | Ga0070662_1000551352 | 457 |
| 344 | 3300005467 | Ga0070706_100039995 | Ga0070706_1000399953 | 457 |
| 345 | 3300005471 | Ga0070698_100296282 | Ga0070698_1002962822 | 457 |
| 346 | 3300005518 | Ga0070699_100038913 | Ga0070699_1000389132 | 457 |
| 347 | 3300025922 | Ga0207646_10062784 | Ga0207646_100627843 | 457 |
| 348 | 3300025933 | Ga0207706_10041882 | Ga0207706_100418824 | 457 |
| 349 | 3300026023 | Ga0207677_10145629 | Ga0207677_101456292 | 457 |
| 350 | 3300049588 | Ga0501072_0132229 | Ga0501072_0132229_96_1505 | 457 |
| 351 | 3300050508 | nmdc:mga09592_48767_c1 | nmdc:mga09592_48767_c1_1047_2462 | 457 |
| 352 | 3300005354 | Ga0070675_100131236 | Ga0070675_1001312361 | 458 |
| 353 | 3300006038 | Ga0075365_10022819 | Ga0075365_100228192 | 458 |
| 354 | 3300006353 | Ga0075370_10066752 | Ga0075370_100667521 | 458 |
| 355 | 3300006871 | Ga0075434_100010601 | Ga0075434_1000106013 | 458 |
| 356 | 3300007076 | Ga0075435_100048550 | Ga0075435_1000485502 | 458 |
| 357 | 3300009094 | Ga0111539_10053095 | Ga0111539_100530952 | 458 |
| 358 | 3300049582 | Ga0501048_0024994 | Ga0501048_0024994_2791_4218 | 458 |
| 359 | 3300050512 | nmdc:mga0n895_1895_c1 | nmdc:mga0n895_1895_c1_1367_2848 | 458 |
| 360 | 3300050515 | nmdc:mga0a205_133836_c1 | nmdc:mga0a205_133836_c1_525_2006 | 458 |
| 361 | 3300061734 | Ga0530510_0047130 | Ga0530510_0047130_1155_2582 | 458 |
| 362 | 3300005290 | Ga0065712_10002361 | Ga0065712_100023612 | 460 |
| 363 | 3300005293 | Ga0065715_10002974 | Ga0065715_100029743 | 460 |
| 364 | 3300005329 | Ga0070683_100145792 | Ga0070683_1001457921 | 460 |
| 365 | 3300005331 | Ga0070670_100097543 | Ga0070670_1000975431 | 460 |
| 366 | 3300005343 | Ga0070687_100012791 | Ga0070687_1000127912 | 460 |
| 367 | 3300006358 | Ga0068871_100167268 | Ga0068871_1001672681 | 460 |
| 368 | 3300006844 | Ga0075428_100059134 | Ga0075428_1000591341 | 460 |
| 369 | 3300006847 | Ga0075431_100188110 | Ga0075431_1001881102 | 460 |
| 370 | 3300006881 | Ga0068865_100159805 | Ga0068865_1001598052 | 460 |
| 371 | 3300009094 | Ga0111539_10031709 | Ga0111539_100317096 | 460 |
| 372 | 3300009147 | Ga0114129_10127799 | Ga0114129_101277992 | 460 |
| 373 | 3300025893 | Ga0207682_10016474 | Ga0207682_100164744 | 460 |
| 374 | 3300025940 | Ga0207691_10063428 | Ga0207691_100634283 | 460 |
| 375 | 3300025944 | Ga0207661_10031757 | Ga0207661_100317573 | 460 |
| 376 | 3300026089 | Ga0207648_10039622 | Ga0207648_100396223 | 460 |
| 377 | 3300050511 | nmdc:mga08y16_11754_c1 | nmdc:mga08y16_11754_c1_2887_4308 | 460 |
| 378 | 3300009147 | Ga0114129_10061418 | Ga0114129_100614185 | 461 |
| 379 | 3300005335 | Ga0070666_10035192 | Ga0070666_100351922 | 462 |
| 380 | 3300005338 | Ga0068868_100082588 | Ga0068868_1000825882 | 462 |
| 381 | 3300005366 | Ga0070659_100061265 | Ga0070659_1000612652 | 462 |
| 382 | 3300005441 | Ga0070700_100182237 | Ga0070700_1001822371 | 462 |
| 383 | 3300005456 | Ga0070678_100053178 | Ga0070678_1000531781 | 462 |
| 384 | 3300005459 | Ga0068867_100006014 | Ga0068867_1000060146 | 462 |
| 385 | 3300005539 | Ga0068853_100144928 | Ga0068853_1001449282 | 462 |
| 386 | 3300005547 | Ga0070693_100008457 | Ga0070693_1000084572 | 462 |
| 387 | 3300005842 | Ga0068858_100209763 | Ga0068858_1002097632 | 462 |
| 388 | 3300005983 | Ga0081540_1010521 | Ga0081540_10105213 | 462 |
| 389 | 3300009094 | Ga0111539_10022315 | Ga0111539_100223153 | 462 |
| 390 | 3300009098 | Ga0105245_10141866 | Ga0105245_101418661 | 462 |
| 391 | 3300009147 | Ga0114129_10101502 | Ga0114129_101015021 | 462 |
| 392 | 3300009174 | Ga0105241_10069582 | Ga0105241_100695822 | 462 |
| 393 | 3300009176 | Ga0105242_10007792 | Ga0105242_100077922 | 462 |
| 394 | 3300025907 | Ga0207645_10016127 | Ga0207645_100161272 | 462 |
| 395 | 3300025927 | Ga0207687_10079611 | Ga0207687_100796112 | 462 |
| 396 | 3300025935 | Ga0207709_10116300 | Ga0207709_101163001 | 462 |
| 397 | 3300026023 | Ga0207677_10039272 | Ga0207677_100392722 | 462 |
| 398 | 3300026041 | Ga0207639_10119734 | Ga0207639_101197342 | 462 |
| 399 | 3300026075 | Ga0207708_10012567 | Ga0207708_100125674 | 462 |
| 400 | 3300026089 | Ga0207648_10012239 | Ga0207648_100122393 | 462 |
| 401 | 3300026118 | Ga0207675_100016025 | Ga0207675_1000160252 | 462 |
| 402 | 3300037418 | Ga0395900_0002273 | Ga0395900_0002273_13481_14896 | 462 |
| 403 | 3300037466 | Ga0395898_0005721 | Ga0395898_0005721_1785_3200 | 462 |
| 404 | 3300038443 | Ga0395901_0021074 | Ga0395901_0021074_2050_3465 | 462 |
| 405 | 3300050511 | nmdc:mga08y16_31120_c1 | nmdc:mga08y16_31120_c1_3618_5057 | 462 |
| 406 | 3300050513 | nmdc:mga0rr50_109889_c1 | nmdc:mga0rr50_109889_c1_70_1602 | 462 |
| 407 | 3300006871 | Ga0075434_100060934 | Ga0075434_1000609342 | 463 |
| 408 | 3300026121 | Ga0207683_10045698 | Ga0207683_100456983 | 463 |
| 409 | 3300042876 | Ga0451577_0002796 | Ga0451577_0002796_2719_4128 | 463 |
| 410 | 3300005356 | Ga0070674_100000988 | Ga0070674_10000098810 | 464 |
| 411 | 3300014326 | Ga0157380_10001243 | Ga0157380_1000124311 | 464 |
| 412 | 3300026116 | Ga0207674_10121570 | Ga0207674_101215702 | 464 |
| 413 | 3300005445 | Ga0070708_100040319 | Ga0070708_1000403192 | 465 |
| 414 | 3300005467 | Ga0070706_100061910 | Ga0070706_1000619102 | 465 |
| 415 | 3300042993 | Ga0439440_0009806 | Ga0439440_0009806_371_1813 | 465 |
| 416 | 3300049576 | Ga0501040_0156538 | Ga0501040_0156538_193_1590 | 465 |
| 417 | 3300005295 | Ga0065707_10002595 | Ga0065707_100025951 | 466 |
| 418 | 3300005330 | Ga0070690_100034765 | Ga0070690_1000347654 | 466 |
| 419 | 3300005331 | Ga0070670_100226873 | Ga0070670_1002268732 | 466 |
| 420 | 3300005340 | Ga0070689_100016519 | Ga0070689_1000165194 | 466 |
| 421 | 3300005577 | Ga0068857_100030695 | Ga0068857_1000306952 | 466 |
| 422 | 3300005840 | Ga0068870_10011935 | Ga0068870_100119352 | 466 |
| 423 | 3300005843 | Ga0068860_100031285 | Ga0068860_1000312852 | 466 |
| 424 | 3300009094 | Ga0111539_10128670 | Ga0111539_101286703 | 466 |
| 425 | 3300025908 | Ga0207643_10015996 | Ga0207643_100159962 | 466 |
| 426 | 3300025940 | Ga0207691_10007695 | Ga0207691_100076953 | 466 |
| 427 | 3300025942 | Ga0207689_10111208 | Ga0207689_101112082 | 466 |
| 428 | 3300025960 | Ga0207651_10166804 | Ga0207651_101668041 | 466 |
| 429 | 3300026035 | Ga0207703_10016319 | Ga0207703_100163192 | 466 |
| 430 | 3300028381 | Ga0268264_10003233 | Ga0268264_100032332 | 466 |
| 431 | 3300006847 | Ga0075431_100000486 | Ga0075431_1000004863 | 469 |
| 432 | 3300027907 | Ga0207428_10000027 | Ga0207428_10000027200 | 469 |
| 433 | 3300046516 | Ga0495628_0055710 | Ga0495628_0055710_1226_2644 | 469 |
| 434 | 3300049576 | Ga0501040_0002340 | Ga0501040_0002340_63_1472 | 469 |
| 435 | 3300050510 | nmdc:mga06r32_1744_c1 | nmdc:mga06r32_1744_c1_17079_18488 | 469 |
| 436 | 3300050511 | nmdc:mga08y16_17787_c1 | nmdc:mga08y16_17787_c1_5976_7388 | 469 |
| 437 | 3300050512 | nmdc:mga0n895_60869_c1 | nmdc:mga0n895_60869_c1_98_1507 | 469 |
| 438 | 3300005444 | Ga0070694_100026765 | Ga0070694_1000267651 | 470 |
| 439 | 3300005841 | Ga0068863_100030248 | Ga0068863_1000302485 | 470 |
| 440 | 3300006175 | Ga0070712_100003836 | Ga0070712_1000038367 | 470 |
| 441 | 3300006847 | Ga0075431_100000082 | Ga0075431_1000000828 | 470 |
| 442 | 3300006852 | Ga0075433_10132597 | Ga0075433_101325972 | 470 |
| 443 | 3300006871 | Ga0075434_100327389 | Ga0075434_1003273892 | 470 |
| 444 | 3300006914 | Ga0075436_100018788 | Ga0075436_1000187886 | 470 |
| 445 | 3300009147 | Ga0114129_10001511 | Ga0114129_100015116 | 470 |
| 446 | 3300025915 | Ga0207693_10006943 | Ga0207693_100069437 | 470 |
| 447 | 3300025916 | Ga0207663_10018254 | Ga0207663_100182543 | 470 |
| 448 | 3300042876 | Ga0451577_0053635 | Ga0451577_0053635_445_1860 | 470 |
| 449 | 3300045051 | Ga0451576_0065829 | Ga0451576_0065829_1061_2473 | 470 |
| 450 | 3300046455 | Ga0495603_0017434 | Ga0495603_0017434_1156_2610 | 470 |
| 451 | 3300049588 | Ga0501072_0027727 | Ga0501072_0027727_1683_3098 | 470 |
| 452 | 3300049593 | Ga0501077_0080278 | Ga0501077_0080278_625_2040 | 470 |
| 453 | 3300050507 | nmdc:mga05p37_19057_c1 | nmdc:mga05p37_19057_c1_5668_7158 | 470 |
| 454 | 3300050510 | nmdc:mga06r32_7977_c1 | nmdc:mga06r32_7977_c1_6454_7869 | 470 |
| 455 | 3300050515 | nmdc:mga0a205_139255_c1 | nmdc:mga0a205_139255_c1_631_2121 | 470 |
| 456 | 3300061734 | Ga0530510_0057599 | Ga0530510_0057599_481_1896 | 470 |
| 457 | 3300006852 | Ga0075433_10087738 | Ga0075433_100877382 | 471 |
| 458 | 3300009094 | Ga0111539_10002439 | Ga0111539_1000243919 | 471 |
| 459 | 3300009147 | Ga0114129_10073338 | Ga0114129_100733384 | 471 |
| 460 | 3300027907 | Ga0207428_10005064 | Ga0207428_1000506410 | 471 |
| 461 | 3300031731 | Ga0307405_10074946 | Ga0307405_100749461 | 471 |
| 462 | 3300032002 | Ga0307416_100122713 | Ga0307416_1001227131 | 471 |
| 463 | 3300046615 | Ga0495656_0064340 | Ga0495656_0064340_60_1481 | 471 |
| 464 | 3300049581 | Ga0501047_0221891 | Ga0501047_0221891_83_1504 | 471 |
| 465 | 3300050511 | nmdc:mga08y16_2919_c1 | nmdc:mga08y16_2919_c1_9137_10555 | 471 |
| 466 | 3300050515 | nmdc:mga0a205_196715_c1 | nmdc:mga0a205_196715_c1_378_1796 | 471 |
| 467 | 3300005328 | Ga0070676_10002255 | Ga0070676_100022553 | 472 |
| 468 | 3300005331 | Ga0070670_100004978 | Ga0070670_1000049783 | 472 |
| 469 | 3300005334 | Ga0068869_100001496 | Ga0068869_1000014964 | 472 |
| 470 | 3300005336 | Ga0070680_100002109 | Ga0070680_10000210910 | 472 |
| 471 | 3300005337 | Ga0070682_100000365 | Ga0070682_1000003652 | 472 |
| 472 | 3300005339 | Ga0070660_100018271 | Ga0070660_1000182713 | 472 |
| 473 | 3300005340 | Ga0070689_100026025 | Ga0070689_1000260254 | 472 |
| 474 | 3300005341 | Ga0070691_10014935 | Ga0070691_100149352 | 472 |
| 475 | 3300005343 | Ga0070687_100005532 | Ga0070687_1000055323 | 472 |
| 476 | 3300005344 | Ga0070661_100002514 | Ga0070661_1000025143 | 472 |
| 477 | 3300005345 | Ga0070692_10001897 | Ga0070692_100018978 | 472 |
| 478 | 3300005366 | Ga0070659_100001505 | Ga0070659_10000150519 | 472 |
| 479 | 3300005444 | Ga0070694_100000345 | Ga0070694_1000003455 | 472 |
| 480 | 3300005445 | Ga0070708_100071343 | Ga0070708_1000713433 | 472 |
| 481 | 3300005455 | Ga0070663_100001711 | Ga0070663_10000171112 | 472 |
| 482 | 3300005457 | Ga0070662_100059219 | Ga0070662_1000592192 | 472 |
| 483 | 3300005459 | Ga0068867_100007131 | Ga0068867_1000071318 | 472 |
| 484 | 3300005468 | Ga0070707_100010381 | Ga0070707_1000103816 | 472 |
| 485 | 3300005535 | Ga0070684_100046398 | Ga0070684_1000463982 | 472 |
| 486 | 3300005539 | Ga0068853_100010976 | Ga0068853_1000109767 | 472 |
| 487 | 3300005546 | Ga0070696_100004871 | Ga0070696_1000048712 | 472 |
| 488 | 3300005547 | Ga0070693_100000189 | Ga0070693_10000018930 | 472 |
| 489 | 3300005563 | Ga0068855_100015855 | Ga0068855_1000158558 | 472 |
| 490 | 3300005614 | Ga0068856_100000923 | Ga0068856_1000009233 | 472 |
| 491 | 3300005618 | Ga0068864_100017773 | Ga0068864_1000177735 | 472 |
| 492 | 3300005834 | Ga0068851_10038131 | Ga0068851_100381313 | 472 |
| 493 | 3300005840 | Ga0068870_10005126 | Ga0068870_100051263 | 472 |
| 494 | 3300005841 | Ga0068863_100046577 | Ga0068863_1000465773 | 472 |
| 495 | 3300005843 | Ga0068860_100042597 | Ga0068860_1000425972 | 472 |
| 496 | 3300005844 | Ga0068862_100016417 | Ga0068862_1000164173 | 472 |
| 497 | 3300006871 | Ga0075434_100022413 | Ga0075434_1000224131 | 472 |
| 498 | 3300007076 | Ga0075435_100039959 | Ga0075435_1000399592 | 472 |
| 499 | 3300009174 | Ga0105241_10001410 | Ga0105241_1000141016 | 472 |
| 500 | 3300013105 | Ga0157369_10017116 | Ga0157369_100171163 | 472 |
| 501 | 3300013307 | Ga0157372_10008010 | Ga0157372_100080108 | 472 |
| 502 | 3300025907 | Ga0207645_10000400 | Ga0207645_1000040010 | 472 |
| 503 | 3300025908 | Ga0207643_10000424 | Ga0207643_1000042427 | 472 |
| 504 | 3300025910 | Ga0207684_10113773 | Ga0207684_101137732 | 472 |
| 505 | 3300025911 | Ga0207654_10010692 | Ga0207654_100106922 | 472 |
| 506 | 3300025912 | Ga0207707_10000116 | Ga0207707_1000011626 | 472 |
| 507 | 3300025918 | Ga0207662_10007198 | Ga0207662_100071985 | 472 |
| 508 | 3300025919 | Ga0207657_10000211 | Ga0207657_1000021137 | 472 |
| 509 | 3300025920 | Ga0207649_10006395 | Ga0207649_100063953 | 472 |
| 510 | 3300025921 | Ga0207652_10003841 | Ga0207652_1000384112 | 472 |
| 511 | 3300025922 | Ga0207646_10027940 | Ga0207646_100279403 | 472 |
| 512 | 3300025923 | Ga0207681_10008695 | Ga0207681_100086956 | 472 |
| 513 | 3300025925 | Ga0207650_10135932 | Ga0207650_101359321 | 472 |
| 514 | 3300025932 | Ga0207690_10001495 | Ga0207690_100014953 | 472 |
| 515 | 3300025933 | Ga0207706_10004021 | Ga0207706_100040218 | 472 |
| 516 | 3300025936 | Ga0207670_10048949 | Ga0207670_100489494 | 472 |
| 517 | 3300025941 | Ga0207711_10105861 | Ga0207711_101058612 | 472 |
| 518 | 3300025942 | Ga0207689_10000201 | Ga0207689_1000020126 | 472 |
| 519 | 3300025945 | Ga0207679_10006771 | Ga0207679_100067715 | 472 |
| 520 | 3300025949 | Ga0207667_10002107 | Ga0207667_100021073 | 472 |
| 521 | 3300026041 | Ga0207639_10004331 | Ga0207639_100043318 | 472 |
| 522 | 3300026078 | Ga0207702_10001143 | Ga0207702_100011434 | 472 |
| 523 | 3300026088 | Ga0207641_10025232 | Ga0207641_100252323 | 472 |
| 524 | 3300026089 | Ga0207648_10012060 | Ga0207648_100120608 | 472 |
| 525 | 3300026116 | Ga0207674_10000951 | Ga0207674_100009518 | 472 |
| 526 | 3300028380 | Ga0268265_10005618 | Ga0268265_100056182 | 472 |
| 527 | 3300035088 | Ga0373940_0013102 | Ga0373940_0013102_74_1495 | 472 |
| 528 | 3300035090 | Ga0373949_0007232 | Ga0373949_0007232_144_1565 | 472 |
| 529 | 3300035114 | Ga0373939_0007541 | Ga0373939_0007541_895_2316 | 472 |
| 530 | 3300035241 | Ga0373961_0007741 | Ga0373961_0007741_1150_2571 | 472 |
| 531 | 3300042438 | Ga0439459_0000110 | Ga0439459_0000110_4871_6292 | 472 |
| 532 | 3300044712 | Ga0453684_0058416 | Ga0453684_0058416_3445_4866 | 472 |
| 533 | 3300045051 | Ga0451576_0005764 | Ga0451576_0005764_2232_3653 | 472 |
| 534 | 3300050512 | nmdc:mga0n895_53201_c1 | nmdc:mga0n895_53201_c1_1683_3104 | 472 |
| 535 | 3300005444 | Ga0070694_100073558 | Ga0070694_1000735582 | 473 |
| 536 | 3300005545 | Ga0070695_100029138 | Ga0070695_1000291382 | 473 |
| 537 | 3300005546 | Ga0070696_100040971 | Ga0070696_1000409712 | 473 |
| 538 | 3300005718 | Ga0068866_10054606 | Ga0068866_100546062 | 473 |
| 539 | 3300006844 | Ga0075428_100004648 | Ga0075428_10000464815 | 473 |
| 540 | 3300006846 | Ga0075430_100039626 | Ga0075430_1000396261 | 473 |
| 541 | 3300006847 | Ga0075431_100001687 | Ga0075431_10000168721 | 473 |
| 542 | 3300006871 | Ga0075434_100040271 | Ga0075434_1000402716 | 473 |
| 543 | 3300025941 | Ga0207711_10247569 | Ga0207711_102475691 | 473 |
| 544 | 3300050508 | nmdc:mga09592_190943_c1 | nmdc:mga09592_190943_c1_147_1589 | 473 |
| 545 | 3300050509 | nmdc:mga0qj67_7809_c1 | nmdc:mga0qj67_7809_c1_6292_7734 | 473 |
| 546 | 3300050510 | nmdc:mga06r32_39458_c1 | nmdc:mga06r32_39458_c1_146_1588 | 473 |
| 547 | 3300050512 | nmdc:mga0n895_24005_c1 | nmdc:mga0n895_24005_c1_1395_2819 | 473 |
| 548 | 3300005328 | Ga0070676_10037385 | Ga0070676_100373851 | 474 |
| 549 | 3300005334 | Ga0068869_100002011 | Ga0068869_1000020119 | 474 |
| 550 | 3300005444 | Ga0070694_100006735 | Ga0070694_1000067353 | 474 |
| 551 | 3300005444 | Ga0070694_100011586 | Ga0070694_1000115862 | 474 |
| 552 | 3300005445 | Ga0070708_100085474 | Ga0070708_1000854742 | 474 |
| 553 | 3300005457 | Ga0070662_100026986 | Ga0070662_1000269863 | 474 |
| 554 | 3300005459 | Ga0068867_100052159 | Ga0068867_1000521592 | 474 |
| 555 | 3300005467 | Ga0070706_100003928 | Ga0070706_1000039282 | 474 |
| 556 | 3300005467 | Ga0070706_100137563 | Ga0070706_1001375632 | 474 |
| 557 | 3300005468 | Ga0070707_100001862 | Ga0070707_10000186223 | 474 |
| 558 | 3300005468 | Ga0070707_100149336 | Ga0070707_1001493362 | 474 |
| 559 | 3300005471 | Ga0070698_100049291 | Ga0070698_1000492913 | 474 |
| 560 | 3300005518 | Ga0070699_100005248 | Ga0070699_1000052487 | 474 |
| 561 | 3300005536 | Ga0070697_100054351 | Ga0070697_1000543512 | 474 |
| 562 | 3300005545 | Ga0070695_100042978 | Ga0070695_1000429781 | 474 |
| 563 | 3300005546 | Ga0070696_100021801 | Ga0070696_1000218014 | 474 |
| 564 | 3300005549 | Ga0070704_100056342 | Ga0070704_1000563422 | 474 |
| 565 | 3300005549 | Ga0070704_100067970 | Ga0070704_1000679702 | 474 |
| 566 | 3300005937 | Ga0081455_10000868 | Ga0081455_100008683 | 474 |
| 567 | 3300009098 | Ga0105245_10109242 | Ga0105245_101092422 | 474 |
| 568 | 3300025910 | Ga0207684_10003777 | Ga0207684_1000377710 | 474 |
| 569 | 3300025910 | Ga0207684_10058826 | Ga0207684_100588263 | 474 |
| 570 | 3300025922 | Ga0207646_10006951 | Ga0207646_100069517 | 474 |
| 571 | 3300025922 | Ga0207646_10123365 | Ga0207646_101233652 | 474 |
| 572 | 3300025927 | Ga0207687_10064136 | Ga0207687_100641362 | 474 |
| 573 | 3300025933 | Ga0207706_10020893 | Ga0207706_100208932 | 474 |
| 574 | 3300025942 | Ga0207689_10006142 | Ga0207689_1000614212 | 474 |
| 575 | 3300027360 | Ga0209969_1001359 | Ga0209969_10013593 | 474 |
| 576 | 3300027424 | Ga0209984_1000634 | Ga0209984_10006343 | 474 |
| 577 | 3300027526 | Ga0209968_1000573 | Ga0209968_10005735 | 474 |
| 578 | 3300027614 | Ga0209970_1000407 | Ga0209970_10004072 | 474 |
| 579 | 3300027682 | Ga0209971_1000037 | Ga0209971_100003742 | 474 |
| 580 | 3300027695 | Ga0209966_1000378 | Ga0209966_10003786 | 474 |
| 581 | 3300027717 | Ga0209998_10000042 | Ga0209998_1000004214 | 474 |
| 582 | 3300027876 | Ga0209974_10000465 | Ga0209974_100004652 | 474 |
| 583 | 3300028380 | Ga0268265_10061875 | Ga0268265_100618752 | 474 |
| 584 | 3300042005 | Ga0439448_0005919 | Ga0439448_0005919_1608_3035 | 474 |
| 585 | 3300042439 | Ga0439464_0000830 | Ga0439464_0000830_1604_3031 | 474 |
| 586 | 3300042461 | Ga0439460_0000197 | Ga0439460_0000197_967_2394 | 474 |
| 587 | 3300042876 | Ga0451577_0068274 | Ga0451577_0068274_199_1626 | 474 |
| 588 | 3300044673 | Ga0453683_0026123 | Ga0453683_0026123_764_2191 | 474 |
| 589 | 3300044673 | Ga0453683_0050488 | Ga0453683_0050488_1075_2499 | 474 |
| 590 | 3300045051 | Ga0451576_0005141 | Ga0451576_0005141_14419_15846 | 474 |
| 591 | 3300045051 | Ga0451576_0019775 | Ga0451576_0019775_1402_2829 | 474 |
| 592 | 3300049570 | Ga0501033_0106442 | Ga0501033_0106442_559_1986 | 474 |
| 593 | 3300049575 | Ga0501039_0012641 | Ga0501039_0012641_3866_5293 | 474 |
| 594 | 3300049577 | Ga0501041_0006125 | Ga0501041_0006125_4903_6330 | 474 |
| 595 | 3300049578 | Ga0501042_0034409 | Ga0501042_0034409_1492_2919 | 474 |
| 596 | 3300049580 | Ga0501046_0075277 | Ga0501046_0075277_338_1765 | 474 |
| 597 | 3300049580 | Ga0501046_0114920 | Ga0501046_0114920_68_1495 | 474 |
| 598 | 3300049581 | Ga0501047_0109507 | Ga0501047_0109507_1165_2592 | 474 |
| 599 | 3300049584 | Ga0501068_0031832 | Ga0501068_0031832_105_1532 | 474 |
| 600 | 3300049588 | Ga0501072_0035451 | Ga0501072_0035451_842_2269 | 474 |
| 601 | 3300049590 | Ga0501074_0032375 | Ga0501074_0032375_748_2175 | 474 |
| 602 | 3300049591 | Ga0501075_0006351 | Ga0501075_0006351_1297_2724 | 474 |
| 603 | 3300049591 | Ga0501075_0043634 | Ga0501075_0043634_737_2164 | 474 |
| 604 | 3300049592 | Ga0501076_0118503 | Ga0501076_0118503_670_2097 | 474 |
| 605 | 3300049593 | Ga0501077_0009200 | Ga0501077_0009200_3816_5243 | 474 |
| 606 | 3300049593 | Ga0501077_0079258 | Ga0501077_0079258_528_1955 | 474 |
| 607 | 3300049741 | Ga0501079_0012871 | Ga0501079_0012871_1700_3127 | 474 |
| 608 | 3300049741 | Ga0501079_0033516 | Ga0501079_0033516_347_1774 | 474 |
| 609 | 3300049743 | Ga0501081_0005258 | Ga0501081_0005258_963_2390 | 474 |
| 610 | 3300049743 | Ga0501081_0028626 | Ga0501081_0028626_1851_3278 | 474 |
| 611 | 3300049743 | Ga0501081_0055063 | Ga0501081_0055063_401_1828 | 474 |
| 612 | 3300049744 | Ga0501083_0014659 | Ga0501083_0014659_2823_4250 | 474 |
| 613 | 3300049824 | Ga0501045_0018435 | Ga0501045_0018435_2949_4376 | 474 |
| 614 | 3300054114 | Ga0501084_0014381 | Ga0501084_0014381_5099_6526 | 474 |
| 615 | 3300061734 | Ga0530510_0099475 | Ga0530510_0099475_341_1768 | 474 |
| 616 | 3300031731 | Ga0307405_10039995 | Ga0307405_100399951 | 476 |
| 617 | 3300032002 | Ga0307416_100050470 | Ga0307416_1000504702 | 476 |
| 618 | 3300005471 | Ga0070698_100007713 | Ga0070698_1000077132 | 478 |
| 619 | 3300005518 | Ga0070699_100000712 | Ga0070699_10000071217 | 478 |
| 620 | 3300005546 | Ga0070696_100050366 | Ga0070696_1000503662 | 478 |
| 621 | 3300009147 | Ga0114129_10003221 | Ga0114129_1000322124 | 478 |
| 622 | 3300050507 | nmdc:mga05p37_14939_c1 | nmdc:mga05p37_14939_c1_3688_5154 | 478 |
| 623 | 3300005518 | Ga0070699_100026173 | Ga0070699_1000261735 | 479 |
| 624 | 3300001977 | JGI24746J21847_1000779 | JGI24746J21847_10007793 | 480 |
| 625 | 3300005293 | Ga0065715_10005150 | Ga0065715_100051503 | 480 |
| 626 | 3300005334 | Ga0068869_100010384 | Ga0068869_1000103845 | 480 |
| 627 | 3300005340 | Ga0070689_100006307 | Ga0070689_1000063073 | 480 |
| 628 | 3300005343 | Ga0070687_100013316 | Ga0070687_1000133162 | 480 |
| 629 | 3300005347 | Ga0070668_100057079 | Ga0070668_1000570792 | 480 |
| 630 | 3300005438 | Ga0070701_10026049 | Ga0070701_100260492 | 480 |
| 631 | 3300005441 | Ga0070700_100009311 | Ga0070700_1000093114 | 480 |
| 632 | 3300005457 | Ga0070662_100027076 | Ga0070662_1000270762 | 480 |
| 633 | 3300005458 | Ga0070681_10045040 | Ga0070681_100450403 | 480 |
| 634 | 3300005564 | Ga0070664_100006931 | Ga0070664_1000069312 | 480 |
| 635 | 3300005564 | Ga0070664_100064670 | Ga0070664_1000646703 | 480 |
| 636 | 3300005618 | Ga0068864_100086867 | Ga0068864_1000868672 | 480 |
| 637 | 3300005719 | Ga0068861_100016033 | Ga0068861_1000160332 | 480 |
| 638 | 3300005840 | Ga0068870_10002979 | Ga0068870_100029792 | 480 |
| 639 | 3300005841 | Ga0068863_100072573 | Ga0068863_1000725733 | 480 |
| 640 | 3300005844 | Ga0068862_100011482 | Ga0068862_1000114823 | 480 |
| 641 | 3300006852 | Ga0075433_10005550 | Ga0075433_100055503 | 480 |
| 642 | 3300006871 | Ga0075434_100114253 | Ga0075434_1001142532 | 480 |
| 643 | 3300006871 | Ga0075434_100131672 | Ga0075434_1001316722 | 480 |
| 644 | 3300009094 | Ga0111539_10006594 | Ga0111539_100065945 | 480 |
| 645 | 3300009094 | Ga0111539_10207545 | Ga0111539_102075453 | 480 |
| 646 | 3300009177 | Ga0105248_10110182 | Ga0105248_101101822 | 480 |
| 647 | 3300009553 | Ga0105249_10008153 | Ga0105249_1000815310 | 480 |
| 648 | 3300011119 | Ga0105246_10028242 | Ga0105246_100282422 | 480 |
| 649 | 3300013306 | Ga0163162_10022241 | Ga0163162_100222414 | 480 |
| 650 | 3300013308 | Ga0157375_10268348 | Ga0157375_102683482 | 480 |
| 651 | 3300014326 | Ga0157380_10003226 | Ga0157380_100032262 | 480 |
| 652 | 3300017792 | Ga0163161_10015178 | Ga0163161_100151782 | 480 |
| 653 | 3300025315 | Ga0207697_10001435 | Ga0207697_100014354 | 480 |
| 654 | 3300025901 | Ga0207688_10001607 | Ga0207688_100016077 | 480 |
| 655 | 3300025908 | Ga0207643_10000732 | Ga0207643_100007327 | 480 |
| 656 | 3300025912 | Ga0207707_10109336 | Ga0207707_101093362 | 480 |
| 657 | 3300025918 | Ga0207662_10003719 | Ga0207662_100037194 | 480 |
| 658 | 3300025926 | Ga0207659_10002998 | Ga0207659_100029985 | 480 |
| 659 | 3300025933 | Ga0207706_10017429 | Ga0207706_100174292 | 480 |
| 660 | 3300025936 | Ga0207670_10061086 | Ga0207670_100610862 | 480 |
| 661 | 3300025938 | Ga0207704_10071650 | Ga0207704_100716502 | 480 |
| 662 | 3300025940 | Ga0207691_10010524 | Ga0207691_100105242 | 480 |
| 663 | 3300025942 | Ga0207689_10005325 | Ga0207689_100053254 | 480 |
| 664 | 3300025961 | Ga0207712_10066798 | Ga0207712_100667981 | 480 |
| 665 | 3300025986 | Ga0207658_10066628 | Ga0207658_100666282 | 480 |
| 666 | 3300026075 | Ga0207708_10015376 | Ga0207708_100153762 | 480 |
| 667 | 3300026118 | Ga0207675_100002501 | Ga0207675_1000025019 | 480 |
| 668 | 3300026121 | Ga0207683_10007833 | Ga0207683_100078337 | 480 |
| 669 | 3300027907 | Ga0207428_10008043 | Ga0207428_100080438 | 480 |
| 670 | 3300028380 | Ga0268265_10022805 | Ga0268265_100228053 | 480 |
| 671 | 3300045051 | Ga0451576_0084972 | Ga0451576_0084972_1423_2865 | 480 |
| 672 | 3300050507 | nmdc:mga05p37_183619_c1 | nmdc:mga05p37_183619_c1_369_1904 | 480 |
| 673 | 3300050515 | nmdc:mga0a205_66283_c1 | nmdc:mga0a205_66283_c1_323_1765 | 480 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7aqq-assembly1.cif.gz_N | cryo-em structure of arabidopsis thaliana complex-i (membrane core) | 0.9295 | 8 | 475 |
| 8e73-assembly1.cif.gz_2M | vigna radiata supercomplex i+iii2 (full bridge) | 0.9179 | 8 | 476 |
| 6khj-assembly1.cif.gz_B | supercomplex for electron transfer | 0.9143 | 8 | 473 |
| 7aqq-assembly1.cif.gz_N | cryo-em structure of arabidopsis thaliana complex-i (membrane core) | 0.9125 | 8 | 475 |
| 7f9o-assembly1.cif.gz_M | psi-ndh supercomplex of barley | 0.9116 | 9 | 469 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IIQ6_781_1032_1.25.40.660 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein 35, helical subcomplex Vps35-C | 0.344 | 8 | 245 | 1.25.40.660 |
| af_I1LLV0_1_234_1.20.1410.10 | Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain | 0.3315 | 40 | 268 | 1.20.1410.10 |
| af_F4HWQ7_36_219_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3253 | 4 | 229 | 1.20.1070.10 |
| af_I1LLV0_1_234_1.20.1410.10 | Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain | 0.3248 | 40 | 268 | 1.20.1410.10 |
| af_F4HWQ7_36_219_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3224 | 4 | 229 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661UT51-F1-model_v4 | NADH-quinone oxidoreductase subunit N | 0.9673 | 292 | 476 |
GO:0012505
GO:0016020 GO:0048038 |
| AF-A0A351XEN3-F1-model_v4 | NADH:quinone oxidoreductase/Mrp antiporter transmembrane domain-containing protein | 0.9666 | 258 | 475 |
GO:0012505
GO:0016020 |
| AF-A0A3N5QKU7-F1-model_v4 | NADH-quinone oxidoreductase subunit N | 0.9666 | 320 | 475 |
GO:0012505
GO:0016020 |
| AF-A0A6L3AAY0-F1-model_v4 | NADH-quinone oxidoreductase subunit N | 0.9577 | 82 | 475 |
GO:0008137
GO:0012505 GO:0016020 GO:0042773 |
| AF-A0A2G8MKL7-F1-model_v4 | deleted | 0.9574 | 227 | 476 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar