F474292
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 673 | 298 | 673 | 95 |
Family's Representative Sequence
| Representative Sequence | 3300005618|Ga0068864_100112228|Ga0068864_1001122281 |
| Length | 101 |
| Sequence | MTGTRMKYFHRTHLSPDSVLARAAQYFGGRLSPVEELPRRRRFTGSIGQVGVSVQADGGHYTLVTVETNQVGESEADKLAKRFLTIVHTMAEPTHRPIGAY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 150 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 151 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 152 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 153 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 154 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 161 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 162 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 167 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 177 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 178 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 179 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 180 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 181 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 184 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 185 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 227 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 228 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 229 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 230 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 231 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 254 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 255 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 256 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 257 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 258 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 259 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 260 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 261 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 262 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 263 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 264 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 265 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 266 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 267 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 273 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 274 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 275 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 276 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 277 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 278 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 282 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 283 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 293 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 294 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 295 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 296 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.28 |
| Rhizosphere | 92.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10466576 | 3300005295 | Bacteria | 774 |
| 2 | Ga0070676_10039684 | 3300005328 | Bacteria | 2723 |
| 3 | Ga0070690_100056417 | 3300005330 | Bacteria | 2519 |
| 4 | Ga0070677_10127839 | 3300005333 | Bacteria | 1156 |
| 5 | Ga0068869_100007142 | 3300005334 | Bacteria | 7117 |
| 6 | Ga0070666_10057226 | 3300005335 | Bacteria | 2634 |
| 7 | Ga0070680_100390387 | 3300005336 | Bacteria | 1186 |
| 8 | Ga0070680_100931858 | 3300005336 | Bacteria | 750 |
| 9 | Ga0070680_101874526 | 3300005336 | Bacteria | 520 |
| 10 | Ga0070691_10008925 | 3300005341 | Bacteria | 4590 |
| 11 | Ga0070691_10049859 | 3300005341 | Bacteria | 1996 |
| 12 | Ga0070661_100433319 | 3300005344 | Bacteria | 1044 |
| 13 | Ga0070692_10062581 | 3300005345 | Bacteria | 1964 |
| 14 | Ga0070669_100739979 | 3300005353 | Unclassified | 833 |
| 15 | Ga0070675_100345992 | 3300005354 | Bacteria | 1318 |
| 16 | Ga0070671_100333480 | 3300005355 | Bacteria | 1293 |
| 17 | Ga0070674_100002772 | 3300005356 | Bacteria | 9682 |
| 18 | Ga0070673_102224785 | 3300005364 | Bacteria | 521 |
| 19 | Ga0070667_100029374 | 3300005367 | Bacteria | 4580 |
| 20 | Ga0070667_100183574 | 3300005367 | Bacteria | 1851 |
| 21 | Ga0070667_101163471 | 3300005367 | Bacteria | 722 |
| 22 | Ga0070703_10141841 | 3300005406 | Bacteria | 894 |
| 23 | Ga0070710_10378022 | 3300005437 | Bacteria | 944 |
| 24 | Ga0070701_10130807 | 3300005438 | Bacteria | 1426 |
| 25 | Ga0070701_10178718 | 3300005438 | Bacteria | 1241 |
| 26 | Ga0070711_100079919 | 3300005439 | Bacteria | 2327 |
| 27 | Ga0070711_100513021 | 3300005439 | Bacteria | 990 |
| 28 | Ga0070705_100006861 | 3300005440 | Bacteria | 5597 |
| 29 | Ga0070705_100010366 | 3300005440 | Bacteria | 4663 |
| 30 | Ga0070705_100035580 | 3300005440 | Bacteria | 2793 |
| 31 | Ga0070705_100368171 | 3300005440 | Bacteria | 1054 |
| 32 | Ga0070705_100818014 | 3300005440 | Bacteria | 743 |
| 33 | Ga0070705_100885179 | 3300005440 | Unclassified | 717 |
| 34 | Ga0070700_100091200 | 3300005441 | Bacteria | 1989 |
| 35 | Ga0070700_100093439 | 3300005441 | Bacteria | 1967 |
| 36 | Ga0070700_101214915 | 3300005441 | Bacteria | 630 |
| 37 | Ga0070694_100214296 | 3300005444 | Bacteria | 1442 |
| 38 | Ga0070694_100550160 | 3300005444 | Bacteria | 924 |
| 39 | Ga0070694_101455798 | 3300005444 | Bacteria | 579 |
| 40 | Ga0070694_101888520 | 3300005444 | Unclassified | 510 |
| 41 | Ga0070708_100168293 | 3300005445 | Bacteria | 2045 |
| 42 | Ga0070708_100403511 | 3300005445 | Bacteria | 1289 |
| 43 | Ga0070708_100610896 | 3300005445 | Bacteria | 1028 |
| 44 | Ga0070708_101156705 | 3300005445 | Bacteria | 724 |
| 45 | Ga0070708_101323539 | 3300005445 | Unclassified | 673 |
| 46 | Ga0070708_101901325 | 3300005445 | Bacteria | 552 |
| 47 | Ga0070708_102118961 | 3300005445 | Unclassified | 520 |
| 48 | Ga0070663_100756666 | 3300005455 | Bacteria | 830 |
| 49 | Ga0070678_100021674 | 3300005456 | Bacteria | 4242 |
| 50 | Ga0070662_100009215 | 3300005457 | Bacteria | 6445 |
| 51 | Ga0070681_10140844 | 3300005458 | Bacteria | 2341 |
| 52 | Ga0068867_100001444 | 3300005459 | Bacteria | 16464 |
| 53 | Ga0068867_101600290 | 3300005459 | Bacteria | 609 |
| 54 | Ga0070706_100268398 | 3300005467 | Bacteria | 1592 |
| 55 | Ga0070706_100321284 | 3300005467 | Bacteria | 1443 |
| 56 | Ga0070706_100421079 | 3300005467 | Bacteria | 1243 |
| 57 | Ga0070706_101144740 | 3300005467 | Bacteria | 716 |
| 58 | Ga0070707_100069499 | 3300005468 | Bacteria | 3391 |
| 59 | Ga0070707_100247277 | 3300005468 | Bacteria | 1735 |
| 60 | Ga0070698_100111517 | 3300005471 | Bacteria | 2700 |
| 61 | Ga0070698_100139002 | 3300005471 | Bacteria | 2382 |
| 62 | Ga0070698_100177798 | 3300005471 | Bacteria | 2067 |
| 63 | Ga0070698_100223466 | 3300005471 | Bacteria | 1816 |
| 64 | Ga0070698_100478860 | 3300005471 | Bacteria | 1182 |
| 65 | Ga0070698_100873454 | 3300005471 | Bacteria | 845 |
| 66 | Ga0070698_101139768 | 3300005471 | Unclassified | 729 |
| 67 | Ga0070698_101227612 | 3300005471 | Unclassified | 699 |
| 68 | Ga0070699_100008009 | 3300005518 | Bacteria | 9174 |
| 69 | Ga0070699_100093310 | 3300005518 | Bacteria | 2634 |
| 70 | Ga0070699_100135473 | 3300005518 | Bacteria | 2173 |
| 71 | Ga0070699_100213972 | 3300005518 | Bacteria | 1717 |
| 72 | Ga0070699_100909395 | 3300005518 | Bacteria | 806 |
| 73 | Ga0070699_100959528 | 3300005518 | Unclassified | 784 |
| 74 | Ga0070699_101181099 | 3300005518 | Unclassified | 702 |
| 75 | Ga0070679_100311117 | 3300005530 | Bacteria | 1525 |
| 76 | Ga0070679_100715931 | 3300005530 | Bacteria | 944 |
| 77 | Ga0070684_101966803 | 3300005535 | Unclassified | 552 |
| 78 | Ga0070697_100021236 | 3300005536 | Bacteria | 5142 |
| 79 | Ga0070697_100101706 | 3300005536 | Bacteria | 2388 |
| 80 | Ga0070697_101075305 | 3300005536 | Bacteria | 716 |
| 81 | Ga0070697_101295682 | 3300005536 | Unclassified | 650 |
| 82 | Ga0070697_101388814 | 3300005536 | Unclassified | 627 |
| 83 | Ga0068853_100226078 | 3300005539 | Bacteria | 1711 |
| 84 | Ga0070686_100263258 | 3300005544 | Bacteria | 1265 |
| 85 | Ga0070686_100637300 | 3300005544 | Bacteria | 844 |
| 86 | Ga0070695_100075529 | 3300005545 | Bacteria | 2217 |
| 87 | Ga0070695_100984403 | 3300005545 | Unclassified | 685 |
| 88 | Ga0070695_101660756 | 3300005545 | Unclassified | 534 |
| 89 | Ga0070696_100004439 | 3300005546 | Bacteria | 9362 |
| 90 | Ga0070696_100017620 | 3300005546 | Bacteria | 4822 |
| 91 | Ga0070696_100037557 | 3300005546 | Bacteria | 3341 |
| 92 | Ga0070696_100481052 | 3300005546 | Bacteria | 985 |
| 93 | Ga0070696_100645460 | 3300005546 | Bacteria | 858 |
| 94 | Ga0070696_100788547 | 3300005546 | Bacteria | 781 |
| 95 | Ga0070696_101228531 | 3300005546 | Bacteria | 634 |
| 96 | Ga0070693_100321367 | 3300005547 | Bacteria | 1050 |
| 97 | Ga0070704_100063496 | 3300005549 | Bacteria | 2651 |
| 98 | Ga0070704_100178041 | 3300005549 | Bacteria | 1698 |
| 99 | Ga0070704_101298325 | 3300005549 | Unclassified | 666 |
| 100 | Ga0068855_102183438 | 3300005563 | Bacteria | 556 |
| 101 | Ga0070664_100162182 | 3300005564 | Bacteria | 1978 |
| 102 | Ga0070664_102118803 | 3300005564 | Bacteria | 534 |
| 103 | Ga0068857_100050518 | 3300005577 | Bacteria | 3688 |
| 104 | Ga0068857_100193092 | 3300005577 | Bacteria | 1855 |
| 105 | Ga0068857_100617212 | 3300005577 | Bacteria | 1026 |
| 106 | Ga0068854_100010148 | 3300005578 | Bacteria | 6102 |
| 107 | Ga0068854_100953849 | 3300005578 | Bacteria | 757 |
| 108 | Ga0068859_100076240 | 3300005617 | Bacteria | 3394 |
| 109 | Ga0068859_102380627 | 3300005617 | Bacteria | 584 |
| 110 | Ga0068864_100001101 | 3300005618 | Bacteria | 22618 |
| 111 | Ga0068864_100112228 | 3300005618 | Bacteria | 2429 |
| 112 | Ga0068864_101009605 | 3300005618 | Bacteria | 825 |
| 113 | Ga0068866_10000165 | 3300005718 | Bacteria | 30640 |
| 114 | Ga0068861_100101728 | 3300005719 | Bacteria | 2286 |
| 115 | Ga0068861_100243708 | 3300005719 | Bacteria | 1530 |
| 116 | Ga0068861_100549133 | 3300005719 | Bacteria | 1052 |
| 117 | Ga0068861_101418099 | 3300005719 | Bacteria | 679 |
| 118 | Ga0068861_101772230 | 3300005719 | Bacteria | 612 |
| 119 | Ga0068870_10066682 | 3300005840 | Bacteria | 1951 |
| 120 | Ga0068863_100076993 | 3300005841 | Bacteria | 3156 |
| 121 | Ga0068863_100400310 | 3300005841 | Bacteria | 1343 |
| 122 | Ga0068858_100080197 | 3300005842 | Bacteria | 3032 |
| 123 | Ga0068858_101286174 | 3300005842 | Unclassified | 720 |
| 124 | Ga0068860_100685615 | 3300005843 | Bacteria | 1034 |
| 125 | Ga0068860_100756488 | 3300005843 | Bacteria | 984 |
| 126 | Ga0068860_100862405 | 3300005843 | Bacteria | 920 |
| 127 | Ga0068860_101360423 | 3300005843 | Bacteria | 731 |
| 128 | Ga0068860_101531584 | 3300005843 | Bacteria | 688 |
| 129 | Ga0068862_101424342 | 3300005844 | Bacteria | 697 |
| 130 | Ga0081538_10026610 | 3300005981 | Bacteria | 4040 |
| 131 | Ga0070715_10229749 | 3300006163 | Bacteria | 959 |
| 132 | Ga0070716_101537939 | 3300006173 | Bacteria | 545 |
| 133 | Ga0070712_100135387 | 3300006175 | Bacteria | 1873 |
| 134 | Ga0097621_100574481 | 3300006237 | Bacteria | 1028 |
| 135 | Ga0097621_101172255 | 3300006237 | Unclassified | 723 |
| 136 | Ga0068871_100094094 | 3300006358 | Bacteria | 2501 |
| 137 | Ga0075428_100540701 | 3300006844 | Bacteria | 1246 |
| 138 | Ga0075428_102000718 | 3300006844 | Bacteria | 601 |
| 139 | Ga0075428_102172427 | 3300006844 | Bacteria | 573 |
| 140 | Ga0075430_100014773 | 3300006846 | Bacteria | 6650 |
| 141 | Ga0075430_100282639 | 3300006846 | Bacteria | 1373 |
| 142 | Ga0075430_100584295 | 3300006846 | Bacteria | 922 |
| 143 | Ga0075431_100589047 | 3300006847 | Bacteria | 1097 |
| 144 | Ga0075431_101106014 | 3300006847 | Bacteria | 757 |
| 145 | Ga0075433_10019313 | 3300006852 | Bacteria | 5678 |
| 146 | Ga0075433_10142207 | 3300006852 | Bacteria | 2133 |
| 147 | Ga0075433_11323646 | 3300006852 | Bacteria | 624 |
| 148 | Ga0075434_100197634 | 3300006871 | Bacteria | 2031 |
| 149 | Ga0075434_100402723 | 3300006871 | Bacteria | 1389 |
| 150 | Ga0075434_100747493 | 3300006871 | Bacteria | 995 |
| 151 | Ga0075429_100063000 | 3300006880 | Bacteria | 3231 |
| 152 | Ga0068865_100001488 | 3300006881 | Bacteria | 13652 |
| 153 | Ga0068865_100922293 | 3300006881 | Bacteria | 761 |
| 154 | Ga0068865_101695285 | 3300006881 | Bacteria | 570 |
| 155 | Ga0097620_100076241 | 3300006931 | Bacteria | 3394 |
| 156 | Ga0097620_102380800 | 3300006931 | Bacteria | 584 |
| 157 | Ga0075435_100513852 | 3300007076 | Bacteria | 1036 |
| 158 | Ga0075435_101166192 | 3300007076 | Bacteria | 674 |
| 159 | Ga0105240_10032020 | 3300009093 | Bacteria | 6810 |
| 160 | Ga0111539_10245983 | 3300009094 | Bacteria | 2082 |
| 161 | Ga0111539_10332026 | 3300009094 | Bacteria | 1770 |
| 162 | Ga0111539_10702318 | 3300009094 | Bacteria | 1177 |
| 163 | Ga0105245_11937848 | 3300009098 | Unclassified | 642 |
| 164 | Ga0105247_10148183 | 3300009101 | Bacteria | 1544 |
| 165 | Ga0114129_10209150 | 3300009147 | Bacteria | 2638 |
| 166 | Ga0114129_10499446 | 3300009147 | Bacteria | 1589 |
| 167 | Ga0114129_10817652 | 3300009147 | Bacteria | 1187 |
| 168 | Ga0114129_11081202 | 3300009147 | Bacteria | 1005 |
| 169 | Ga0114129_11351122 | 3300009147 | Bacteria | 881 |
| 170 | Ga0114129_12621611 | 3300009147 | Bacteria | 601 |
| 171 | Ga0105243_10034312 | 3300009148 | Bacteria | 3927 |
| 172 | Ga0105243_10769122 | 3300009148 | Bacteria | 946 |
| 173 | Ga0105241_10006643 | 3300009174 | Bacteria | 8524 |
| 174 | Ga0105242_10012015 | 3300009176 | Bacteria | 6666 |
| 175 | Ga0105242_10566914 | 3300009176 | Bacteria | 1091 |
| 176 | Ga0105248_10047348 | 3300009177 | Bacteria | 4821 |
| 177 | Ga0105248_11911070 | 3300009177 | Bacteria | 674 |
| 178 | Ga0105238_10844137 | 3300009551 | Bacteria | 933 |
| 179 | Ga0105249_10058065 | 3300009553 | Bacteria | 3546 |
| 180 | Ga0105249_10248890 | 3300009553 | Bacteria | 1761 |
| 181 | Ga0105239_10023083 | 3300010375 | Bacteria | 6858 |
| 182 | Ga0105239_13221016 | 3300010375 | Bacteria | 531 |
| 183 | Ga0105246_10089636 | 3300011119 | Bacteria | 2213 |
| 184 | Ga0105246_10254083 | 3300011119 | Bacteria | 1397 |
| 185 | Ga0157371_10021369 | 3300013102 | Bacteria | 4751 |
| 186 | Ga0157371_11055541 | 3300013102 | Bacteria | 622 |
| 187 | Ga0157378_10075301 | 3300013297 | Bacteria | 3039 |
| 188 | Ga0163162_11390379 | 3300013306 | Unclassified | 798 |
| 189 | Ga0163162_11902536 | 3300013306 | Unclassified | 681 |
| 190 | Ga0157375_10379332 | 3300013308 | Bacteria | 1580 |
| 191 | Ga0157375_10617099 | 3300013308 | Bacteria | 1243 |
| 192 | Ga0163163_10041997 | 3300014325 | Bacteria | 4476 |
| 193 | Ga0163163_11051267 | 3300014325 | Bacteria | 877 |
| 194 | Ga0163163_12931526 | 3300014325 | Bacteria | 532 |
| 195 | Ga0157380_10496428 | 3300014326 | Bacteria | 1184 |
| 196 | Ga0157380_11228549 | 3300014326 | Bacteria | 794 |
| 197 | Ga0182008_10544871 | 3300014497 | Bacteria | 644 |
| 198 | Ga0157377_11560736 | 3300014745 | Unclassified | 527 |
| 199 | Ga0157379_10077664 | 3300014968 | Bacteria | 2973 |
| 200 | Ga0157379_10126392 | 3300014968 | Bacteria | 2300 |
| 201 | Ga0157379_10450366 | 3300014968 | Bacteria | 1188 |
| 202 | Ga0157379_11613073 | 3300014968 | Bacteria | 634 |
| 203 | Ga0157376_10694168 | 3300014969 | Bacteria | 1022 |
| 204 | Ga0163161_10110208 | 3300017792 | Bacteria | 2057 |
| 205 | Ga0163161_11493349 | 3300017792 | Bacteria | 593 |
| 206 | Ga0207653_10052792 | 3300025885 | Bacteria | 1356 |
| 207 | Ga0207682_10158218 | 3300025893 | Bacteria | 1025 |
| 208 | Ga0207642_10001600 | 3300025899 | Bacteria | 6974 |
| 209 | Ga0207688_10542386 | 3300025901 | Bacteria | 730 |
| 210 | Ga0207680_10051914 | 3300025903 | Bacteria | 2454 |
| 211 | Ga0207685_10029835 | 3300025905 | Bacteria | 1935 |
| 212 | Ga0207645_10000654 | 3300025907 | Bacteria | 28792 |
| 213 | Ga0207643_10018495 | 3300025908 | Bacteria | 3816 |
| 214 | Ga0207684_10209514 | 3300025910 | Bacteria | 1681 |
| 215 | Ga0207684_10278157 | 3300025910 | Unclassified | 1444 |
| 216 | Ga0207684_10486627 | 3300025910 | Bacteria | 1058 |
| 217 | Ga0207684_10644146 | 3300025910 | Bacteria | 903 |
| 218 | Ga0207654_10022254 | 3300025911 | Bacteria | 3380 |
| 219 | Ga0207695_10078707 | 3300025913 | Bacteria | 3344 |
| 220 | Ga0207693_10116841 | 3300025915 | Bacteria | 2094 |
| 221 | Ga0207693_10518527 | 3300025915 | Bacteria | 930 |
| 222 | Ga0207663_10096574 | 3300025916 | Bacteria | 1974 |
| 223 | Ga0207663_10224832 | 3300025916 | Bacteria | 1368 |
| 224 | Ga0207660_10065876 | 3300025917 | Bacteria | 2619 |
| 225 | Ga0207660_10316595 | 3300025917 | Bacteria | 1245 |
| 226 | Ga0207660_10458276 | 3300025917 | Bacteria | 1032 |
| 227 | Ga0207660_11384837 | 3300025917 | Bacteria | 570 |
| 228 | Ga0207657_10192867 | 3300025919 | Bacteria | 1642 |
| 229 | Ga0207652_10558367 | 3300025921 | Bacteria | 1028 |
| 230 | Ga0207652_10621990 | 3300025921 | Bacteria | 967 |
| 231 | Ga0207646_10027898 | 3300025922 | Bacteria | 5147 |
| 232 | Ga0207646_10047328 | 3300025922 | Bacteria | 3857 |
| 233 | Ga0207646_11333605 | 3300025922 | Bacteria | 626 |
| 234 | Ga0207646_11829112 | 3300025922 | Unclassified | 519 |
| 235 | Ga0207681_10058353 | 3300025923 | Bacteria | 2642 |
| 236 | Ga0207681_10483711 | 3300025923 | Bacteria | 1011 |
| 237 | Ga0207687_10149457 | 3300025927 | Bacteria | 1781 |
| 238 | Ga0207700_10702151 | 3300025928 | Bacteria | 903 |
| 239 | Ga0207644_10269770 | 3300025931 | Bacteria | 1363 |
| 240 | Ga0207706_10000244 | 3300025933 | Bacteria | 59754 |
| 241 | Ga0207706_10095957 | 3300025933 | Bacteria | 2608 |
| 242 | Ga0207686_10000739 | 3300025934 | Bacteria | 20216 |
| 243 | Ga0207709_10010091 | 3300025935 | Bacteria | 5202 |
| 244 | Ga0207669_10000951 | 3300025937 | Bacteria | 12276 |
| 245 | Ga0207669_11051127 | 3300025937 | Bacteria | 686 |
| 246 | Ga0207704_10047633 | 3300025938 | Bacteria | 2564 |
| 247 | Ga0207704_10348203 | 3300025938 | Bacteria | 1153 |
| 248 | Ga0207704_10460666 | 3300025938 | Bacteria | 1017 |
| 249 | Ga0207691_10120126 | 3300025940 | Bacteria | 2330 |
| 250 | Ga0207711_10014398 | 3300025941 | Bacteria | 6568 |
| 251 | Ga0207689_10004763 | 3300025942 | Bacteria | 12241 |
| 252 | Ga0207661_10229177 | 3300025944 | Bacteria | 1645 |
| 253 | Ga0207679_10897599 | 3300025945 | Bacteria | 810 |
| 254 | Ga0207679_11706128 | 3300025945 | Unclassified | 576 |
| 255 | Ga0207651_10130991 | 3300025960 | Bacteria | 1920 |
| 256 | Ga0207712_10036673 | 3300025961 | Bacteria | 3341 |
| 257 | Ga0207712_10150022 | 3300025961 | Bacteria | 1800 |
| 258 | Ga0207668_10067824 | 3300025972 | Bacteria | 2534 |
| 259 | Ga0207640_10003546 | 3300025981 | Bacteria | 8416 |
| 260 | Ga0207640_10771645 | 3300025981 | Unclassified | 830 |
| 261 | Ga0207658_10459638 | 3300025986 | Unclassified | 1128 |
| 262 | Ga0207658_10461392 | 3300025986 | Bacteria | 1126 |
| 263 | Ga0207677_10414698 | 3300026023 | Bacteria | 1145 |
| 264 | Ga0207703_10700002 | 3300026035 | Bacteria | 963 |
| 265 | Ga0207703_11508492 | 3300026035 | Unclassified | 647 |
| 266 | Ga0207639_10141825 | 3300026041 | Bacteria | 2003 |
| 267 | Ga0207639_11719577 | 3300026041 | Bacteria | 588 |
| 268 | Ga0207678_10885472 | 3300026067 | Bacteria | 789 |
| 269 | Ga0207678_11690597 | 3300026067 | Bacteria | 556 |
| 270 | Ga0207678_11805379 | 3300026067 | Bacteria | 535 |
| 271 | Ga0207708_10050542 | 3300026075 | Bacteria | 3165 |
| 272 | Ga0207708_10145613 | 3300026075 | Bacteria | 1861 |
| 273 | Ga0207708_10659312 | 3300026075 | Bacteria | 891 |
| 274 | Ga0207702_10963890 | 3300026078 | Bacteria | 846 |
| 275 | Ga0207641_10014994 | 3300026088 | Bacteria | 6354 |
| 276 | Ga0207641_10366685 | 3300026088 | Bacteria | 1376 |
| 277 | Ga0207648_10000273 | 3300026089 | Bacteria | 56070 |
| 278 | Ga0207648_11750673 | 3300026089 | Bacteria | 583 |
| 279 | Ga0207676_10088565 | 3300026095 | Bacteria | 2534 |
| 280 | Ga0207676_10251708 | 3300026095 | Bacteria | 1590 |
| 281 | Ga0207676_11021755 | 3300026095 | Bacteria | 815 |
| 282 | Ga0207676_11579351 | 3300026095 | Bacteria | 654 |
| 283 | Ga0207674_10037131 | 3300026116 | Bacteria | 5070 |
| 284 | Ga0207674_10874572 | 3300026116 | Bacteria | 866 |
| 285 | Ga0207675_100022222 | 3300026118 | Bacteria | 5907 |
| 286 | Ga0207675_100793598 | 3300026118 | Bacteria | 960 |
| 287 | Ga0207675_101018263 | 3300026118 | Bacteria | 847 |
| 288 | Ga0207675_101504994 | 3300026118 | Bacteria | 694 |
| 289 | Ga0207683_10006669 | 3300026121 | Bacteria | 9877 |
| 290 | Ga0207683_10693967 | 3300026121 | Bacteria | 944 |
| 291 | Ga0207698_10553202 | 3300026142 | Bacteria | 1128 |
| 292 | Ga0209998_10069499 | 3300027717 | Bacteria | 840 |
| 293 | Ga0207428_10156595 | 3300027907 | Bacteria | 1732 |
| 294 | Ga0207428_10176884 | 3300027907 | Bacteria | 1613 |
| 295 | Ga0268265_10498898 | 3300028380 | Bacteria | 1146 |
| 296 | Ga0268265_11309278 | 3300028380 | Bacteria | 725 |
| 297 | Ga0268265_11407957 | 3300028380 | Bacteria | 699 |
| 298 | Ga0268264_10313772 | 3300028381 | Bacteria | 1480 |
| 299 | Ga0307408_100005949 | 3300031548 | Bacteria | 8125 |
| 300 | Ga0307408_100026791 | 3300031548 | Bacteria | 3965 |
| 301 | Ga0307408_100031731 | 3300031548 | Bacteria | 3680 |
| 302 | Ga0307408_100368456 | 3300031548 | Bacteria | 1224 |
| 303 | Ga0307408_100906506 | 3300031548 | Bacteria | 807 |
| 304 | Ga0307405_10095960 | 3300031731 | Bacteria | 1976 |
| 305 | Ga0307405_10250186 | 3300031731 | Bacteria | 1318 |
| 306 | Ga0307405_10629985 | 3300031731 | Bacteria | 879 |
| 307 | Ga0307413_10013116 | 3300031824 | Bacteria | 4151 |
| 308 | Ga0307413_10028104 | 3300031824 | Bacteria | 3127 |
| 309 | Ga0307413_10028238 | 3300031824 | Bacteria | 3121 |
| 310 | Ga0307413_10030957 | 3300031824 | Bacteria | 3012 |
| 311 | Ga0307413_10045105 | 3300031824 | Bacteria | 2610 |
| 312 | Ga0307413_10078817 | 3300031824 | Bacteria | 2103 |
| 313 | Ga0307413_10849126 | 3300031824 | Bacteria | 771 |
| 314 | Ga0307413_10988661 | 3300031824 | Bacteria | 720 |
| 315 | Ga0307410_10002568 | 3300031852 | Bacteria | 8806 |
| 316 | Ga0307410_10003332 | 3300031852 | Bacteria | 8038 |
| 317 | Ga0307410_10006262 | 3300031852 | Bacteria | 6406 |
| 318 | Ga0307410_10018020 | 3300031852 | Bacteria | 4256 |
| 319 | Ga0307410_10032819 | 3300031852 | Bacteria | 3347 |
| 320 | Ga0307410_10065406 | 3300031852 | Bacteria | 2501 |
| 321 | Ga0307410_10075903 | 3300031852 | Bacteria | 2344 |
| 322 | Ga0307410_10088549 | 3300031852 | Bacteria | 2192 |
| 323 | Ga0307410_10125921 | 3300031852 | Bacteria | 1876 |
| 324 | Ga0307410_10383126 | 3300031852 | Bacteria | 1132 |
| 325 | Ga0307410_11069671 | 3300031852 | Bacteria | 698 |
| 326 | Ga0307410_11634905 | 3300031852 | Unclassified | 570 |
| 327 | Ga0307410_11701440 | 3300031852 | Bacteria | 559 |
| 328 | Ga0307406_10022221 | 3300031901 | Bacteria | 3761 |
| 329 | Ga0307406_10027530 | 3300031901 | Bacteria | 3426 |
| 330 | Ga0307406_10027577 | 3300031901 | Bacteria | 3424 |
| 331 | Ga0307406_10056263 | 3300031901 | Bacteria | 2518 |
| 332 | Ga0307406_10085881 | 3300031901 | Bacteria | 2105 |
| 333 | Ga0307407_10047860 | 3300031903 | Bacteria | 2430 |
| 334 | Ga0307407_10081642 | 3300031903 | Bacteria | 1957 |
| 335 | Ga0307407_10342271 | 3300031903 | Bacteria | 1056 |
| 336 | Ga0307407_10495924 | 3300031903 | Bacteria | 894 |
| 337 | Ga0307407_10582447 | 3300031903 | Unclassified | 831 |
| 338 | Ga0307407_10933014 | 3300031903 | Bacteria | 667 |
| 339 | Ga0307407_11278308 | 3300031903 | Unclassified | 575 |
| 340 | Ga0307412_10033086 | 3300031911 | Bacteria | 3283 |
| 341 | Ga0307412_10045066 | 3300031911 | Bacteria | 2881 |
| 342 | Ga0307412_10316143 | 3300031911 | Bacteria | 1240 |
| 343 | Ga0307412_11974227 | 3300031911 | Unclassified | 540 |
| 344 | Ga0307409_100000665 | 3300031995 | Bacteria | 15233 |
| 345 | Ga0307409_100010974 | 3300031995 | Bacteria | 5677 |
| 346 | Ga0307409_100052697 | 3300031995 | Bacteria | 3122 |
| 347 | Ga0307409_100066895 | 3300031995 | Bacteria | 2835 |
| 348 | Ga0307409_100139059 | 3300031995 | Bacteria | 2089 |
| 349 | Ga0307409_100320000 | 3300031995 | Bacteria | 1451 |
| 350 | Ga0307409_100564770 | 3300031995 | Bacteria | 1119 |
| 351 | Ga0307409_101110484 | 3300031995 | Bacteria | 812 |
| 352 | Ga0307416_100000169 | 3300032002 | Bacteria | 36583 |
| 353 | Ga0307416_100000867 | 3300032002 | Bacteria | 15923 |
| 354 | Ga0307416_100058032 | 3300032002 | Bacteria | 3135 |
| 355 | Ga0307416_100067890 | 3300032002 | Bacteria | 2943 |
| 356 | Ga0307416_100076556 | 3300032002 | Bacteria | 2805 |
| 357 | Ga0307416_100104769 | 3300032002 | Bacteria | 2473 |
| 358 | Ga0307416_100109195 | 3300032002 | Bacteria | 2433 |
| 359 | Ga0307416_100209651 | 3300032002 | Bacteria | 1857 |
| 360 | Ga0307416_100339171 | 3300032002 | Bacteria | 1515 |
| 361 | Ga0307416_100554186 | 3300032002 | Bacteria | 1223 |
| 362 | Ga0307416_100854964 | 3300032002 | Bacteria | 1008 |
| 363 | Ga0307416_101097655 | 3300032002 | Bacteria | 900 |
| 364 | Ga0307416_101529157 | 3300032002 | Bacteria | 773 |
| 365 | Ga0307416_102889113 | 3300032002 | Archaea | 575 |
| 366 | Ga0307416_103794208 | 3300032002 | Bacteria | 506 |
| 367 | Ga0307414_10002833 | 3300032004 | Bacteria | 9143 |
| 368 | Ga0307414_10010252 | 3300032004 | Bacteria | 5428 |
| 369 | Ga0307414_10029303 | 3300032004 | Bacteria | 3581 |
| 370 | Ga0307414_10413798 | 3300032004 | Bacteria | 1174 |
| 371 | Ga0307414_10419233 | 3300032004 | Bacteria | 1167 |
| 372 | Ga0307414_10562222 | 3300032004 | Bacteria | 1018 |
| 373 | Ga0307411_10004089 | 3300032005 | Bacteria | 6916 |
| 374 | Ga0307411_10008563 | 3300032005 | Bacteria | 5310 |
| 375 | Ga0307411_10009847 | 3300032005 | Bacteria | 5056 |
| 376 | Ga0307411_10010011 | 3300032005 | Bacteria | 5025 |
| 377 | Ga0307411_10023128 | 3300032005 | Bacteria | 3674 |
| 378 | Ga0307411_10036137 | 3300032005 | Bacteria | 3092 |
| 379 | Ga0307411_10136237 | 3300032005 | Bacteria | 1803 |
| 380 | Ga0307411_10188055 | 3300032005 | Bacteria | 1574 |
| 381 | Ga0307411_10208933 | 3300032005 | Bacteria | 1506 |
| 382 | Ga0307411_10663709 | 3300032005 | Bacteria | 904 |
| 383 | Ga0307415_100001210 | 3300032126 | Bacteria | 12111 |
| 384 | Ga0307415_100020805 | 3300032126 | Bacteria | 4016 |
| 385 | Ga0307415_100041964 | 3300032126 | Bacteria | 3041 |
| 386 | Ga0307415_100046942 | 3300032126 | Bacteria | 2904 |
| 387 | Ga0307415_100054076 | 3300032126 | Bacteria | 2739 |
| 388 | Ga0307415_100077313 | 3300032126 | Bacteria | 2363 |
| 389 | Ga0307415_100226066 | 3300032126 | Bacteria | 1504 |
| 390 | Ga0307415_100606459 | 3300032126 | Bacteria | 975 |
| 391 | Ga0307415_101232589 | 3300032126 | Bacteria | 706 |
| 392 | Ga0307415_102541477 | 3300032126 | Bacteria | 505 |
| 393 | Ga0373928_0014865 | 3300035084 | Bacteria | 1579 |
| 394 | Ga0373929_0079919 | 3300035085 | Bacteria | 795 |
| 395 | Ga0373929_0126946 | 3300035085 | Bacteria | 665 |
| 396 | Ga0373940_0044441 | 3300035088 | Bacteria | 1231 |
| 397 | Ga0373940_0173131 | 3300035088 | Bacteria | 698 |
| 398 | Ga0373940_0199266 | 3300035088 | Unclassified | 657 |
| 399 | Ga0373949_0226281 | 3300035090 | Unclassified | 570 |
| 400 | Ga0373949_0286940 | 3300035090 | Unclassified | 519 |
| 401 | Ga0373951_0018130 | 3300035091 | Bacteria | 1598 |
| 402 | Ga0373932_0387810 | 3300035112 | Bacteria | 538 |
| 403 | Ga0373939_0080402 | 3300035114 | Bacteria | 1081 |
| 404 | Ga0373939_0154586 | 3300035114 | Bacteria | 838 |
| 405 | Ga0373941_0058249 | 3300035115 | Bacteria | 1250 |
| 406 | Ga0373941_0319340 | 3300035115 | Unclassified | 624 |
| 407 | Ga0373960_0061604 | 3300035121 | Bacteria | 1140 |
| 408 | Ga0373960_0091538 | 3300035121 | Bacteria | 973 |
| 409 | Ga0373942_0023024 | 3300035207 | Bacteria | 1587 |
| 410 | Ga0373961_0427118 | 3300035241 | Bacteria | 513 |
| 411 | Ga0373962_0070139 | 3300035242 | Bacteria | 1046 |
| 412 | Ga0373962_0138127 | 3300035242 | Bacteria | 790 |
| 413 | Ga0373931_0054141 | 3300035691 | Bacteria | 2144 |
| 414 | Ga0373931_0116197 | 3300035691 | Bacteria | 1524 |
| 415 | Ga0373931_0558948 | 3300035691 | Bacteria | 744 |
| 416 | Ga0373931_0576431 | 3300035691 | Bacteria | 733 |
| 417 | Ga0373937_0117801 | 3300036401 | Bacteria | 2474 |
| 418 | Ga0395905_0478378 | 3300037471 | Bacteria | 1145 |
| 419 | Ga0395905_0539105 | 3300037471 | Bacteria | 1068 |
| 420 | Ga0395905_1845704 | 3300037471 | Bacteria | 510 |
| 421 | Ga0395901_0387432 | 3300038443 | Bacteria | 1438 |
| 422 | Ga0395901_0992798 | 3300038443 | Bacteria | 816 |
| 423 | Ga0242419_009502 | 3300038698 | Bacteria | 737 |
| 424 | Ga0242420_004009 | 3300038996 | Bacteria | 2202 |
| 425 | Ga0242420_066752 | 3300038996 | Bacteria | 725 |
| 426 | Ga0242420_080861 | 3300038996 | Bacteria | 671 |
| 427 | Ga0439441_066403 | 3300042001 | Bacteria | 767 |
| 428 | Ga0439434_0091527 | 3300042435 | Bacteria | 973 |
| 429 | Ga0439435_0035267 | 3300042436 | Bacteria | 1379 |
| 430 | Ga0439459_0058676 | 3300042438 | Bacteria | 864 |
| 431 | Ga0451577_0018318 | 3300042876 | Bacteria | 6453 |
| 432 | Ga0451577_0291948 | 3300042876 | Bacteria | 1478 |
| 433 | Ga0453683_0253843 | 3300044673 | Bacteria | 1121 |
| 434 | Ga0453683_1201478 | 3300044673 | Bacteria | 508 |
| 435 | Ga0453684_0221947 | 3300044712 | Bacteria | 2189 |
| 436 | Ga0453684_1105708 | 3300044712 | Bacteria | 837 |
| 437 | Ga0451576_1757787 | 3300045051 | Bacteria | 641 |
| 438 | Ga0466967_1029796 | 3300045976 | Bacteria | 820 |
| 439 | Ga0495592_0240070 | 3300046454 | Bacteria | 1203 |
| 440 | Ga0495603_0008621 | 3300046455 | Bacteria | 6162 |
| 441 | Ga0495641_0042347 | 3300046461 | Bacteria | 2111 |
| 442 | Ga0495582_0176355 | 3300046473 | Bacteria | 1217 |
| 443 | Ga0495639_0164715 | 3300046475 | Bacteria | 1074 |
| 444 | Ga0495639_0242234 | 3300046475 | Unclassified | 890 |
| 445 | Ga0495664_0010407 | 3300046477 | Bacteria | 5218 |
| 446 | Ga0495594_0009149 | 3300046499 | Bacteria | 5111 |
| 447 | Ga0495618_0005880 | 3300046514 | Bacteria | 7459 |
| 448 | Ga0495630_0017989 | 3300046517 | Bacteria | 5186 |
| 449 | Ga0495666_0018868 | 3300046526 | Bacteria | 3426 |
| 450 | Ga0495640_0003406 | 3300046533 | Bacteria | 12796 |
| 451 | Ga0495586_0024595 | 3300046535 | Bacteria | 3220 |
| 452 | Ga0495633_0183904 | 3300046558 | Bacteria | 962 |
| 453 | Ga0495667_0781200 | 3300046559 | Bacteria | 589 |
| 454 | Ga0495656_0739499 | 3300046615 | Unclassified | 530 |
| 455 | Ga0495634_0011818 | 3300046642 | Bacteria | 6349 |
| 456 | Ga0495635_0860318 | 3300046663 | Bacteria | 582 |
| 457 | Ga0495659_0080321 | 3300046664 | Bacteria | 1237 |
| 458 | Ga0495647_0008341 | 3300046681 | Bacteria | 3482 |
| 459 | Ga0495658_0003805 | 3300046683 | Bacteria | 7473 |
| 460 | Ga0495613_0025942 | 3300046689 | Bacteria | 4366 |
| 461 | Ga0495670_0044607 | 3300046691 | Bacteria | 2214 |
| 462 | Ga0495636_0013911 | 3300047318 | Bacteria | 3197 |
| 463 | Ga0495674_0006526 | 3300047319 | Bacteria | 11195 |
| 464 | Ga0495680_0007903 | 3300047322 | Bacteria | 9706 |
| 465 | Ga0495684_0105238 | 3300047471 | Bacteria | 2132 |
| 466 | Ga0495593_0134558 | 3300047673 | Bacteria | 1254 |
| 467 | Ga0495614_0048945 | 3300048089 | Bacteria | 1812 |
| 468 | Ga0496100_0175105 | 3300048903 | Bacteria | 1548 |
| 469 | Ga0496101_0045795 | 3300048904 | Bacteria | 3135 |
| 470 | Ga0496101_0233359 | 3300048904 | Bacteria | 1431 |
| 471 | Ga0496101_1105086 | 3300048904 | Unclassified | 622 |
| 472 | Ga0496102_0129883 | 3300048905 | Bacteria | 2357 |
| 473 | Ga0496102_0180956 | 3300048905 | Bacteria | 1986 |
| 474 | Ga0496102_0309306 | 3300048905 | Bacteria | 1489 |
| 475 | Ga0496102_0389966 | 3300048905 | Bacteria | 1310 |
| 476 | Ga0496102_0679341 | 3300048905 | Bacteria | 953 |
| 477 | Ga0496102_1952564 | 3300048905 | Bacteria | 503 |
| 478 | Ga0496103_0036580 | 3300048906 | Bacteria | 3007 |
| 479 | Ga0496103_0180793 | 3300048906 | Bacteria | 1356 |
| 480 | Ga0496103_0299815 | 3300048906 | Bacteria | 1034 |
| 481 | Ga0496104_0099730 | 3300048907 | Bacteria | 2780 |
| 482 | Ga0496104_0203729 | 3300048907 | Bacteria | 1890 |
| 483 | Ga0496104_0618949 | 3300048907 | Bacteria | 992 |
| 484 | Ga0496105_0218864 | 3300048908 | Bacteria | 1550 |
| 485 | Ga0496105_0642879 | 3300048908 | Unclassified | 819 |
| 486 | Ga0496106_0023979 | 3300048909 | Bacteria | 4534 |
| 487 | Ga0496106_0025578 | 3300048909 | Bacteria | 4394 |
| 488 | Ga0496106_0050308 | 3300048909 | Bacteria | 3141 |
| 489 | Ga0496106_0423328 | 3300048909 | Bacteria | 1070 |
| 490 | Ga0496106_0810616 | 3300048909 | Bacteria | 742 |
| 491 | Ga0496106_0884025 | 3300048909 | Unclassified | 706 |
| 492 | Ga0496107_0162551 | 3300048910 | Bacteria | 1655 |
| 493 | Ga0496107_0191963 | 3300048910 | Bacteria | 1518 |
| 494 | Ga0496108_0007531 | 3300048911 | Bacteria | 8824 |
| 495 | Ga0496108_0020371 | 3300048911 | Bacteria | 5451 |
| 496 | Ga0496108_0030609 | 3300048911 | Bacteria | 4460 |
| 497 | Ga0496109_0001213 | 3300048912 | Bacteria | 21423 |
| 498 | Ga0496109_0007276 | 3300048912 | Bacteria | 9358 |
| 499 | Ga0496109_0110285 | 3300048912 | Bacteria | 2558 |
| 500 | Ga0496109_0344247 | 3300048912 | Bacteria | 1408 |
| 501 | Ga0496109_1074714 | 3300048912 | Bacteria | 742 |
| 502 | Ga0496110_0008231 | 3300048913 | Bacteria | 8381 |
| 503 | Ga0496110_0086073 | 3300048913 | Bacteria | 2805 |
| 504 | Ga0496110_0142950 | 3300048913 | Bacteria | 2163 |
| 505 | Ga0496110_0264039 | 3300048913 | Bacteria | 1567 |
| 506 | Ga0496111_0008696 | 3300048914 | Bacteria | 6736 |
| 507 | Ga0496112_0007045 | 3300048915 | Bacteria | 9933 |
| 508 | Ga0496112_0025715 | 3300048915 | Bacteria | 5653 |
| 509 | Ga0496112_0027925 | 3300048915 | Bacteria | 5443 |
| 510 | Ga0496112_0119722 | 3300048915 | Bacteria | 2603 |
| 511 | Ga0496113_0004956 | 3300048916 | Bacteria | 8247 |
| 512 | Ga0496113_0016734 | 3300048916 | Bacteria | 5071 |
| 513 | Ga0496113_0214674 | 3300048916 | Bacteria | 1532 |
| 514 | Ga0496114_0071341 | 3300048917 | Bacteria | 2919 |
| 515 | Ga0496114_0442687 | 3300048917 | Bacteria | 1151 |
| 516 | Ga0496114_0832360 | 3300048917 | Bacteria | 802 |
| 517 | Ga0501299_018040 | 3300049522 | Bacteria | 1265 |
| 518 | Ga0501031_0084686 | 3300049568 | Bacteria | 2067 |
| 519 | Ga0501033_0126833 | 3300049570 | Bacteria | 1850 |
| 520 | Ga0501036_0204346 | 3300049572 | Bacteria | 1661 |
| 521 | Ga0501036_0394311 | 3300049572 | Bacteria | 1155 |
| 522 | Ga0501037_0180745 | 3300049573 | Bacteria | 1497 |
| 523 | Ga0501037_0548433 | 3300049573 | Bacteria | 780 |
| 524 | Ga0501038_0123961 | 3300049574 | Bacteria | 2128 |
| 525 | Ga0501038_0200000 | 3300049574 | Bacteria | 1604 |
| 526 | Ga0501038_0590989 | 3300049574 | Bacteria | 841 |
| 527 | Ga0501038_0679909 | 3300049574 | Bacteria | 773 |
| 528 | Ga0501039_0074687 | 3300049575 | Bacteria | 2635 |
| 529 | Ga0501040_0099029 | 3300049576 | Bacteria | 2032 |
| 530 | Ga0501040_0202093 | 3300049576 | Bacteria | 1411 |
| 531 | Ga0501040_0632261 | 3300049576 | Bacteria | 773 |
| 532 | Ga0501040_1057784 | 3300049576 | Unclassified | 588 |
| 533 | Ga0501041_0045136 | 3300049577 | Bacteria | 2679 |
| 534 | Ga0501041_0584123 | 3300049577 | Unclassified | 713 |
| 535 | Ga0501042_0232881 | 3300049578 | Bacteria | 1329 |
| 536 | Ga0501043_0264848 | 3300049579 | Bacteria | 1321 |
| 537 | Ga0501043_1199064 | 3300049579 | Unclassified | 533 |
| 538 | Ga0501046_0123993 | 3300049580 | Bacteria | 1964 |
| 539 | Ga0501046_0151832 | 3300049580 | Bacteria | 1747 |
| 540 | Ga0501046_0306742 | 3300049580 | Bacteria | 1158 |
| 541 | Ga0501046_1041884 | 3300049580 | Unclassified | 567 |
| 542 | Ga0501048_0610630 | 3300049582 | Bacteria | 783 |
| 543 | Ga0501067_0027880 | 3300049583 | Bacteria | 3130 |
| 544 | Ga0501067_0081415 | 3300049583 | Bacteria | 1795 |
| 545 | Ga0501067_0128229 | 3300049583 | Bacteria | 1411 |
| 546 | Ga0501067_0326390 | 3300049583 | Bacteria | 855 |
| 547 | Ga0501068_0071844 | 3300049584 | Bacteria | 2113 |
| 548 | Ga0501068_0680197 | 3300049584 | Bacteria | 672 |
| 549 | Ga0501069_0045087 | 3300049585 | Bacteria | 2442 |
| 550 | Ga0501069_0132235 | 3300049585 | Bacteria | 1429 |
| 551 | Ga0501069_0271244 | 3300049585 | Bacteria | 992 |
| 552 | Ga0501070_0145673 | 3300049586 | Bacteria | 1955 |
| 553 | Ga0501071_0033094 | 3300049587 | Bacteria | 3673 |
| 554 | Ga0501072_0096123 | 3300049588 | Bacteria | 2354 |
| 555 | Ga0501074_0037332 | 3300049590 | Bacteria | 3522 |
| 556 | Ga0501074_0503850 | 3300049590 | Bacteria | 858 |
| 557 | Ga0501075_0015555 | 3300049591 | Bacteria | 5460 |
| 558 | Ga0501075_0360363 | 3300049591 | Bacteria | 1108 |
| 559 | Ga0501075_0882133 | 3300049591 | Unclassified | 680 |
| 560 | Ga0501075_0995661 | 3300049591 | Unclassified | 637 |
| 561 | Ga0501076_0075407 | 3300049592 | Bacteria | 2703 |
| 562 | Ga0501076_0173234 | 3300049592 | Bacteria | 1759 |
| 563 | Ga0501076_0214594 | 3300049592 | Bacteria | 1573 |
| 564 | Ga0501076_0306918 | 3300049592 | Bacteria | 1301 |
| 565 | Ga0501076_0396839 | 3300049592 | Bacteria | 1134 |
| 566 | Ga0501076_1508785 | 3300049592 | Unclassified | 552 |
| 567 | Ga0501077_0001177 | 3300049593 | Bacteria | 15828 |
| 568 | Ga0501077_0043784 | 3300049593 | Bacteria | 2845 |
| 569 | Ga0501077_0051951 | 3300049593 | Bacteria | 2603 |
| 570 | Ga0501077_0359910 | 3300049593 | Bacteria | 929 |
| 571 | Ga0501077_0718566 | 3300049593 | Unclassified | 642 |
| 572 | Ga0501199_005575 | 3300049650 | Bacteria | 1266 |
| 573 | Ga0501209_033028 | 3300049656 | Bacteria | 1325 |
| 574 | Ga0501209_035671 | 3300049656 | Bacteria | 1289 |
| 575 | Ga0501209_057390 | 3300049656 | Bacteria | 1078 |
| 576 | Ga0501209_142989 | 3300049656 | Bacteria | 718 |
| 577 | Ga0501211_025768 | 3300049658 | Bacteria | 640 |
| 578 | Ga0501216_027457 | 3300049660 | Bacteria | 1033 |
| 579 | Ga0501217_015539 | 3300049661 | Bacteria | 1735 |
| 580 | Ga0501233_018413 | 3300049668 | Bacteria | 1469 |
| 581 | Ga0501233_023535 | 3300049668 | Bacteria | 1340 |
| 582 | Ga0501243_030647 | 3300049675 | Bacteria | 917 |
| 583 | Ga0501247_024646 | 3300049677 | Bacteria | 797 |
| 584 | Ga0501249_016756 | 3300049679 | Bacteria | 1575 |
| 585 | Ga0501249_046991 | 3300049679 | Bacteria | 987 |
| 586 | Ga0501249_091688 | 3300049679 | Bacteria | 721 |
| 587 | Ga0501249_099465 | 3300049679 | Bacteria | 695 |
| 588 | Ga0501251_014722 | 3300049681 | Unclassified | 975 |
| 589 | Ga0501253_106327 | 3300049683 | Unclassified | 664 |
| 590 | Ga0501257_096248 | 3300049686 | Bacteria | 774 |
| 591 | Ga0501258_001408 | 3300049687 | Bacteria | 1958 |
| 592 | Ga0501221_010769 | 3300049704 | Bacteria | 1632 |
| 593 | Ga0501225_0028841 | 3300049705 | Bacteria | 1525 |
| 594 | Ga0501079_0069364 | 3300049741 | Bacteria | 2721 |
| 595 | Ga0501079_0148048 | 3300049741 | Bacteria | 1830 |
| 596 | Ga0501079_0165543 | 3300049741 | Bacteria | 1724 |
| 597 | Ga0501079_0201756 | 3300049741 | Bacteria | 1553 |
| 598 | Ga0501079_0451523 | 3300049741 | Bacteria | 1009 |
| 599 | Ga0501080_0147413 | 3300049742 | Bacteria | 2176 |
| 600 | Ga0501080_0481241 | 3300049742 | Bacteria | 1111 |
| 601 | Ga0501080_0760252 | 3300049742 | Bacteria | 852 |
| 602 | Ga0501081_0093036 | 3300049743 | Bacteria | 2122 |
| 603 | Ga0501081_0123029 | 3300049743 | Bacteria | 1849 |
| 604 | Ga0501081_0169682 | 3300049743 | Bacteria | 1575 |
| 605 | Ga0501081_0235482 | 3300049743 | Bacteria | 1334 |
| 606 | Ga0501081_0235671 | 3300049743 | Bacteria | 1334 |
| 607 | Ga0501083_0126016 | 3300049744 | Bacteria | 1679 |
| 608 | Ga0501083_0897602 | 3300049744 | Unclassified | 577 |
| 609 | Ga0501264_020928 | 3300049761 | Bacteria | 695 |
| 610 | Ga0501266_029634 | 3300049763 | Bacteria | 777 |
| 611 | Ga0501267_005648 | 3300049764 | Bacteria | 1188 |
| 612 | Ga0501270_025212 | 3300049767 | Bacteria | 940 |
| 613 | Ga0501273_009919 | 3300049770 | Bacteria | 1163 |
| 614 | Ga0501276_035464 | 3300049773 | Unclassified | 538 |
| 615 | Ga0501283_006872 | 3300049779 | Bacteria | 1606 |
| 616 | Ga0501283_024292 | 3300049779 | Bacteria | 987 |
| 617 | Ga0501035_0229845 | 3300049822 | Bacteria | 1581 |
| 618 | Ga0501035_1318551 | 3300049822 | Bacteria | 556 |
| 619 | Ga0501045_0056535 | 3300049824 | Bacteria | 2870 |
| 620 | Ga0501045_0120708 | 3300049824 | Bacteria | 1946 |
| 621 | Ga0501045_0252193 | 3300049824 | Bacteria | 1313 |
| 622 | Ga0501045_0716859 | 3300049824 | Unclassified | 738 |
| 623 | Ga0501204_009290 | 3300049850 | Bacteria | 1134 |
| 624 | Ga0501212_029659 | 3300049851 | Bacteria | 878 |
| 625 | nmdc:mga05p37_148079_c1 | 3300050507 | Bacteria | 2873 |
| 626 | nmdc:mga05p37_1933540_c1 | 3300050507 | Unclassified | 562 |
| 627 | nmdc:mga05p37_291525_c1 | 3300050507 | Bacteria | 1280 |
| 628 | nmdc:mga05p37_694322_c1 | 3300050507 | Bacteria | 1132 |
| 629 | nmdc:mga05p37_715376_c1 | 3300050507 | Bacteria | 1110 |
| 630 | nmdc:mga05p37_934377_c1 | 3300050507 | Bacteria | 930 |
| 631 | nmdc:mga09592_568948_c1 | 3300050508 | Bacteria | 972 |
| 632 | nmdc:mga09592_59953_c1 | 3300050508 | Bacteria | 3217 |
| 633 | nmdc:mga0qj67_278760_c1 | 3300050509 | Bacteria | 1355 |
| 634 | nmdc:mga0qj67_7368_c1 | 3300050509 | Bacteria | 8133 |
| 635 | nmdc:mga06r32_1218704_c1 | 3300050510 | Bacteria | 698 |
| 636 | nmdc:mga06r32_342801_c1 | 3300050510 | Bacteria | 1479 |
| 637 | nmdc:mga06r32_511208_c1 | 3300050510 | Bacteria | 1177 |
| 638 | nmdc:mga06r32_864959_c1 | 3300050510 | Bacteria | 862 |
| 639 | nmdc:mga08y16_281292_c1 | 3300050511 | Bacteria | 1716 |
| 640 | nmdc:mga08y16_415585_c1 | 3300050511 | Bacteria | 1375 |
| 641 | nmdc:mga08y16_621829_c1 | 3300050511 | Bacteria | 1087 |
| 642 | nmdc:mga0n895_1319348_c1 | 3300050512 | Bacteria | 692 |
| 643 | nmdc:mga0n895_295528_c1 | 3300050512 | Bacteria | 1642 |
| 644 | nmdc:mga0n895_569961_c1 | 3300050512 | Bacteria | 1137 |
| 645 | nmdc:mga0rr50_643794_c1 | 3300050513 | Bacteria | 904 |
| 646 | nmdc:mga0rr50_934934_c1 | 3300050513 | Bacteria | 739 |
| 647 | nmdc:mga0a205_40614_c1 | 3300050515 | Bacteria | 4479 |
| 648 | nmdc:mga0a205_85608_c1 | 3300050515 | Bacteria | 3044 |
| 649 | Ga0501084_0006598 | 3300054114 | Bacteria | 9538 |
| 650 | Ga0501084_0320495 | 3300054114 | Bacteria | 1309 |
| 651 | Ga0501084_0559492 | 3300054114 | Bacteria | 966 |
| 652 | Ga0590071_001573 | 3300059421 | Bacteria | 5973 |
| 653 | Ga0590071_002778 | 3300059421 | Bacteria | 4384 |
| 654 | Ga0590071_012194 | 3300059421 | Bacteria | 2014 |
| 655 | Ga0590071_039033 | 3300059421 | Bacteria | 1141 |
| 656 | Ga0590071_066097 | 3300059421 | Bacteria | 888 |
| 657 | Ga0590074_028681 | 3300059423 | Bacteria | 978 |
| 658 | Ga0590075_024941 | 3300059424 | Bacteria | 1502 |
| 659 | Ga0590075_037947 | 3300059424 | Bacteria | 1229 |
| 660 | Ga0590077_050286 | 3300059426 | Bacteria | 935 |
| 661 | Ga0590077_083583 | 3300059426 | Bacteria | 736 |
| 662 | Ga0587066_056959 | 3300059490 | Bacteria | 787 |
| 663 | Ga0501082_0064431 | 3300060353 | Bacteria | 3156 |
| 664 | Ga0501082_1011507 | 3300060353 | Bacteria | 727 |
| 665 | Ga0501082_1371747 | 3300060353 | Bacteria | 617 |
| 666 | Ga0501082_1443506 | 3300060353 | Unclassified | 601 |
| 667 | Ga0501082_1785689 | 3300060353 | Bacteria | 536 |
| 668 | Ga0530510_0200281 | 3300061734 | Bacteria | 1483 |
| 669 | Ga0530510_0394416 | 3300061734 | Bacteria | 1043 |
| 670 | Ga0530510_0417474 | 3300061734 | Bacteria | 1013 |
| 671 | Ga0530510_0598932 | 3300061734 | Bacteria | 838 |
| 672 | Ga0530510_0882050 | 3300061734 | Bacteria | 683 |
| 673 | Ga0530510_1245687 | 3300061734 | Bacteria | 570 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005356 | Ga0070674_100002772 | Ga0070674_1000027722 | 82 |
| 2 | 3300005445 | Ga0070708_101901325 | Ga0070708_1019013251 | 82 |
| 3 | 3300005459 | Ga0068867_100001444 | Ga0068867_10000144410 | 82 |
| 4 | 3300005467 | Ga0070706_100268398 | Ga0070706_1002683982 | 82 |
| 5 | 3300005468 | Ga0070707_100069499 | Ga0070707_1000694992 | 82 |
| 6 | 3300005471 | Ga0070698_100139002 | Ga0070698_1001390022 | 82 |
| 7 | 3300005518 | Ga0070699_100008009 | Ga0070699_1000080098 | 82 |
| 8 | 3300005618 | Ga0068864_100001101 | Ga0068864_10000110121 | 82 |
| 9 | 3300005718 | Ga0068866_10000165 | Ga0068866_1000016519 | 82 |
| 10 | 3300006358 | Ga0068871_100094094 | Ga0068871_1000940942 | 82 |
| 11 | 3300006881 | Ga0068865_100001488 | Ga0068865_10000148813 | 82 |
| 12 | 3300025907 | Ga0207645_10000654 | Ga0207645_1000065431 | 82 |
| 13 | 3300025921 | Ga0207652_10558367 | Ga0207652_105583672 | 82 |
| 14 | 3300025922 | Ga0207646_10047328 | Ga0207646_100473283 | 82 |
| 15 | 3300025927 | Ga0207687_10149457 | Ga0207687_101494572 | 82 |
| 16 | 3300025933 | Ga0207706_10000244 | Ga0207706_1000024412 | 82 |
| 17 | 3300025934 | Ga0207686_10000739 | Ga0207686_100007399 | 82 |
| 18 | 3300025937 | Ga0207669_10000951 | Ga0207669_1000095111 | 82 |
| 19 | 3300025942 | Ga0207689_10004763 | Ga0207689_100047633 | 82 |
| 20 | 3300026089 | Ga0207648_10000273 | Ga0207648_1000027349 | 82 |
| 21 | 3300026095 | Ga0207676_10251708 | Ga0207676_102517081 | 82 |
| 22 | 3300026121 | Ga0207683_10006669 | Ga0207683_100066698 | 82 |
| 23 | 3300032002 | Ga0307416_101529157 | Ga0307416_1015291572 | 82 |
| 24 | 3300036401 | Ga0373937_0117801 | Ga0373937_0117801_686_934 | 82 |
| 25 | 3300046454 | Ga0495592_0240070 | Ga0495592_0240070_450_698 | 82 |
| 26 | 3300046461 | Ga0495641_0042347 | Ga0495641_0042347_1446_1694 | 82 |
| 27 | 3300046473 | Ga0495582_0176355 | Ga0495582_0176355_103_351 | 82 |
| 28 | 3300046475 | Ga0495639_0164715 | Ga0495639_0164715_505_753 | 82 |
| 29 | 3300046477 | Ga0495664_0010407 | Ga0495664_0010407_3128_3376 | 82 |
| 30 | 3300046499 | Ga0495594_0009149 | Ga0495594_0009149_280_528 | 82 |
| 31 | 3300046514 | Ga0495618_0005880 | Ga0495618_0005880_4400_4648 | 82 |
| 32 | 3300046517 | Ga0495630_0017989 | Ga0495630_0017989_3033_3281 | 82 |
| 33 | 3300046526 | Ga0495666_0018868 | Ga0495666_0018868_601_849 | 82 |
| 34 | 3300046533 | Ga0495640_0003406 | Ga0495640_0003406_6024_6272 | 82 |
| 35 | 3300046535 | Ga0495586_0024595 | Ga0495586_0024595_2894_3142 | 82 |
| 36 | 3300046559 | Ga0495667_0781200 | Ga0495667_0781200_168_416 | 82 |
| 37 | 3300046642 | Ga0495634_0011818 | Ga0495634_0011818_6064_6312 | 82 |
| 38 | 3300046663 | Ga0495635_0860318 | Ga0495635_0860318_182_430 | 82 |
| 39 | 3300046681 | Ga0495647_0008341 | Ga0495647_0008341_392_640 | 82 |
| 40 | 3300046683 | Ga0495658_0003805 | Ga0495658_0003805_5352_5600 | 82 |
| 41 | 3300046689 | Ga0495613_0025942 | Ga0495613_0025942_2440_2688 | 82 |
| 42 | 3300047319 | Ga0495674_0006526 | Ga0495674_0006526_4870_5118 | 82 |
| 43 | 3300047322 | Ga0495680_0007903 | Ga0495680_0007903_4169_4417 | 82 |
| 44 | 3300047471 | Ga0495684_0105238 | Ga0495684_0105238_1378_1626 | 82 |
| 45 | 3300047673 | Ga0495593_0134558 | Ga0495593_0134558_324_572 | 82 |
| 46 | 3300048089 | Ga0495614_0048945 | Ga0495614_0048945_1191_1439 | 82 |
| 47 | 3300048917 | Ga0496114_0832360 | Ga0496114_0832360_541_789 | 82 |
| 48 | 3300035084 | Ga0373928_0014865 | Ga0373928_0014865_1085_1336 | 83 |
| 49 | 3300048909 | Ga0496106_0884025 | Ga0496106_0884025_28_279 | 83 |
| 50 | 3300048917 | Ga0496114_0442687 | Ga0496114_0442687_875_1126 | 83 |
| 51 | 3300049579 | Ga0501043_1199064 | Ga0501043_1199064_248_499 | 83 |
| 52 | 3300049582 | Ga0501048_0610630 | Ga0501048_0610630_10_261 | 83 |
| 53 | 3300049592 | Ga0501076_0396839 | Ga0501076_0396839_858_1109 | 83 |
| 54 | 3300049592 | Ga0501076_1508785 | Ga0501076_1508785_277_528 | 83 |
| 55 | 3300049743 | Ga0501081_0093036 | Ga0501081_0093036_32_283 | 83 |
| 56 | 3300060353 | Ga0501082_1371747 | Ga0501082_1371747_24_275 | 83 |
| 57 | 3300005295 | Ga0065707_10466576 | Ga0065707_104665761 | 96 |
| 58 | 3300005328 | Ga0070676_10039684 | Ga0070676_100396842 | 96 |
| 59 | 3300005330 | Ga0070690_100056417 | Ga0070690_1000564172 | 96 |
| 60 | 3300005333 | Ga0070677_10127839 | Ga0070677_101278392 | 96 |
| 61 | 3300005334 | Ga0068869_100007142 | Ga0068869_1000071425 | 96 |
| 62 | 3300005335 | Ga0070666_10057226 | Ga0070666_100572263 | 96 |
| 63 | 3300005336 | Ga0070680_100390387 | Ga0070680_1003903872 | 96 |
| 64 | 3300005336 | Ga0070680_100931858 | Ga0070680_1009318582 | 96 |
| 65 | 3300005336 | Ga0070680_101874526 | Ga0070680_1018745261 | 96 |
| 66 | 3300005341 | Ga0070691_10008925 | Ga0070691_100089252 | 96 |
| 67 | 3300005341 | Ga0070691_10049859 | Ga0070691_100498591 | 96 |
| 68 | 3300005344 | Ga0070661_100433319 | Ga0070661_1004333192 | 96 |
| 69 | 3300005345 | Ga0070692_10062581 | Ga0070692_100625812 | 96 |
| 70 | 3300005353 | Ga0070669_100739979 | Ga0070669_1007399792 | 96 |
| 71 | 3300005354 | Ga0070675_100345992 | Ga0070675_1003459922 | 96 |
| 72 | 3300005355 | Ga0070671_100333480 | Ga0070671_1003334802 | 96 |
| 73 | 3300005364 | Ga0070673_102224785 | Ga0070673_1022247851 | 96 |
| 74 | 3300005367 | Ga0070667_100029374 | Ga0070667_1000293742 | 96 |
| 75 | 3300005367 | Ga0070667_100183574 | Ga0070667_1001835742 | 96 |
| 76 | 3300005367 | Ga0070667_101163471 | Ga0070667_1011634712 | 96 |
| 77 | 3300005406 | Ga0070703_10141841 | Ga0070703_101418412 | 96 |
| 78 | 3300005437 | Ga0070710_10378022 | Ga0070710_103780222 | 96 |
| 79 | 3300005438 | Ga0070701_10130807 | Ga0070701_101308072 | 96 |
| 80 | 3300005438 | Ga0070701_10178718 | Ga0070701_101787181 | 96 |
| 81 | 3300005439 | Ga0070711_100079919 | Ga0070711_1000799192 | 96 |
| 82 | 3300005439 | Ga0070711_100513021 | Ga0070711_1005130211 | 96 |
| 83 | 3300005440 | Ga0070705_100006861 | Ga0070705_1000068614 | 96 |
| 84 | 3300005440 | Ga0070705_100010366 | Ga0070705_1000103662 | 96 |
| 85 | 3300005440 | Ga0070705_100035580 | Ga0070705_1000355803 | 96 |
| 86 | 3300005440 | Ga0070705_100368171 | Ga0070705_1003681712 | 96 |
| 87 | 3300005440 | Ga0070705_100818014 | Ga0070705_1008180142 | 96 |
| 88 | 3300005440 | Ga0070705_100885179 | Ga0070705_1008851791 | 96 |
| 89 | 3300005441 | Ga0070700_100091200 | Ga0070700_1000912002 | 96 |
| 90 | 3300005441 | Ga0070700_100093439 | Ga0070700_1000934392 | 96 |
| 91 | 3300005441 | Ga0070700_101214915 | Ga0070700_1012149151 | 96 |
| 92 | 3300005444 | Ga0070694_100214296 | Ga0070694_1002142962 | 96 |
| 93 | 3300005444 | Ga0070694_100550160 | Ga0070694_1005501602 | 96 |
| 94 | 3300005444 | Ga0070694_101455798 | Ga0070694_1014557981 | 96 |
| 95 | 3300005444 | Ga0070694_101888520 | Ga0070694_1018885201 | 96 |
| 96 | 3300005445 | Ga0070708_100168293 | Ga0070708_1001682932 | 96 |
| 97 | 3300005445 | Ga0070708_100403511 | Ga0070708_1004035112 | 96 |
| 98 | 3300005445 | Ga0070708_100610896 | Ga0070708_1006108961 | 96 |
| 99 | 3300005445 | Ga0070708_101156705 | Ga0070708_1011567052 | 96 |
| 100 | 3300005445 | Ga0070708_101323539 | Ga0070708_1013235391 | 96 |
| 101 | 3300005445 | Ga0070708_102118961 | Ga0070708_1021189611 | 96 |
| 102 | 3300005455 | Ga0070663_100756666 | Ga0070663_1007566662 | 96 |
| 103 | 3300005456 | Ga0070678_100021674 | Ga0070678_1000216742 | 96 |
| 104 | 3300005457 | Ga0070662_100009215 | Ga0070662_1000092156 | 96 |
| 105 | 3300005458 | Ga0070681_10140844 | Ga0070681_101408442 | 96 |
| 106 | 3300005459 | Ga0068867_101600290 | Ga0068867_1016002901 | 96 |
| 107 | 3300005467 | Ga0070706_100321284 | Ga0070706_1003212842 | 96 |
| 108 | 3300005467 | Ga0070706_100421079 | Ga0070706_1004210792 | 96 |
| 109 | 3300005467 | Ga0070706_101144740 | Ga0070706_1011447402 | 96 |
| 110 | 3300005468 | Ga0070707_100247277 | Ga0070707_1002472772 | 96 |
| 111 | 3300005471 | Ga0070698_100111517 | Ga0070698_1001115173 | 96 |
| 112 | 3300005471 | Ga0070698_100177798 | Ga0070698_1001777984 | 96 |
| 113 | 3300005471 | Ga0070698_100223466 | Ga0070698_1002234662 | 96 |
| 114 | 3300005471 | Ga0070698_100478860 | Ga0070698_1004788602 | 96 |
| 115 | 3300005471 | Ga0070698_100873454 | Ga0070698_1008734542 | 96 |
| 116 | 3300005471 | Ga0070698_101139768 | Ga0070698_1011397682 | 96 |
| 117 | 3300005471 | Ga0070698_101227612 | Ga0070698_1012276122 | 96 |
| 118 | 3300005518 | Ga0070699_100093310 | Ga0070699_1000933102 | 96 |
| 119 | 3300005518 | Ga0070699_100135473 | Ga0070699_1001354733 | 96 |
| 120 | 3300005518 | Ga0070699_100213972 | Ga0070699_1002139722 | 96 |
| 121 | 3300005518 | Ga0070699_100909395 | Ga0070699_1009093952 | 96 |
| 122 | 3300005518 | Ga0070699_100959528 | Ga0070699_1009595282 | 96 |
| 123 | 3300005518 | Ga0070699_101181099 | Ga0070699_1011810992 | 96 |
| 124 | 3300005530 | Ga0070679_100311117 | Ga0070679_1003111172 | 96 |
| 125 | 3300005530 | Ga0070679_100715931 | Ga0070679_1007159312 | 96 |
| 126 | 3300005535 | Ga0070684_101966803 | Ga0070684_1019668032 | 96 |
| 127 | 3300005536 | Ga0070697_100021236 | Ga0070697_1000212363 | 96 |
| 128 | 3300005536 | Ga0070697_100101706 | Ga0070697_1001017062 | 96 |
| 129 | 3300005536 | Ga0070697_101075305 | Ga0070697_1010753052 | 96 |
| 130 | 3300005536 | Ga0070697_101295682 | Ga0070697_1012956822 | 96 |
| 131 | 3300005536 | Ga0070697_101388814 | Ga0070697_1013888142 | 96 |
| 132 | 3300005539 | Ga0068853_100226078 | Ga0068853_1002260782 | 96 |
| 133 | 3300005544 | Ga0070686_100263258 | Ga0070686_1002632581 | 96 |
| 134 | 3300005544 | Ga0070686_100637300 | Ga0070686_1006373001 | 96 |
| 135 | 3300005545 | Ga0070695_100075529 | Ga0070695_1000755292 | 96 |
| 136 | 3300005545 | Ga0070695_100984403 | Ga0070695_1009844032 | 96 |
| 137 | 3300005545 | Ga0070695_101660756 | Ga0070695_1016607561 | 96 |
| 138 | 3300005546 | Ga0070696_100004439 | Ga0070696_1000044394 | 96 |
| 139 | 3300005546 | Ga0070696_100017620 | Ga0070696_1000176203 | 96 |
| 140 | 3300005546 | Ga0070696_100037557 | Ga0070696_1000375572 | 96 |
| 141 | 3300005546 | Ga0070696_100481052 | Ga0070696_1004810522 | 96 |
| 142 | 3300005546 | Ga0070696_100645460 | Ga0070696_1006454601 | 96 |
| 143 | 3300005546 | Ga0070696_100788547 | Ga0070696_1007885471 | 96 |
| 144 | 3300005546 | Ga0070696_101228531 | Ga0070696_1012285312 | 96 |
| 145 | 3300005547 | Ga0070693_100321367 | Ga0070693_1003213672 | 96 |
| 146 | 3300005549 | Ga0070704_100063496 | Ga0070704_1000634962 | 96 |
| 147 | 3300005549 | Ga0070704_100178041 | Ga0070704_1001780412 | 96 |
| 148 | 3300005549 | Ga0070704_101298325 | Ga0070704_1012983251 | 96 |
| 149 | 3300005563 | Ga0068855_102183438 | Ga0068855_1021834381 | 96 |
| 150 | 3300005564 | Ga0070664_100162182 | Ga0070664_1001621822 | 96 |
| 151 | 3300005564 | Ga0070664_102118803 | Ga0070664_1021188032 | 96 |
| 152 | 3300005577 | Ga0068857_100050518 | Ga0068857_1000505182 | 96 |
| 153 | 3300005577 | Ga0068857_100193092 | Ga0068857_1001930922 | 96 |
| 154 | 3300005577 | Ga0068857_100617212 | Ga0068857_1006172121 | 96 |
| 155 | 3300005578 | Ga0068854_100010148 | Ga0068854_1000101482 | 96 |
| 156 | 3300005578 | Ga0068854_100953849 | Ga0068854_1009538492 | 96 |
| 157 | 3300005617 | Ga0068859_100076240 | Ga0068859_1000762402 | 96 |
| 158 | 3300005617 | Ga0068859_102380627 | Ga0068859_1023806271 | 96 |
| 159 | 3300005618 | Ga0068864_100112228 | Ga0068864_1001122281 | 96 |
| 160 | 3300005618 | Ga0068864_101009605 | Ga0068864_1010096052 | 96 |
| 161 | 3300005719 | Ga0068861_100101728 | Ga0068861_1001017282 | 96 |
| 162 | 3300005719 | Ga0068861_100243708 | Ga0068861_1002437082 | 96 |
| 163 | 3300005719 | Ga0068861_100549133 | Ga0068861_1005491332 | 96 |
| 164 | 3300005719 | Ga0068861_101418099 | Ga0068861_1014180992 | 96 |
| 165 | 3300005719 | Ga0068861_101772230 | Ga0068861_1017722301 | 96 |
| 166 | 3300005840 | Ga0068870_10066682 | Ga0068870_100666822 | 96 |
| 167 | 3300005841 | Ga0068863_100076993 | Ga0068863_1000769932 | 96 |
| 168 | 3300005841 | Ga0068863_100400310 | Ga0068863_1004003102 | 96 |
| 169 | 3300005842 | Ga0068858_100080197 | Ga0068858_1000801972 | 96 |
| 170 | 3300005842 | Ga0068858_101286174 | Ga0068858_1012861742 | 96 |
| 171 | 3300005843 | Ga0068860_100685615 | Ga0068860_1006856152 | 96 |
| 172 | 3300005843 | Ga0068860_100756488 | Ga0068860_1007564882 | 96 |
| 173 | 3300005843 | Ga0068860_100862405 | Ga0068860_1008624052 | 96 |
| 174 | 3300005843 | Ga0068860_101360423 | Ga0068860_1013604232 | 96 |
| 175 | 3300005843 | Ga0068860_101531584 | Ga0068860_1015315842 | 96 |
| 176 | 3300005844 | Ga0068862_101424342 | Ga0068862_1014243422 | 96 |
| 177 | 3300005981 | Ga0081538_10026610 | Ga0081538_100266102 | 96 |
| 178 | 3300006163 | Ga0070715_10229749 | Ga0070715_102297492 | 96 |
| 179 | 3300006173 | Ga0070716_101537939 | Ga0070716_1015379392 | 96 |
| 180 | 3300006175 | Ga0070712_100135387 | Ga0070712_1001353872 | 96 |
| 181 | 3300006237 | Ga0097621_100574481 | Ga0097621_1005744811 | 96 |
| 182 | 3300006237 | Ga0097621_101172255 | Ga0097621_1011722552 | 96 |
| 183 | 3300006844 | Ga0075428_100540701 | Ga0075428_1005407012 | 96 |
| 184 | 3300006844 | Ga0075428_102000718 | Ga0075428_1020007182 | 96 |
| 185 | 3300006844 | Ga0075428_102172427 | Ga0075428_1021724272 | 96 |
| 186 | 3300006846 | Ga0075430_100014773 | Ga0075430_1000147733 | 96 |
| 187 | 3300006846 | Ga0075430_100282639 | Ga0075430_1002826392 | 96 |
| 188 | 3300006846 | Ga0075430_100584295 | Ga0075430_1005842952 | 96 |
| 189 | 3300006847 | Ga0075431_100589047 | Ga0075431_1005890472 | 96 |
| 190 | 3300006847 | Ga0075431_101106014 | Ga0075431_1011060142 | 96 |
| 191 | 3300006852 | Ga0075433_10019313 | Ga0075433_100193132 | 96 |
| 192 | 3300006852 | Ga0075433_10142207 | Ga0075433_101422072 | 96 |
| 193 | 3300006852 | Ga0075433_11323646 | Ga0075433_113236462 | 96 |
| 194 | 3300006871 | Ga0075434_100197634 | Ga0075434_1001976342 | 96 |
| 195 | 3300006871 | Ga0075434_100402723 | Ga0075434_1004027232 | 96 |
| 196 | 3300006871 | Ga0075434_100747493 | Ga0075434_1007474932 | 96 |
| 197 | 3300006880 | Ga0075429_100063000 | Ga0075429_1000630003 | 96 |
| 198 | 3300006881 | Ga0068865_100922293 | Ga0068865_1009222932 | 96 |
| 199 | 3300006881 | Ga0068865_101695285 | Ga0068865_1016952851 | 96 |
| 200 | 3300006931 | Ga0097620_100076241 | Ga0097620_1000762412 | 96 |
| 201 | 3300006931 | Ga0097620_102380800 | Ga0097620_1023808001 | 96 |
| 202 | 3300007076 | Ga0075435_100513852 | Ga0075435_1005138522 | 96 |
| 203 | 3300007076 | Ga0075435_101166192 | Ga0075435_1011661922 | 96 |
| 204 | 3300009093 | Ga0105240_10032020 | Ga0105240_100320205 | 96 |
| 205 | 3300009094 | Ga0111539_10245983 | Ga0111539_102459832 | 96 |
| 206 | 3300009094 | Ga0111539_10332026 | Ga0111539_103320262 | 96 |
| 207 | 3300009094 | Ga0111539_10702318 | Ga0111539_107023182 | 96 |
| 208 | 3300009098 | Ga0105245_11937848 | Ga0105245_119378482 | 96 |
| 209 | 3300009101 | Ga0105247_10148183 | Ga0105247_101481831 | 96 |
| 210 | 3300009147 | Ga0114129_10209150 | Ga0114129_102091503 | 96 |
| 211 | 3300009147 | Ga0114129_10499446 | Ga0114129_104994462 | 96 |
| 212 | 3300009147 | Ga0114129_10817652 | Ga0114129_108176522 | 96 |
| 213 | 3300009147 | Ga0114129_11081202 | Ga0114129_110812022 | 96 |
| 214 | 3300009147 | Ga0114129_11351122 | Ga0114129_113511222 | 96 |
| 215 | 3300009147 | Ga0114129_12621611 | Ga0114129_126216111 | 96 |
| 216 | 3300009148 | Ga0105243_10034312 | Ga0105243_100343122 | 96 |
| 217 | 3300009148 | Ga0105243_10769122 | Ga0105243_107691222 | 96 |
| 218 | 3300009174 | Ga0105241_10006643 | Ga0105241_100066438 | 96 |
| 219 | 3300009176 | Ga0105242_10012015 | Ga0105242_100120152 | 96 |
| 220 | 3300009176 | Ga0105242_10566914 | Ga0105242_105669142 | 96 |
| 221 | 3300009177 | Ga0105248_10047348 | Ga0105248_100473484 | 96 |
| 222 | 3300009177 | Ga0105248_11911070 | Ga0105248_119110702 | 96 |
| 223 | 3300009551 | Ga0105238_10844137 | Ga0105238_108441372 | 96 |
| 224 | 3300009553 | Ga0105249_10058065 | Ga0105249_100580654 | 96 |
| 225 | 3300009553 | Ga0105249_10248890 | Ga0105249_102488902 | 96 |
| 226 | 3300010375 | Ga0105239_10023083 | Ga0105239_100230835 | 96 |
| 227 | 3300010375 | Ga0105239_13221016 | Ga0105239_132210161 | 96 |
| 228 | 3300011119 | Ga0105246_10089636 | Ga0105246_100896361 | 96 |
| 229 | 3300011119 | Ga0105246_10254083 | Ga0105246_102540832 | 96 |
| 230 | 3300013102 | Ga0157371_10021369 | Ga0157371_100213693 | 96 |
| 231 | 3300013102 | Ga0157371_11055541 | Ga0157371_110555412 | 96 |
| 232 | 3300013297 | Ga0157378_10075301 | Ga0157378_100753012 | 96 |
| 233 | 3300013306 | Ga0163162_11390379 | Ga0163162_113903792 | 96 |
| 234 | 3300013306 | Ga0163162_11902536 | Ga0163162_119025362 | 96 |
| 235 | 3300013308 | Ga0157375_10379332 | Ga0157375_103793322 | 96 |
| 236 | 3300013308 | Ga0157375_10617099 | Ga0157375_106170992 | 96 |
| 237 | 3300014325 | Ga0163163_10041997 | Ga0163163_100419975 | 96 |
| 238 | 3300014325 | Ga0163163_11051267 | Ga0163163_110512672 | 96 |
| 239 | 3300014325 | Ga0163163_12931526 | Ga0163163_129315262 | 96 |
| 240 | 3300014326 | Ga0157380_10496428 | Ga0157380_104964282 | 96 |
| 241 | 3300014326 | Ga0157380_11228549 | Ga0157380_112285492 | 96 |
| 242 | 3300014497 | Ga0182008_10544871 | Ga0182008_105448711 | 96 |
| 243 | 3300014745 | Ga0157377_11560736 | Ga0157377_115607361 | 96 |
| 244 | 3300014968 | Ga0157379_10077664 | Ga0157379_100776642 | 96 |
| 245 | 3300014968 | Ga0157379_10126392 | Ga0157379_101263922 | 96 |
| 246 | 3300014968 | Ga0157379_10450366 | Ga0157379_104503662 | 96 |
| 247 | 3300014968 | Ga0157379_11613073 | Ga0157379_116130732 | 96 |
| 248 | 3300014969 | Ga0157376_10694168 | Ga0157376_106941682 | 96 |
| 249 | 3300017792 | Ga0163161_10110208 | Ga0163161_101102082 | 96 |
| 250 | 3300017792 | Ga0163161_11493349 | Ga0163161_114933491 | 96 |
| 251 | 3300025885 | Ga0207653_10052792 | Ga0207653_100527922 | 96 |
| 252 | 3300025893 | Ga0207682_10158218 | Ga0207682_101582182 | 96 |
| 253 | 3300025899 | Ga0207642_10001600 | Ga0207642_100016002 | 96 |
| 254 | 3300025901 | Ga0207688_10542386 | Ga0207688_105423862 | 96 |
| 255 | 3300025903 | Ga0207680_10051914 | Ga0207680_100519142 | 96 |
| 256 | 3300025905 | Ga0207685_10029835 | Ga0207685_100298352 | 96 |
| 257 | 3300025908 | Ga0207643_10018495 | Ga0207643_100184952 | 96 |
| 258 | 3300025910 | Ga0207684_10209514 | Ga0207684_102095142 | 96 |
| 259 | 3300025910 | Ga0207684_10278157 | Ga0207684_102781572 | 96 |
| 260 | 3300025910 | Ga0207684_10486627 | Ga0207684_104866272 | 96 |
| 261 | 3300025910 | Ga0207684_10644146 | Ga0207684_106441462 | 96 |
| 262 | 3300025911 | Ga0207654_10022254 | Ga0207654_100222541 | 96 |
| 263 | 3300025913 | Ga0207695_10078707 | Ga0207695_100787072 | 96 |
| 264 | 3300025915 | Ga0207693_10116841 | Ga0207693_101168412 | 96 |
| 265 | 3300025915 | Ga0207693_10518527 | Ga0207693_105185272 | 96 |
| 266 | 3300025916 | Ga0207663_10096574 | Ga0207663_100965742 | 96 |
| 267 | 3300025916 | Ga0207663_10224832 | Ga0207663_102248321 | 96 |
| 268 | 3300025917 | Ga0207660_10065876 | Ga0207660_100658762 | 96 |
| 269 | 3300025917 | Ga0207660_10316595 | Ga0207660_103165952 | 96 |
| 270 | 3300025917 | Ga0207660_10458276 | Ga0207660_104582762 | 96 |
| 271 | 3300025917 | Ga0207660_11384837 | Ga0207660_113848371 | 96 |
| 272 | 3300025919 | Ga0207657_10192867 | Ga0207657_101928672 | 96 |
| 273 | 3300025921 | Ga0207652_10621990 | Ga0207652_106219902 | 96 |
| 274 | 3300025922 | Ga0207646_10027898 | Ga0207646_100278985 | 96 |
| 275 | 3300025922 | Ga0207646_11333605 | Ga0207646_113336052 | 96 |
| 276 | 3300025922 | Ga0207646_11829112 | Ga0207646_118291122 | 96 |
| 277 | 3300025923 | Ga0207681_10058353 | Ga0207681_100583533 | 96 |
| 278 | 3300025923 | Ga0207681_10483711 | Ga0207681_104837112 | 96 |
| 279 | 3300025928 | Ga0207700_10702151 | Ga0207700_107021512 | 96 |
| 280 | 3300025931 | Ga0207644_10269770 | Ga0207644_102697702 | 96 |
| 281 | 3300025933 | Ga0207706_10095957 | Ga0207706_100959572 | 96 |
| 282 | 3300025935 | Ga0207709_10010091 | Ga0207709_100100913 | 96 |
| 283 | 3300025937 | Ga0207669_11051127 | Ga0207669_110511272 | 96 |
| 284 | 3300025938 | Ga0207704_10047633 | Ga0207704_100476333 | 96 |
| 285 | 3300025938 | Ga0207704_10348203 | Ga0207704_103482032 | 96 |
| 286 | 3300025938 | Ga0207704_10460666 | Ga0207704_104606662 | 96 |
| 287 | 3300025940 | Ga0207691_10120126 | Ga0207691_101201262 | 96 |
| 288 | 3300025941 | Ga0207711_10014398 | Ga0207711_100143983 | 96 |
| 289 | 3300025944 | Ga0207661_10229177 | Ga0207661_102291772 | 96 |
| 290 | 3300025945 | Ga0207679_10897599 | Ga0207679_108975992 | 96 |
| 291 | 3300025945 | Ga0207679_11706128 | Ga0207679_117061282 | 96 |
| 292 | 3300025960 | Ga0207651_10130991 | Ga0207651_101309911 | 96 |
| 293 | 3300025961 | Ga0207712_10036673 | Ga0207712_100366732 | 96 |
| 294 | 3300025961 | Ga0207712_10150022 | Ga0207712_101500222 | 96 |
| 295 | 3300025972 | Ga0207668_10067824 | Ga0207668_100678241 | 96 |
| 296 | 3300025981 | Ga0207640_10003546 | Ga0207640_100035465 | 96 |
| 297 | 3300025981 | Ga0207640_10771645 | Ga0207640_107716452 | 96 |
| 298 | 3300025986 | Ga0207658_10459638 | Ga0207658_104596381 | 96 |
| 299 | 3300025986 | Ga0207658_10461392 | Ga0207658_104613922 | 96 |
| 300 | 3300026023 | Ga0207677_10414698 | Ga0207677_104146982 | 96 |
| 301 | 3300026035 | Ga0207703_10700002 | Ga0207703_107000022 | 96 |
| 302 | 3300026035 | Ga0207703_11508492 | Ga0207703_115084921 | 96 |
| 303 | 3300026041 | Ga0207639_10141825 | Ga0207639_101418252 | 96 |
| 304 | 3300026041 | Ga0207639_11719577 | Ga0207639_117195772 | 96 |
| 305 | 3300026067 | Ga0207678_10885472 | Ga0207678_108854721 | 96 |
| 306 | 3300026067 | Ga0207678_11690597 | Ga0207678_116905972 | 96 |
| 307 | 3300026067 | Ga0207678_11805379 | Ga0207678_118053791 | 96 |
| 308 | 3300026075 | Ga0207708_10050542 | Ga0207708_100505422 | 96 |
| 309 | 3300026075 | Ga0207708_10145613 | Ga0207708_101456132 | 96 |
| 310 | 3300026075 | Ga0207708_10659312 | Ga0207708_106593122 | 96 |
| 311 | 3300026078 | Ga0207702_10963890 | Ga0207702_109638902 | 96 |
| 312 | 3300026088 | Ga0207641_10014994 | Ga0207641_100149944 | 96 |
| 313 | 3300026088 | Ga0207641_10366685 | Ga0207641_103666852 | 96 |
| 314 | 3300026089 | Ga0207648_11750673 | Ga0207648_117506732 | 96 |
| 315 | 3300026095 | Ga0207676_10088565 | Ga0207676_100885653 | 96 |
| 316 | 3300026095 | Ga0207676_11021755 | Ga0207676_110217551 | 96 |
| 317 | 3300026095 | Ga0207676_11579351 | Ga0207676_115793512 | 96 |
| 318 | 3300026116 | Ga0207674_10037131 | Ga0207674_100371312 | 96 |
| 319 | 3300026116 | Ga0207674_10874572 | Ga0207674_108745721 | 96 |
| 320 | 3300026118 | Ga0207675_100022222 | Ga0207675_1000222222 | 96 |
| 321 | 3300026118 | Ga0207675_100793598 | Ga0207675_1007935982 | 96 |
| 322 | 3300026118 | Ga0207675_101018263 | Ga0207675_1010182632 | 96 |
| 323 | 3300026118 | Ga0207675_101504994 | Ga0207675_1015049942 | 96 |
| 324 | 3300026121 | Ga0207683_10693967 | Ga0207683_106939672 | 96 |
| 325 | 3300026142 | Ga0207698_10553202 | Ga0207698_105532022 | 96 |
| 326 | 3300027717 | Ga0209998_10069499 | Ga0209998_100694992 | 96 |
| 327 | 3300027907 | Ga0207428_10156595 | Ga0207428_101565952 | 96 |
| 328 | 3300027907 | Ga0207428_10176884 | Ga0207428_101768842 | 96 |
| 329 | 3300028380 | Ga0268265_10498898 | Ga0268265_104988982 | 96 |
| 330 | 3300028380 | Ga0268265_11309278 | Ga0268265_113092782 | 96 |
| 331 | 3300028380 | Ga0268265_11407957 | Ga0268265_114079572 | 96 |
| 332 | 3300028381 | Ga0268264_10313772 | Ga0268264_103137722 | 96 |
| 333 | 3300031548 | Ga0307408_100005949 | Ga0307408_1000059495 | 96 |
| 334 | 3300031548 | Ga0307408_100026791 | Ga0307408_1000267913 | 96 |
| 335 | 3300031548 | Ga0307408_100031731 | Ga0307408_1000317312 | 96 |
| 336 | 3300031548 | Ga0307408_100368456 | Ga0307408_1003684562 | 96 |
| 337 | 3300031548 | Ga0307408_100906506 | Ga0307408_1009065062 | 96 |
| 338 | 3300031731 | Ga0307405_10095960 | Ga0307405_100959602 | 96 |
| 339 | 3300031731 | Ga0307405_10250186 | Ga0307405_102501862 | 96 |
| 340 | 3300031731 | Ga0307405_10629985 | Ga0307405_106299852 | 96 |
| 341 | 3300031824 | Ga0307413_10013116 | Ga0307413_100131164 | 96 |
| 342 | 3300031824 | Ga0307413_10028104 | Ga0307413_100281042 | 96 |
| 343 | 3300031824 | Ga0307413_10028238 | Ga0307413_100282382 | 96 |
| 344 | 3300031824 | Ga0307413_10030957 | Ga0307413_100309572 | 96 |
| 345 | 3300031824 | Ga0307413_10045105 | Ga0307413_100451053 | 96 |
| 346 | 3300031824 | Ga0307413_10078817 | Ga0307413_100788172 | 96 |
| 347 | 3300031824 | Ga0307413_10849126 | Ga0307413_108491262 | 96 |
| 348 | 3300031824 | Ga0307413_10988661 | Ga0307413_109886612 | 96 |
| 349 | 3300031852 | Ga0307410_10002568 | Ga0307410_100025689 | 96 |
| 350 | 3300031852 | Ga0307410_10003332 | Ga0307410_100033326 | 96 |
| 351 | 3300031852 | Ga0307410_10006262 | Ga0307410_100062623 | 96 |
| 352 | 3300031852 | Ga0307410_10018020 | Ga0307410_100180202 | 96 |
| 353 | 3300031852 | Ga0307410_10032819 | Ga0307410_100328194 | 96 |
| 354 | 3300031852 | Ga0307410_10065406 | Ga0307410_100654063 | 96 |
| 355 | 3300031852 | Ga0307410_10075903 | Ga0307410_100759032 | 96 |
| 356 | 3300031852 | Ga0307410_10088549 | Ga0307410_100885492 | 96 |
| 357 | 3300031852 | Ga0307410_10125921 | Ga0307410_101259212 | 96 |
| 358 | 3300031852 | Ga0307410_10383126 | Ga0307410_103831262 | 96 |
| 359 | 3300031852 | Ga0307410_11069671 | Ga0307410_110696711 | 96 |
| 360 | 3300031852 | Ga0307410_11634905 | Ga0307410_116349052 | 96 |
| 361 | 3300031852 | Ga0307410_11701440 | Ga0307410_117014402 | 96 |
| 362 | 3300031901 | Ga0307406_10022221 | Ga0307406_100222213 | 96 |
| 363 | 3300031901 | Ga0307406_10027530 | Ga0307406_100275302 | 96 |
| 364 | 3300031901 | Ga0307406_10027577 | Ga0307406_100275772 | 96 |
| 365 | 3300031901 | Ga0307406_10056263 | Ga0307406_100562632 | 96 |
| 366 | 3300031901 | Ga0307406_10085881 | Ga0307406_100858812 | 96 |
| 367 | 3300031903 | Ga0307407_10047860 | Ga0307407_100478602 | 96 |
| 368 | 3300031903 | Ga0307407_10081642 | Ga0307407_100816423 | 96 |
| 369 | 3300031903 | Ga0307407_10342271 | Ga0307407_103422712 | 96 |
| 370 | 3300031903 | Ga0307407_10495924 | Ga0307407_104959242 | 96 |
| 371 | 3300031903 | Ga0307407_10582447 | Ga0307407_105824471 | 96 |
| 372 | 3300031903 | Ga0307407_10933014 | Ga0307407_109330142 | 96 |
| 373 | 3300031903 | Ga0307407_11278308 | Ga0307407_112783081 | 96 |
| 374 | 3300031911 | Ga0307412_10033086 | Ga0307412_100330862 | 96 |
| 375 | 3300031911 | Ga0307412_10045066 | Ga0307412_100450662 | 96 |
| 376 | 3300031911 | Ga0307412_10316143 | Ga0307412_103161431 | 96 |
| 377 | 3300031911 | Ga0307412_11974227 | Ga0307412_119742272 | 96 |
| 378 | 3300031995 | Ga0307409_100000665 | Ga0307409_1000006657 | 96 |
| 379 | 3300031995 | Ga0307409_100010974 | Ga0307409_1000109742 | 96 |
| 380 | 3300031995 | Ga0307409_100052697 | Ga0307409_1000526974 | 96 |
| 381 | 3300031995 | Ga0307409_100066895 | Ga0307409_1000668952 | 96 |
| 382 | 3300031995 | Ga0307409_100139059 | Ga0307409_1001390592 | 96 |
| 383 | 3300031995 | Ga0307409_100320000 | Ga0307409_1003200002 | 96 |
| 384 | 3300031995 | Ga0307409_100564770 | Ga0307409_1005647702 | 96 |
| 385 | 3300031995 | Ga0307409_101110484 | Ga0307409_1011104842 | 96 |
| 386 | 3300032002 | Ga0307416_100000169 | Ga0307416_10000016919 | 96 |
| 387 | 3300032002 | Ga0307416_100000867 | Ga0307416_10000086715 | 96 |
| 388 | 3300032002 | Ga0307416_100058032 | Ga0307416_1000580323 | 96 |
| 389 | 3300032002 | Ga0307416_100067890 | Ga0307416_1000678904 | 96 |
| 390 | 3300032002 | Ga0307416_100076556 | Ga0307416_1000765563 | 96 |
| 391 | 3300032002 | Ga0307416_100104769 | Ga0307416_1001047693 | 96 |
| 392 | 3300032002 | Ga0307416_100109195 | Ga0307416_1001091951 | 96 |
| 393 | 3300032002 | Ga0307416_100209651 | Ga0307416_1002096512 | 96 |
| 394 | 3300032002 | Ga0307416_100339171 | Ga0307416_1003391712 | 96 |
| 395 | 3300032002 | Ga0307416_100554186 | Ga0307416_1005541862 | 96 |
| 396 | 3300032002 | Ga0307416_100854964 | Ga0307416_1008549642 | 96 |
| 397 | 3300032002 | Ga0307416_101097655 | Ga0307416_1010976551 | 96 |
| 398 | 3300032002 | Ga0307416_102889113 | Ga0307416_1028891132 | 96 |
| 399 | 3300032002 | Ga0307416_103794208 | Ga0307416_1037942081 | 96 |
| 400 | 3300032004 | Ga0307414_10002833 | Ga0307414_100028338 | 96 |
| 401 | 3300032004 | Ga0307414_10010252 | Ga0307414_100102523 | 96 |
| 402 | 3300032004 | Ga0307414_10029303 | Ga0307414_100293033 | 96 |
| 403 | 3300032004 | Ga0307414_10413798 | Ga0307414_104137981 | 96 |
| 404 | 3300032004 | Ga0307414_10419233 | Ga0307414_104192332 | 96 |
| 405 | 3300032004 | Ga0307414_10562222 | Ga0307414_105622221 | 96 |
| 406 | 3300032005 | Ga0307411_10004089 | Ga0307411_100040896 | 96 |
| 407 | 3300032005 | Ga0307411_10008563 | Ga0307411_100085632 | 96 |
| 408 | 3300032005 | Ga0307411_10009847 | Ga0307411_100098472 | 96 |
| 409 | 3300032005 | Ga0307411_10010011 | Ga0307411_100100114 | 96 |
| 410 | 3300032005 | Ga0307411_10023128 | Ga0307411_100231282 | 96 |
| 411 | 3300032005 | Ga0307411_10036137 | Ga0307411_100361372 | 96 |
| 412 | 3300032005 | Ga0307411_10136237 | Ga0307411_101362372 | 96 |
| 413 | 3300032005 | Ga0307411_10188055 | Ga0307411_101880552 | 96 |
| 414 | 3300032005 | Ga0307411_10208933 | Ga0307411_102089332 | 96 |
| 415 | 3300032005 | Ga0307411_10663709 | Ga0307411_106637092 | 96 |
| 416 | 3300032126 | Ga0307415_100001210 | Ga0307415_1000012104 | 96 |
| 417 | 3300032126 | Ga0307415_100020805 | Ga0307415_1000208053 | 96 |
| 418 | 3300032126 | Ga0307415_100041964 | Ga0307415_1000419641 | 96 |
| 419 | 3300032126 | Ga0307415_100046942 | Ga0307415_1000469422 | 96 |
| 420 | 3300032126 | Ga0307415_100054076 | Ga0307415_1000540762 | 96 |
| 421 | 3300032126 | Ga0307415_100077313 | Ga0307415_1000773132 | 96 |
| 422 | 3300032126 | Ga0307415_100226066 | Ga0307415_1002260662 | 96 |
| 423 | 3300032126 | Ga0307415_100606459 | Ga0307415_1006064592 | 96 |
| 424 | 3300032126 | Ga0307415_101232589 | Ga0307415_1012325892 | 96 |
| 425 | 3300032126 | Ga0307415_102541477 | Ga0307415_1025414772 | 96 |
| 426 | 3300035085 | Ga0373929_0079919 | Ga0373929_0079919_192_482 | 96 |
| 427 | 3300035085 | Ga0373929_0126946 | Ga0373929_0126946_230_520 | 96 |
| 428 | 3300035088 | Ga0373940_0044441 | Ga0373940_0044441_251_541 | 96 |
| 429 | 3300035088 | Ga0373940_0173131 | Ga0373940_0173131_270_560 | 96 |
| 430 | 3300035088 | Ga0373940_0199266 | Ga0373940_0199266_227_517 | 96 |
| 431 | 3300035090 | Ga0373949_0226281 | Ga0373949_0226281_134_424 | 96 |
| 432 | 3300035090 | Ga0373949_0286940 | Ga0373949_0286940_32_322 | 96 |
| 433 | 3300035091 | Ga0373951_0018130 | Ga0373951_0018130_1044_1334 | 96 |
| 434 | 3300035112 | Ga0373932_0387810 | Ga0373932_0387810_111_401 | 96 |
| 435 | 3300035114 | Ga0373939_0080402 | Ga0373939_0080402_428_736 | 96 |
| 436 | 3300035114 | Ga0373939_0154586 | Ga0373939_0154586_226_516 | 96 |
| 437 | 3300035115 | Ga0373941_0058249 | Ga0373941_0058249_174_464 | 96 |
| 438 | 3300035115 | Ga0373941_0319340 | Ga0373941_0319340_237_527 | 96 |
| 439 | 3300035121 | Ga0373960_0061604 | Ga0373960_0061604_812_1102 | 96 |
| 440 | 3300035121 | Ga0373960_0091538 | Ga0373960_0091538_383_673 | 96 |
| 441 | 3300035207 | Ga0373942_0023024 | Ga0373942_0023024_327_617 | 96 |
| 442 | 3300035241 | Ga0373961_0427118 | Ga0373961_0427118_179_487 | 96 |
| 443 | 3300035242 | Ga0373962_0070139 | Ga0373962_0070139_247_537 | 96 |
| 444 | 3300035242 | Ga0373962_0138127 | Ga0373962_0138127_48_338 | 96 |
| 445 | 3300035691 | Ga0373931_0054141 | Ga0373931_0054141_525_815 | 96 |
| 446 | 3300035691 | Ga0373931_0116197 | Ga0373931_0116197_1097_1387 | 96 |
| 447 | 3300035691 | Ga0373931_0558948 | Ga0373931_0558948_424_714 | 96 |
| 448 | 3300035691 | Ga0373931_0576431 | Ga0373931_0576431_326_616 | 96 |
| 449 | 3300037471 | Ga0395905_0478378 | Ga0395905_0478378_235_525 | 96 |
| 450 | 3300037471 | Ga0395905_0539105 | Ga0395905_0539105_443_733 | 96 |
| 451 | 3300037471 | Ga0395905_1845704 | Ga0395905_1845704_57_347 | 96 |
| 452 | 3300038443 | Ga0395901_0387432 | Ga0395901_0387432_438_728 | 96 |
| 453 | 3300038443 | Ga0395901_0992798 | Ga0395901_0992798_476_766 | 96 |
| 454 | 3300038698 | Ga0242419_009502 | Ga0242419_009502_350_640 | 96 |
| 455 | 3300038996 | Ga0242420_004009 | Ga0242420_004009_1470_1760 | 96 |
| 456 | 3300038996 | Ga0242420_066752 | Ga0242420_066752_236_544 | 96 |
| 457 | 3300038996 | Ga0242420_080861 | Ga0242420_080861_80_370 | 96 |
| 458 | 3300042001 | Ga0439441_066403 | Ga0439441_066403_388_678 | 96 |
| 459 | 3300042435 | Ga0439434_0091527 | Ga0439434_0091527_306_596 | 96 |
| 460 | 3300042436 | Ga0439435_0035267 | Ga0439435_0035267_987_1277 | 96 |
| 461 | 3300042438 | Ga0439459_0058676 | Ga0439459_0058676_209_499 | 96 |
| 462 | 3300042876 | Ga0451577_0018318 | Ga0451577_0018318_195_485 | 96 |
| 463 | 3300042876 | Ga0451577_0291948 | Ga0451577_0291948_616_906 | 96 |
| 464 | 3300044673 | Ga0453683_0253843 | Ga0453683_0253843_641_931 | 96 |
| 465 | 3300044673 | Ga0453683_1201478 | Ga0453683_1201478_136_426 | 96 |
| 466 | 3300044712 | Ga0453684_0221947 | Ga0453684_0221947_1673_1963 | 96 |
| 467 | 3300044712 | Ga0453684_1105708 | Ga0453684_1105708_196_486 | 96 |
| 468 | 3300045051 | Ga0451576_1757787 | Ga0451576_1757787_191_481 | 96 |
| 469 | 3300045976 | Ga0466967_1029796 | Ga0466967_1029796_349_639 | 96 |
| 470 | 3300046455 | Ga0495603_0008621 | Ga0495603_0008621_3821_4111 | 96 |
| 471 | 3300046475 | Ga0495639_0242234 | Ga0495639_0242234_268_558 | 96 |
| 472 | 3300046558 | Ga0495633_0183904 | Ga0495633_0183904_294_584 | 96 |
| 473 | 3300046615 | Ga0495656_0739499 | Ga0495656_0739499_47_337 | 96 |
| 474 | 3300046664 | Ga0495659_0080321 | Ga0495659_0080321_869_1159 | 96 |
| 475 | 3300046691 | Ga0495670_0044607 | Ga0495670_0044607_664_954 | 96 |
| 476 | 3300047318 | Ga0495636_0013911 | Ga0495636_0013911_510_800 | 96 |
| 477 | 3300048903 | Ga0496100_0175105 | Ga0496100_0175105_108_398 | 96 |
| 478 | 3300048904 | Ga0496101_0045795 | Ga0496101_0045795_1718_2008 | 96 |
| 479 | 3300048904 | Ga0496101_0233359 | Ga0496101_0233359_716_1006 | 96 |
| 480 | 3300048904 | Ga0496101_1105086 | Ga0496101_1105086_131_421 | 96 |
| 481 | 3300048905 | Ga0496102_0129883 | Ga0496102_0129883_83_373 | 96 |
| 482 | 3300048905 | Ga0496102_0180956 | Ga0496102_0180956_1138_1428 | 96 |
| 483 | 3300048905 | Ga0496102_0309306 | Ga0496102_0309306_1098_1388 | 96 |
| 484 | 3300048905 | Ga0496102_0389966 | Ga0496102_0389966_391_681 | 96 |
| 485 | 3300048905 | Ga0496102_0679341 | Ga0496102_0679341_322_612 | 96 |
| 486 | 3300048905 | Ga0496102_1952564 | Ga0496102_1952564_159_449 | 96 |
| 487 | 3300048906 | Ga0496103_0036580 | Ga0496103_0036580_547_837 | 96 |
| 488 | 3300048906 | Ga0496103_0180793 | Ga0496103_0180793_661_951 | 96 |
| 489 | 3300048906 | Ga0496103_0299815 | Ga0496103_0299815_681_971 | 96 |
| 490 | 3300048907 | Ga0496104_0099730 | Ga0496104_0099730_1203_1493 | 96 |
| 491 | 3300048907 | Ga0496104_0203729 | Ga0496104_0203729_378_668 | 96 |
| 492 | 3300048907 | Ga0496104_0618949 | Ga0496104_0618949_630_938 | 96 |
| 493 | 3300048908 | Ga0496105_0218864 | Ga0496105_0218864_375_665 | 96 |
| 494 | 3300048908 | Ga0496105_0642879 | Ga0496105_0642879_184_474 | 96 |
| 495 | 3300048909 | Ga0496106_0023979 | Ga0496106_0023979_2469_2759 | 96 |
| 496 | 3300048909 | Ga0496106_0025578 | Ga0496106_0025578_2321_2611 | 96 |
| 497 | 3300048909 | Ga0496106_0050308 | Ga0496106_0050308_2806_3096 | 96 |
| 498 | 3300048909 | Ga0496106_0423328 | Ga0496106_0423328_511_801 | 96 |
| 499 | 3300048909 | Ga0496106_0810616 | Ga0496106_0810616_430_720 | 96 |
| 500 | 3300048910 | Ga0496107_0162551 | Ga0496107_0162551_18_308 | 96 |
| 501 | 3300048910 | Ga0496107_0191963 | Ga0496107_0191963_783_1073 | 96 |
| 502 | 3300048911 | Ga0496108_0007531 | Ga0496108_0007531_1462_1752 | 96 |
| 503 | 3300048911 | Ga0496108_0020371 | Ga0496108_0020371_4220_4510 | 96 |
| 504 | 3300048911 | Ga0496108_0030609 | Ga0496108_0030609_3011_3319 | 96 |
| 505 | 3300048912 | Ga0496109_0001213 | Ga0496109_0001213_19457_19747 | 96 |
| 506 | 3300048912 | Ga0496109_0007276 | Ga0496109_0007276_1347_1655 | 96 |
| 507 | 3300048912 | Ga0496109_0110285 | Ga0496109_0110285_770_1060 | 96 |
| 508 | 3300048912 | Ga0496109_0344247 | Ga0496109_0344247_255_545 | 96 |
| 509 | 3300048912 | Ga0496109_1074714 | Ga0496109_1074714_164_454 | 96 |
| 510 | 3300048913 | Ga0496110_0008231 | Ga0496110_0008231_1839_2129 | 96 |
| 511 | 3300048913 | Ga0496110_0086073 | Ga0496110_0086073_1885_2175 | 96 |
| 512 | 3300048913 | Ga0496110_0142950 | Ga0496110_0142950_1667_1975 | 96 |
| 513 | 3300048913 | Ga0496110_0264039 | Ga0496110_0264039_665_955 | 96 |
| 514 | 3300048914 | Ga0496111_0008696 | Ga0496111_0008696_3449_3739 | 96 |
| 515 | 3300048915 | Ga0496112_0007045 | Ga0496112_0007045_4369_4659 | 96 |
| 516 | 3300048915 | Ga0496112_0025715 | Ga0496112_0025715_5272_5562 | 96 |
| 517 | 3300048915 | Ga0496112_0027925 | Ga0496112_0027925_2503_2811 | 96 |
| 518 | 3300048915 | Ga0496112_0119722 | Ga0496112_0119722_680_970 | 96 |
| 519 | 3300048916 | Ga0496113_0004956 | Ga0496113_0004956_7314_7604 | 96 |
| 520 | 3300048916 | Ga0496113_0016734 | Ga0496113_0016734_336_626 | 96 |
| 521 | 3300048916 | Ga0496113_0214674 | Ga0496113_0214674_596_904 | 96 |
| 522 | 3300048917 | Ga0496114_0071341 | Ga0496114_0071341_1133_1423 | 96 |
| 523 | 3300049522 | Ga0501299_018040 | Ga0501299_018040_899_1189 | 96 |
| 524 | 3300049568 | Ga0501031_0084686 | Ga0501031_0084686_797_1087 | 96 |
| 525 | 3300049570 | Ga0501033_0126833 | Ga0501033_0126833_486_776 | 96 |
| 526 | 3300049572 | Ga0501036_0204346 | Ga0501036_0204346_1214_1504 | 96 |
| 527 | 3300049572 | Ga0501036_0394311 | Ga0501036_0394311_321_611 | 96 |
| 528 | 3300049573 | Ga0501037_0180745 | Ga0501037_0180745_487_777 | 96 |
| 529 | 3300049573 | Ga0501037_0548433 | Ga0501037_0548433_367_657 | 96 |
| 530 | 3300049574 | Ga0501038_0123961 | Ga0501038_0123961_103_393 | 96 |
| 531 | 3300049574 | Ga0501038_0200000 | Ga0501038_0200000_1175_1465 | 96 |
| 532 | 3300049574 | Ga0501038_0590989 | Ga0501038_0590989_17_307 | 96 |
| 533 | 3300049574 | Ga0501038_0679909 | Ga0501038_0679909_423_713 | 96 |
| 534 | 3300049575 | Ga0501039_0074687 | Ga0501039_0074687_1780_2070 | 96 |
| 535 | 3300049576 | Ga0501040_0099029 | Ga0501040_0099029_583_873 | 96 |
| 536 | 3300049576 | Ga0501040_0202093 | Ga0501040_0202093_975_1265 | 96 |
| 537 | 3300049576 | Ga0501040_0632261 | Ga0501040_0632261_228_518 | 96 |
| 538 | 3300049576 | Ga0501040_1057784 | Ga0501040_1057784_200_490 | 96 |
| 539 | 3300049577 | Ga0501041_0045136 | Ga0501041_0045136_1362_1652 | 96 |
| 540 | 3300049577 | Ga0501041_0584123 | Ga0501041_0584123_305_595 | 96 |
| 541 | 3300049578 | Ga0501042_0232881 | Ga0501042_0232881_516_806 | 96 |
| 542 | 3300049579 | Ga0501043_0264848 | Ga0501043_0264848_975_1265 | 96 |
| 543 | 3300049580 | Ga0501046_0123993 | Ga0501046_0123993_983_1273 | 96 |
| 544 | 3300049580 | Ga0501046_0151832 | Ga0501046_0151832_272_562 | 96 |
| 545 | 3300049580 | Ga0501046_0306742 | Ga0501046_0306742_558_848 | 96 |
| 546 | 3300049580 | Ga0501046_1041884 | Ga0501046_1041884_188_478 | 96 |
| 547 | 3300049583 | Ga0501067_0027880 | Ga0501067_0027880_1849_2139 | 96 |
| 548 | 3300049583 | Ga0501067_0081415 | Ga0501067_0081415_1440_1730 | 96 |
| 549 | 3300049583 | Ga0501067_0128229 | Ga0501067_0128229_698_994 | 96 |
| 550 | 3300049583 | Ga0501067_0326390 | Ga0501067_0326390_134_424 | 96 |
| 551 | 3300049584 | Ga0501068_0071844 | Ga0501068_0071844_678_968 | 96 |
| 552 | 3300049584 | Ga0501068_0680197 | Ga0501068_0680197_214_504 | 96 |
| 553 | 3300049585 | Ga0501069_0045087 | Ga0501069_0045087_942_1232 | 96 |
| 554 | 3300049585 | Ga0501069_0132235 | Ga0501069_0132235_20_310 | 96 |
| 555 | 3300049585 | Ga0501069_0271244 | Ga0501069_0271244_579_869 | 96 |
| 556 | 3300049586 | Ga0501070_0145673 | Ga0501070_0145673_754_1044 | 96 |
| 557 | 3300049587 | Ga0501071_0033094 | Ga0501071_0033094_1562_1852 | 96 |
| 558 | 3300049588 | Ga0501072_0096123 | Ga0501072_0096123_761_1051 | 96 |
| 559 | 3300049590 | Ga0501074_0037332 | Ga0501074_0037332_3214_3504 | 96 |
| 560 | 3300049590 | Ga0501074_0503850 | Ga0501074_0503850_207_497 | 96 |
| 561 | 3300049591 | Ga0501075_0015555 | Ga0501075_0015555_3573_3863 | 96 |
| 562 | 3300049591 | Ga0501075_0360363 | Ga0501075_0360363_84_374 | 96 |
| 563 | 3300049591 | Ga0501075_0882133 | Ga0501075_0882133_179_469 | 96 |
| 564 | 3300049591 | Ga0501075_0995661 | Ga0501075_0995661_293_583 | 96 |
| 565 | 3300049592 | Ga0501076_0075407 | Ga0501076_0075407_1917_2207 | 96 |
| 566 | 3300049592 | Ga0501076_0173234 | Ga0501076_0173234_990_1280 | 96 |
| 567 | 3300049592 | Ga0501076_0214594 | Ga0501076_0214594_511_801 | 96 |
| 568 | 3300049592 | Ga0501076_0306918 | Ga0501076_0306918_539_829 | 96 |
| 569 | 3300049593 | Ga0501077_0001177 | Ga0501077_0001177_15280_15570 | 96 |
| 570 | 3300049593 | Ga0501077_0043784 | Ga0501077_0043784_1855_2145 | 96 |
| 571 | 3300049593 | Ga0501077_0051951 | Ga0501077_0051951_587_877 | 96 |
| 572 | 3300049593 | Ga0501077_0359910 | Ga0501077_0359910_260_550 | 96 |
| 573 | 3300049593 | Ga0501077_0718566 | Ga0501077_0718566_336_626 | 96 |
| 574 | 3300049650 | Ga0501199_005575 | Ga0501199_005575_98_388 | 96 |
| 575 | 3300049656 | Ga0501209_033028 | Ga0501209_033028_468_758 | 96 |
| 576 | 3300049656 | Ga0501209_035671 | Ga0501209_035671_356_646 | 96 |
| 577 | 3300049656 | Ga0501209_057390 | Ga0501209_057390_754_1044 | 96 |
| 578 | 3300049656 | Ga0501209_142989 | Ga0501209_142989_145_435 | 96 |
| 579 | 3300049658 | Ga0501211_025768 | Ga0501211_025768_207_506 | 96 |
| 580 | 3300049660 | Ga0501216_027457 | Ga0501216_027457_292_582 | 96 |
| 581 | 3300049661 | Ga0501217_015539 | Ga0501217_015539_478_768 | 96 |
| 582 | 3300049668 | Ga0501233_018413 | Ga0501233_018413_460_750 | 96 |
| 583 | 3300049668 | Ga0501233_023535 | Ga0501233_023535_922_1212 | 96 |
| 584 | 3300049675 | Ga0501243_030647 | Ga0501243_030647_589_879 | 96 |
| 585 | 3300049677 | Ga0501247_024646 | Ga0501247_024646_459_749 | 96 |
| 586 | 3300049679 | Ga0501249_016756 | Ga0501249_016756_335_625 | 96 |
| 587 | 3300049679 | Ga0501249_046991 | Ga0501249_046991_593_883 | 96 |
| 588 | 3300049679 | Ga0501249_091688 | Ga0501249_091688_22_312 | 96 |
| 589 | 3300049679 | Ga0501249_099465 | Ga0501249_099465_133_423 | 96 |
| 590 | 3300049681 | Ga0501251_014722 | Ga0501251_014722_507_797 | 96 |
| 591 | 3300049683 | Ga0501253_106327 | Ga0501253_106327_306_596 | 96 |
| 592 | 3300049686 | Ga0501257_096248 | Ga0501257_096248_95_385 | 96 |
| 593 | 3300049687 | Ga0501258_001408 | Ga0501258_001408_27_317 | 96 |
| 594 | 3300049704 | Ga0501221_010769 | Ga0501221_010769_164_454 | 96 |
| 595 | 3300049705 | Ga0501225_0028841 | Ga0501225_0028841_207_497 | 96 |
| 596 | 3300049741 | Ga0501079_0069364 | Ga0501079_0069364_1437_1727 | 96 |
| 597 | 3300049741 | Ga0501079_0148048 | Ga0501079_0148048_245_535 | 96 |
| 598 | 3300049741 | Ga0501079_0165543 | Ga0501079_0165543_882_1172 | 96 |
| 599 | 3300049741 | Ga0501079_0201756 | Ga0501079_0201756_804_1094 | 96 |
| 600 | 3300049741 | Ga0501079_0451523 | Ga0501079_0451523_18_308 | 96 |
| 601 | 3300049742 | Ga0501080_0147413 | Ga0501080_0147413_673_963 | 96 |
| 602 | 3300049742 | Ga0501080_0481241 | Ga0501080_0481241_55_345 | 96 |
| 603 | 3300049742 | Ga0501080_0760252 | Ga0501080_0760252_497_787 | 96 |
| 604 | 3300049743 | Ga0501081_0123029 | Ga0501081_0123029_186_476 | 96 |
| 605 | 3300049743 | Ga0501081_0169682 | Ga0501081_0169682_1051_1341 | 96 |
| 606 | 3300049743 | Ga0501081_0235482 | Ga0501081_0235482_702_992 | 96 |
| 607 | 3300049743 | Ga0501081_0235671 | Ga0501081_0235671_559_849 | 96 |
| 608 | 3300049744 | Ga0501083_0126016 | Ga0501083_0126016_207_497 | 96 |
| 609 | 3300049744 | Ga0501083_0897602 | Ga0501083_0897602_36_326 | 96 |
| 610 | 3300049761 | Ga0501264_020928 | Ga0501264_020928_259_549 | 96 |
| 611 | 3300049763 | Ga0501266_029634 | Ga0501266_029634_259_549 | 96 |
| 612 | 3300049764 | Ga0501267_005648 | Ga0501267_005648_456_746 | 96 |
| 613 | 3300049767 | Ga0501270_025212 | Ga0501270_025212_570_860 | 96 |
| 614 | 3300049770 | Ga0501273_009919 | Ga0501273_009919_534_824 | 96 |
| 615 | 3300049773 | Ga0501276_035464 | Ga0501276_035464_143_433 | 96 |
| 616 | 3300049779 | Ga0501283_006872 | Ga0501283_006872_242_532 | 96 |
| 617 | 3300049779 | Ga0501283_024292 | Ga0501283_024292_599_889 | 96 |
| 618 | 3300049822 | Ga0501035_0229845 | Ga0501035_0229845_392_682 | 96 |
| 619 | 3300049822 | Ga0501035_1318551 | Ga0501035_1318551_209_499 | 96 |
| 620 | 3300049824 | Ga0501045_0056535 | Ga0501045_0056535_383_673 | 96 |
| 621 | 3300049824 | Ga0501045_0120708 | Ga0501045_0120708_1640_1930 | 96 |
| 622 | 3300049824 | Ga0501045_0252193 | Ga0501045_0252193_824_1114 | 96 |
| 623 | 3300049824 | Ga0501045_0716859 | Ga0501045_0716859_30_320 | 96 |
| 624 | 3300049850 | Ga0501204_009290 | Ga0501204_009290_249_539 | 96 |
| 625 | 3300049851 | Ga0501212_029659 | Ga0501212_029659_76_366 | 96 |
| 626 | 3300050507 | nmdc:mga05p37_148079_c1 | nmdc:mga05p37_148079_c1_280_570 | 96 |
| 627 | 3300050507 | nmdc:mga05p37_1933540_c1 | nmdc:mga05p37_1933540_c1_183_473 | 96 |
| 628 | 3300050507 | nmdc:mga05p37_291525_c1 | nmdc:mga05p37_291525_c1_132_422 | 96 |
| 629 | 3300050507 | nmdc:mga05p37_694322_c1 | nmdc:mga05p37_694322_c1_408_698 | 96 |
| 630 | 3300050507 | nmdc:mga05p37_715376_c1 | nmdc:mga05p37_715376_c1_225_515 | 96 |
| 631 | 3300050507 | nmdc:mga05p37_934377_c1 | nmdc:mga05p37_934377_c1_210_500 | 96 |
| 632 | 3300050508 | nmdc:mga09592_568948_c1 | nmdc:mga09592_568948_c1_25_315 | 96 |
| 633 | 3300050508 | nmdc:mga09592_59953_c1 | nmdc:mga09592_59953_c1_1713_2012 | 96 |
| 634 | 3300050509 | nmdc:mga0qj67_278760_c1 | nmdc:mga0qj67_278760_c1_1042_1332 | 96 |
| 635 | 3300050509 | nmdc:mga0qj67_7368_c1 | nmdc:mga0qj67_7368_c1_3718_4008 | 96 |
| 636 | 3300050510 | nmdc:mga06r32_1218704_c1 | nmdc:mga06r32_1218704_c1_93_383 | 96 |
| 637 | 3300050510 | nmdc:mga06r32_342801_c1 | nmdc:mga06r32_342801_c1_804_1094 | 96 |
| 638 | 3300050510 | nmdc:mga06r32_511208_c1 | nmdc:mga06r32_511208_c1_666_956 | 96 |
| 639 | 3300050510 | nmdc:mga06r32_864959_c1 | nmdc:mga06r32_864959_c1_359_658 | 96 |
| 640 | 3300050511 | nmdc:mga08y16_281292_c1 | nmdc:mga08y16_281292_c1_1402_1692 | 96 |
| 641 | 3300050511 | nmdc:mga08y16_415585_c1 | nmdc:mga08y16_415585_c1_832_1122 | 96 |
| 642 | 3300050511 | nmdc:mga08y16_621829_c1 | nmdc:mga08y16_621829_c1_519_809 | 96 |
| 643 | 3300050512 | nmdc:mga0n895_1319348_c1 | nmdc:mga0n895_1319348_c1_366_656 | 96 |
| 644 | 3300050512 | nmdc:mga0n895_295528_c1 | nmdc:mga0n895_295528_c1_867_1166 | 96 |
| 645 | 3300050512 | nmdc:mga0n895_569961_c1 | nmdc:mga0n895_569961_c1_632_922 | 96 |
| 646 | 3300050513 | nmdc:mga0rr50_643794_c1 | nmdc:mga0rr50_643794_c1_552_842 | 96 |
| 647 | 3300050513 | nmdc:mga0rr50_934934_c1 | nmdc:mga0rr50_934934_c1_13_303 | 96 |
| 648 | 3300050515 | nmdc:mga0a205_40614_c1 | nmdc:mga0a205_40614_c1_864_1163 | 96 |
| 649 | 3300050515 | nmdc:mga0a205_85608_c1 | nmdc:mga0a205_85608_c1_495_785 | 96 |
| 650 | 3300054114 | Ga0501084_0006598 | Ga0501084_0006598_1187_1477 | 96 |
| 651 | 3300054114 | Ga0501084_0320495 | Ga0501084_0320495_496_786 | 96 |
| 652 | 3300054114 | Ga0501084_0559492 | Ga0501084_0559492_538_828 | 96 |
| 653 | 3300059421 | Ga0590071_001573 | Ga0590071_001573_4261_4551 | 96 |
| 654 | 3300059421 | Ga0590071_002778 | Ga0590071_002778_920_1210 | 96 |
| 655 | 3300059421 | Ga0590071_012194 | Ga0590071_012194_1106_1396 | 96 |
| 656 | 3300059421 | Ga0590071_039033 | Ga0590071_039033_626_916 | 96 |
| 657 | 3300059421 | Ga0590071_066097 | Ga0590071_066097_223_513 | 96 |
| 658 | 3300059423 | Ga0590074_028681 | Ga0590074_028681_230_520 | 96 |
| 659 | 3300059424 | Ga0590075_024941 | Ga0590075_024941_446_736 | 96 |
| 660 | 3300059424 | Ga0590075_037947 | Ga0590075_037947_683_973 | 96 |
| 661 | 3300059426 | Ga0590077_050286 | Ga0590077_050286_478_768 | 96 |
| 662 | 3300059426 | Ga0590077_083583 | Ga0590077_083583_344_634 | 96 |
| 663 | 3300059490 | Ga0587066_056959 | Ga0587066_056959_65_355 | 96 |
| 664 | 3300060353 | Ga0501082_0064431 | Ga0501082_0064431_1205_1495 | 96 |
| 665 | 3300060353 | Ga0501082_1011507 | Ga0501082_1011507_224_514 | 96 |
| 666 | 3300060353 | Ga0501082_1443506 | Ga0501082_1443506_137_427 | 96 |
| 667 | 3300060353 | Ga0501082_1785689 | Ga0501082_1785689_130_420 | 96 |
| 668 | 3300061734 | Ga0530510_0200281 | Ga0530510_0200281_724_1014 | 96 |
| 669 | 3300061734 | Ga0530510_0394416 | Ga0530510_0394416_587_877 | 96 |
| 670 | 3300061734 | Ga0530510_0417474 | Ga0530510_0417474_593_883 | 96 |
| 671 | 3300061734 | Ga0530510_0598932 | Ga0530510_0598932_101_391 | 96 |
| 672 | 3300061734 | Ga0530510_0882050 | Ga0530510_0882050_270_560 | 96 |
| 673 | 3300061734 | Ga0530510_1245687 | Ga0530510_1245687_256_546 | 96 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5f6q-assembly1.cif.gz_A | crystal structure of metallothiol transferase from bacillus anthracis str. ames | 0.832 | 16 | 52 |
| 5cj3-assembly1.cif.gz_B | crystal structure of the zorbamycin binding protein (zbma) from streptomyces flavoviridis with zorbamycin | 0.8152 | 15 | 52 |
| 2zfd-assembly1.cif.gz_B | the crystal structure of plant specific calcium binding protein atcbl2 in complex with the regulatory domain of atcipk14 | 0.7834 | 2 | 83 |
| 4iag-assembly1.cif.gz_A-2 | crystal structure of zbma, the zorbamycin binding protein from streptomyces flavoviridis | 0.774 | 18 | 52 |
| 3tdh-assembly1.cif.gz_A | structure of the regulatory fragment of sccharomyces cerevisiae ampk in complex with amp | 0.7417 | 5 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B9EW50_2_100_3.30.310.80 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 | 0.8376 | 1 | 65 | 3.30.310.80 |
| af_I1L7C7_308_422_3.30.310.80 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 | 0.8294 | 2 | 82 | 3.30.310.80 |
| af_O22932_303_426_3.30.310.80 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 | 0.8062 | 2 | 81 | 3.30.310.80 |
| af_A0A1D6F284_331_456_3.30.310.80 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 | 0.7999 | 2 | 82 | 3.30.310.80 |
| af_A0A0R0IJS9_306_438_3.30.310.80 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 | 0.7912 | 2 | 86 | 3.30.310.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838QJF3-F1-model_v4 | Uncharacterized protein | 0.9814 | 1 | 96 |
|
| AF-A0A2H6A4H8-F1-model_v4 | Uncharacterized protein | 0.9636 | 1 | 96 |
|
| AF-A0A2V7PU17-F1-model_v4 | Uncharacterized protein | 0.946 | 15 | 96 |
|
| AF-A0A1G0M0E6-F1-model_v4 | Uncharacterized protein | 0.9371 | 1 | 96 |
|
| AF-A0A1G0M0E6-F1-model_v4 | Uncharacterized protein | 0.9279 | 1 | 96 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar