F474292

General Info

Members Datasets Scaffolds Average Seq Length
673 298 673 95

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100112228|Ga0068864_1001122281
Length 101
Sequence MTGTRMKYFHRTHLSPDSVLARAAQYFGGRLSPVEELPRRRRFTGSIGQVGVSVQADGGHYTLVTVETNQVGESEADKLAKRFLTIVHTMAEPTHRPIGAY

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
161 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
164 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
177 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
178 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
181 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
254 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
255 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
256 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
257 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
258 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
259 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
260 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
261 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
262 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
263 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
264 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
265 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
266 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
267 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
273 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
274 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
275 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
276 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
277 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
278 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
282 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
294 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
295 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.28
Rhizosphere 92.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10466576 3300005295 Bacteria 774
2 Ga0070676_10039684 3300005328 Bacteria 2723
3 Ga0070690_100056417 3300005330 Bacteria 2519
4 Ga0070677_10127839 3300005333 Bacteria 1156
5 Ga0068869_100007142 3300005334 Bacteria 7117
6 Ga0070666_10057226 3300005335 Bacteria 2634
7 Ga0070680_100390387 3300005336 Bacteria 1186
8 Ga0070680_100931858 3300005336 Bacteria 750
9 Ga0070680_101874526 3300005336 Bacteria 520
10 Ga0070691_10008925 3300005341 Bacteria 4590
11 Ga0070691_10049859 3300005341 Bacteria 1996
12 Ga0070661_100433319 3300005344 Bacteria 1044
13 Ga0070692_10062581 3300005345 Bacteria 1964
14 Ga0070669_100739979 3300005353 Unclassified 833
15 Ga0070675_100345992 3300005354 Bacteria 1318
16 Ga0070671_100333480 3300005355 Bacteria 1293
17 Ga0070674_100002772 3300005356 Bacteria 9682
18 Ga0070673_102224785 3300005364 Bacteria 521
19 Ga0070667_100029374 3300005367 Bacteria 4580
20 Ga0070667_100183574 3300005367 Bacteria 1851
21 Ga0070667_101163471 3300005367 Bacteria 722
22 Ga0070703_10141841 3300005406 Bacteria 894
23 Ga0070710_10378022 3300005437 Bacteria 944
24 Ga0070701_10130807 3300005438 Bacteria 1426
25 Ga0070701_10178718 3300005438 Bacteria 1241
26 Ga0070711_100079919 3300005439 Bacteria 2327
27 Ga0070711_100513021 3300005439 Bacteria 990
28 Ga0070705_100006861 3300005440 Bacteria 5597
29 Ga0070705_100010366 3300005440 Bacteria 4663
30 Ga0070705_100035580 3300005440 Bacteria 2793
31 Ga0070705_100368171 3300005440 Bacteria 1054
32 Ga0070705_100818014 3300005440 Bacteria 743
33 Ga0070705_100885179 3300005440 Unclassified 717
34 Ga0070700_100091200 3300005441 Bacteria 1989
35 Ga0070700_100093439 3300005441 Bacteria 1967
36 Ga0070700_101214915 3300005441 Bacteria 630
37 Ga0070694_100214296 3300005444 Bacteria 1442
38 Ga0070694_100550160 3300005444 Bacteria 924
39 Ga0070694_101455798 3300005444 Bacteria 579
40 Ga0070694_101888520 3300005444 Unclassified 510
41 Ga0070708_100168293 3300005445 Bacteria 2045
42 Ga0070708_100403511 3300005445 Bacteria 1289
43 Ga0070708_100610896 3300005445 Bacteria 1028
44 Ga0070708_101156705 3300005445 Bacteria 724
45 Ga0070708_101323539 3300005445 Unclassified 673
46 Ga0070708_101901325 3300005445 Bacteria 552
47 Ga0070708_102118961 3300005445 Unclassified 520
48 Ga0070663_100756666 3300005455 Bacteria 830
49 Ga0070678_100021674 3300005456 Bacteria 4242
50 Ga0070662_100009215 3300005457 Bacteria 6445
51 Ga0070681_10140844 3300005458 Bacteria 2341
52 Ga0068867_100001444 3300005459 Bacteria 16464
53 Ga0068867_101600290 3300005459 Bacteria 609
54 Ga0070706_100268398 3300005467 Bacteria 1592
55 Ga0070706_100321284 3300005467 Bacteria 1443
56 Ga0070706_100421079 3300005467 Bacteria 1243
57 Ga0070706_101144740 3300005467 Bacteria 716
58 Ga0070707_100069499 3300005468 Bacteria 3391
59 Ga0070707_100247277 3300005468 Bacteria 1735
60 Ga0070698_100111517 3300005471 Bacteria 2700
61 Ga0070698_100139002 3300005471 Bacteria 2382
62 Ga0070698_100177798 3300005471 Bacteria 2067
63 Ga0070698_100223466 3300005471 Bacteria 1816
64 Ga0070698_100478860 3300005471 Bacteria 1182
65 Ga0070698_100873454 3300005471 Bacteria 845
66 Ga0070698_101139768 3300005471 Unclassified 729
67 Ga0070698_101227612 3300005471 Unclassified 699
68 Ga0070699_100008009 3300005518 Bacteria 9174
69 Ga0070699_100093310 3300005518 Bacteria 2634
70 Ga0070699_100135473 3300005518 Bacteria 2173
71 Ga0070699_100213972 3300005518 Bacteria 1717
72 Ga0070699_100909395 3300005518 Bacteria 806
73 Ga0070699_100959528 3300005518 Unclassified 784
74 Ga0070699_101181099 3300005518 Unclassified 702
75 Ga0070679_100311117 3300005530 Bacteria 1525
76 Ga0070679_100715931 3300005530 Bacteria 944
77 Ga0070684_101966803 3300005535 Unclassified 552
78 Ga0070697_100021236 3300005536 Bacteria 5142
79 Ga0070697_100101706 3300005536 Bacteria 2388
80 Ga0070697_101075305 3300005536 Bacteria 716
81 Ga0070697_101295682 3300005536 Unclassified 650
82 Ga0070697_101388814 3300005536 Unclassified 627
83 Ga0068853_100226078 3300005539 Bacteria 1711
84 Ga0070686_100263258 3300005544 Bacteria 1265
85 Ga0070686_100637300 3300005544 Bacteria 844
86 Ga0070695_100075529 3300005545 Bacteria 2217
87 Ga0070695_100984403 3300005545 Unclassified 685
88 Ga0070695_101660756 3300005545 Unclassified 534
89 Ga0070696_100004439 3300005546 Bacteria 9362
90 Ga0070696_100017620 3300005546 Bacteria 4822
91 Ga0070696_100037557 3300005546 Bacteria 3341
92 Ga0070696_100481052 3300005546 Bacteria 985
93 Ga0070696_100645460 3300005546 Bacteria 858
94 Ga0070696_100788547 3300005546 Bacteria 781
95 Ga0070696_101228531 3300005546 Bacteria 634
96 Ga0070693_100321367 3300005547 Bacteria 1050
97 Ga0070704_100063496 3300005549 Bacteria 2651
98 Ga0070704_100178041 3300005549 Bacteria 1698
99 Ga0070704_101298325 3300005549 Unclassified 666
100 Ga0068855_102183438 3300005563 Bacteria 556
101 Ga0070664_100162182 3300005564 Bacteria 1978
102 Ga0070664_102118803 3300005564 Bacteria 534
103 Ga0068857_100050518 3300005577 Bacteria 3688
104 Ga0068857_100193092 3300005577 Bacteria 1855
105 Ga0068857_100617212 3300005577 Bacteria 1026
106 Ga0068854_100010148 3300005578 Bacteria 6102
107 Ga0068854_100953849 3300005578 Bacteria 757
108 Ga0068859_100076240 3300005617 Bacteria 3394
109 Ga0068859_102380627 3300005617 Bacteria 584
110 Ga0068864_100001101 3300005618 Bacteria 22618
111 Ga0068864_100112228 3300005618 Bacteria 2429
112 Ga0068864_101009605 3300005618 Bacteria 825
113 Ga0068866_10000165 3300005718 Bacteria 30640
114 Ga0068861_100101728 3300005719 Bacteria 2286
115 Ga0068861_100243708 3300005719 Bacteria 1530
116 Ga0068861_100549133 3300005719 Bacteria 1052
117 Ga0068861_101418099 3300005719 Bacteria 679
118 Ga0068861_101772230 3300005719 Bacteria 612
119 Ga0068870_10066682 3300005840 Bacteria 1951
120 Ga0068863_100076993 3300005841 Bacteria 3156
121 Ga0068863_100400310 3300005841 Bacteria 1343
122 Ga0068858_100080197 3300005842 Bacteria 3032
123 Ga0068858_101286174 3300005842 Unclassified 720
124 Ga0068860_100685615 3300005843 Bacteria 1034
125 Ga0068860_100756488 3300005843 Bacteria 984
126 Ga0068860_100862405 3300005843 Bacteria 920
127 Ga0068860_101360423 3300005843 Bacteria 731
128 Ga0068860_101531584 3300005843 Bacteria 688
129 Ga0068862_101424342 3300005844 Bacteria 697
130 Ga0081538_10026610 3300005981 Bacteria 4040
131 Ga0070715_10229749 3300006163 Bacteria 959
132 Ga0070716_101537939 3300006173 Bacteria 545
133 Ga0070712_100135387 3300006175 Bacteria 1873
134 Ga0097621_100574481 3300006237 Bacteria 1028
135 Ga0097621_101172255 3300006237 Unclassified 723
136 Ga0068871_100094094 3300006358 Bacteria 2501
137 Ga0075428_100540701 3300006844 Bacteria 1246
138 Ga0075428_102000718 3300006844 Bacteria 601
139 Ga0075428_102172427 3300006844 Bacteria 573
140 Ga0075430_100014773 3300006846 Bacteria 6650
141 Ga0075430_100282639 3300006846 Bacteria 1373
142 Ga0075430_100584295 3300006846 Bacteria 922
143 Ga0075431_100589047 3300006847 Bacteria 1097
144 Ga0075431_101106014 3300006847 Bacteria 757
145 Ga0075433_10019313 3300006852 Bacteria 5678
146 Ga0075433_10142207 3300006852 Bacteria 2133
147 Ga0075433_11323646 3300006852 Bacteria 624
148 Ga0075434_100197634 3300006871 Bacteria 2031
149 Ga0075434_100402723 3300006871 Bacteria 1389
150 Ga0075434_100747493 3300006871 Bacteria 995
151 Ga0075429_100063000 3300006880 Bacteria 3231
152 Ga0068865_100001488 3300006881 Bacteria 13652
153 Ga0068865_100922293 3300006881 Bacteria 761
154 Ga0068865_101695285 3300006881 Bacteria 570
155 Ga0097620_100076241 3300006931 Bacteria 3394
156 Ga0097620_102380800 3300006931 Bacteria 584
157 Ga0075435_100513852 3300007076 Bacteria 1036
158 Ga0075435_101166192 3300007076 Bacteria 674
159 Ga0105240_10032020 3300009093 Bacteria 6810
160 Ga0111539_10245983 3300009094 Bacteria 2082
161 Ga0111539_10332026 3300009094 Bacteria 1770
162 Ga0111539_10702318 3300009094 Bacteria 1177
163 Ga0105245_11937848 3300009098 Unclassified 642
164 Ga0105247_10148183 3300009101 Bacteria 1544
165 Ga0114129_10209150 3300009147 Bacteria 2638
166 Ga0114129_10499446 3300009147 Bacteria 1589
167 Ga0114129_10817652 3300009147 Bacteria 1187
168 Ga0114129_11081202 3300009147 Bacteria 1005
169 Ga0114129_11351122 3300009147 Bacteria 881
170 Ga0114129_12621611 3300009147 Bacteria 601
171 Ga0105243_10034312 3300009148 Bacteria 3927
172 Ga0105243_10769122 3300009148 Bacteria 946
173 Ga0105241_10006643 3300009174 Bacteria 8524
174 Ga0105242_10012015 3300009176 Bacteria 6666
175 Ga0105242_10566914 3300009176 Bacteria 1091
176 Ga0105248_10047348 3300009177 Bacteria 4821
177 Ga0105248_11911070 3300009177 Bacteria 674
178 Ga0105238_10844137 3300009551 Bacteria 933
179 Ga0105249_10058065 3300009553 Bacteria 3546
180 Ga0105249_10248890 3300009553 Bacteria 1761
181 Ga0105239_10023083 3300010375 Bacteria 6858
182 Ga0105239_13221016 3300010375 Bacteria 531
183 Ga0105246_10089636 3300011119 Bacteria 2213
184 Ga0105246_10254083 3300011119 Bacteria 1397
185 Ga0157371_10021369 3300013102 Bacteria 4751
186 Ga0157371_11055541 3300013102 Bacteria 622
187 Ga0157378_10075301 3300013297 Bacteria 3039
188 Ga0163162_11390379 3300013306 Unclassified 798
189 Ga0163162_11902536 3300013306 Unclassified 681
190 Ga0157375_10379332 3300013308 Bacteria 1580
191 Ga0157375_10617099 3300013308 Bacteria 1243
192 Ga0163163_10041997 3300014325 Bacteria 4476
193 Ga0163163_11051267 3300014325 Bacteria 877
194 Ga0163163_12931526 3300014325 Bacteria 532
195 Ga0157380_10496428 3300014326 Bacteria 1184
196 Ga0157380_11228549 3300014326 Bacteria 794
197 Ga0182008_10544871 3300014497 Bacteria 644
198 Ga0157377_11560736 3300014745 Unclassified 527
199 Ga0157379_10077664 3300014968 Bacteria 2973
200 Ga0157379_10126392 3300014968 Bacteria 2300
201 Ga0157379_10450366 3300014968 Bacteria 1188
202 Ga0157379_11613073 3300014968 Bacteria 634
203 Ga0157376_10694168 3300014969 Bacteria 1022
204 Ga0163161_10110208 3300017792 Bacteria 2057
205 Ga0163161_11493349 3300017792 Bacteria 593
206 Ga0207653_10052792 3300025885 Bacteria 1356
207 Ga0207682_10158218 3300025893 Bacteria 1025
208 Ga0207642_10001600 3300025899 Bacteria 6974
209 Ga0207688_10542386 3300025901 Bacteria 730
210 Ga0207680_10051914 3300025903 Bacteria 2454
211 Ga0207685_10029835 3300025905 Bacteria 1935
212 Ga0207645_10000654 3300025907 Bacteria 28792
213 Ga0207643_10018495 3300025908 Bacteria 3816
214 Ga0207684_10209514 3300025910 Bacteria 1681
215 Ga0207684_10278157 3300025910 Unclassified 1444
216 Ga0207684_10486627 3300025910 Bacteria 1058
217 Ga0207684_10644146 3300025910 Bacteria 903
218 Ga0207654_10022254 3300025911 Bacteria 3380
219 Ga0207695_10078707 3300025913 Bacteria 3344
220 Ga0207693_10116841 3300025915 Bacteria 2094
221 Ga0207693_10518527 3300025915 Bacteria 930
222 Ga0207663_10096574 3300025916 Bacteria 1974
223 Ga0207663_10224832 3300025916 Bacteria 1368
224 Ga0207660_10065876 3300025917 Bacteria 2619
225 Ga0207660_10316595 3300025917 Bacteria 1245
226 Ga0207660_10458276 3300025917 Bacteria 1032
227 Ga0207660_11384837 3300025917 Bacteria 570
228 Ga0207657_10192867 3300025919 Bacteria 1642
229 Ga0207652_10558367 3300025921 Bacteria 1028
230 Ga0207652_10621990 3300025921 Bacteria 967
231 Ga0207646_10027898 3300025922 Bacteria 5147
232 Ga0207646_10047328 3300025922 Bacteria 3857
233 Ga0207646_11333605 3300025922 Bacteria 626
234 Ga0207646_11829112 3300025922 Unclassified 519
235 Ga0207681_10058353 3300025923 Bacteria 2642
236 Ga0207681_10483711 3300025923 Bacteria 1011
237 Ga0207687_10149457 3300025927 Bacteria 1781
238 Ga0207700_10702151 3300025928 Bacteria 903
239 Ga0207644_10269770 3300025931 Bacteria 1363
240 Ga0207706_10000244 3300025933 Bacteria 59754
241 Ga0207706_10095957 3300025933 Bacteria 2608
242 Ga0207686_10000739 3300025934 Bacteria 20216
243 Ga0207709_10010091 3300025935 Bacteria 5202
244 Ga0207669_10000951 3300025937 Bacteria 12276
245 Ga0207669_11051127 3300025937 Bacteria 686
246 Ga0207704_10047633 3300025938 Bacteria 2564
247 Ga0207704_10348203 3300025938 Bacteria 1153
248 Ga0207704_10460666 3300025938 Bacteria 1017
249 Ga0207691_10120126 3300025940 Bacteria 2330
250 Ga0207711_10014398 3300025941 Bacteria 6568
251 Ga0207689_10004763 3300025942 Bacteria 12241
252 Ga0207661_10229177 3300025944 Bacteria 1645
253 Ga0207679_10897599 3300025945 Bacteria 810
254 Ga0207679_11706128 3300025945 Unclassified 576
255 Ga0207651_10130991 3300025960 Bacteria 1920
256 Ga0207712_10036673 3300025961 Bacteria 3341
257 Ga0207712_10150022 3300025961 Bacteria 1800
258 Ga0207668_10067824 3300025972 Bacteria 2534
259 Ga0207640_10003546 3300025981 Bacteria 8416
260 Ga0207640_10771645 3300025981 Unclassified 830
261 Ga0207658_10459638 3300025986 Unclassified 1128
262 Ga0207658_10461392 3300025986 Bacteria 1126
263 Ga0207677_10414698 3300026023 Bacteria 1145
264 Ga0207703_10700002 3300026035 Bacteria 963
265 Ga0207703_11508492 3300026035 Unclassified 647
266 Ga0207639_10141825 3300026041 Bacteria 2003
267 Ga0207639_11719577 3300026041 Bacteria 588
268 Ga0207678_10885472 3300026067 Bacteria 789
269 Ga0207678_11690597 3300026067 Bacteria 556
270 Ga0207678_11805379 3300026067 Bacteria 535
271 Ga0207708_10050542 3300026075 Bacteria 3165
272 Ga0207708_10145613 3300026075 Bacteria 1861
273 Ga0207708_10659312 3300026075 Bacteria 891
274 Ga0207702_10963890 3300026078 Bacteria 846
275 Ga0207641_10014994 3300026088 Bacteria 6354
276 Ga0207641_10366685 3300026088 Bacteria 1376
277 Ga0207648_10000273 3300026089 Bacteria 56070
278 Ga0207648_11750673 3300026089 Bacteria 583
279 Ga0207676_10088565 3300026095 Bacteria 2534
280 Ga0207676_10251708 3300026095 Bacteria 1590
281 Ga0207676_11021755 3300026095 Bacteria 815
282 Ga0207676_11579351 3300026095 Bacteria 654
283 Ga0207674_10037131 3300026116 Bacteria 5070
284 Ga0207674_10874572 3300026116 Bacteria 866
285 Ga0207675_100022222 3300026118 Bacteria 5907
286 Ga0207675_100793598 3300026118 Bacteria 960
287 Ga0207675_101018263 3300026118 Bacteria 847
288 Ga0207675_101504994 3300026118 Bacteria 694
289 Ga0207683_10006669 3300026121 Bacteria 9877
290 Ga0207683_10693967 3300026121 Bacteria 944
291 Ga0207698_10553202 3300026142 Bacteria 1128
292 Ga0209998_10069499 3300027717 Bacteria 840
293 Ga0207428_10156595 3300027907 Bacteria 1732
294 Ga0207428_10176884 3300027907 Bacteria 1613
295 Ga0268265_10498898 3300028380 Bacteria 1146
296 Ga0268265_11309278 3300028380 Bacteria 725
297 Ga0268265_11407957 3300028380 Bacteria 699
298 Ga0268264_10313772 3300028381 Bacteria 1480
299 Ga0307408_100005949 3300031548 Bacteria 8125
300 Ga0307408_100026791 3300031548 Bacteria 3965
301 Ga0307408_100031731 3300031548 Bacteria 3680
302 Ga0307408_100368456 3300031548 Bacteria 1224
303 Ga0307408_100906506 3300031548 Bacteria 807
304 Ga0307405_10095960 3300031731 Bacteria 1976
305 Ga0307405_10250186 3300031731 Bacteria 1318
306 Ga0307405_10629985 3300031731 Bacteria 879
307 Ga0307413_10013116 3300031824 Bacteria 4151
308 Ga0307413_10028104 3300031824 Bacteria 3127
309 Ga0307413_10028238 3300031824 Bacteria 3121
310 Ga0307413_10030957 3300031824 Bacteria 3012
311 Ga0307413_10045105 3300031824 Bacteria 2610
312 Ga0307413_10078817 3300031824 Bacteria 2103
313 Ga0307413_10849126 3300031824 Bacteria 771
314 Ga0307413_10988661 3300031824 Bacteria 720
315 Ga0307410_10002568 3300031852 Bacteria 8806
316 Ga0307410_10003332 3300031852 Bacteria 8038
317 Ga0307410_10006262 3300031852 Bacteria 6406
318 Ga0307410_10018020 3300031852 Bacteria 4256
319 Ga0307410_10032819 3300031852 Bacteria 3347
320 Ga0307410_10065406 3300031852 Bacteria 2501
321 Ga0307410_10075903 3300031852 Bacteria 2344
322 Ga0307410_10088549 3300031852 Bacteria 2192
323 Ga0307410_10125921 3300031852 Bacteria 1876
324 Ga0307410_10383126 3300031852 Bacteria 1132
325 Ga0307410_11069671 3300031852 Bacteria 698
326 Ga0307410_11634905 3300031852 Unclassified 570
327 Ga0307410_11701440 3300031852 Bacteria 559
328 Ga0307406_10022221 3300031901 Bacteria 3761
329 Ga0307406_10027530 3300031901 Bacteria 3426
330 Ga0307406_10027577 3300031901 Bacteria 3424
331 Ga0307406_10056263 3300031901 Bacteria 2518
332 Ga0307406_10085881 3300031901 Bacteria 2105
333 Ga0307407_10047860 3300031903 Bacteria 2430
334 Ga0307407_10081642 3300031903 Bacteria 1957
335 Ga0307407_10342271 3300031903 Bacteria 1056
336 Ga0307407_10495924 3300031903 Bacteria 894
337 Ga0307407_10582447 3300031903 Unclassified 831
338 Ga0307407_10933014 3300031903 Bacteria 667
339 Ga0307407_11278308 3300031903 Unclassified 575
340 Ga0307412_10033086 3300031911 Bacteria 3283
341 Ga0307412_10045066 3300031911 Bacteria 2881
342 Ga0307412_10316143 3300031911 Bacteria 1240
343 Ga0307412_11974227 3300031911 Unclassified 540
344 Ga0307409_100000665 3300031995 Bacteria 15233
345 Ga0307409_100010974 3300031995 Bacteria 5677
346 Ga0307409_100052697 3300031995 Bacteria 3122
347 Ga0307409_100066895 3300031995 Bacteria 2835
348 Ga0307409_100139059 3300031995 Bacteria 2089
349 Ga0307409_100320000 3300031995 Bacteria 1451
350 Ga0307409_100564770 3300031995 Bacteria 1119
351 Ga0307409_101110484 3300031995 Bacteria 812
352 Ga0307416_100000169 3300032002 Bacteria 36583
353 Ga0307416_100000867 3300032002 Bacteria 15923
354 Ga0307416_100058032 3300032002 Bacteria 3135
355 Ga0307416_100067890 3300032002 Bacteria 2943
356 Ga0307416_100076556 3300032002 Bacteria 2805
357 Ga0307416_100104769 3300032002 Bacteria 2473
358 Ga0307416_100109195 3300032002 Bacteria 2433
359 Ga0307416_100209651 3300032002 Bacteria 1857
360 Ga0307416_100339171 3300032002 Bacteria 1515
361 Ga0307416_100554186 3300032002 Bacteria 1223
362 Ga0307416_100854964 3300032002 Bacteria 1008
363 Ga0307416_101097655 3300032002 Bacteria 900
364 Ga0307416_101529157 3300032002 Bacteria 773
365 Ga0307416_102889113 3300032002 Archaea 575
366 Ga0307416_103794208 3300032002 Bacteria 506
367 Ga0307414_10002833 3300032004 Bacteria 9143
368 Ga0307414_10010252 3300032004 Bacteria 5428
369 Ga0307414_10029303 3300032004 Bacteria 3581
370 Ga0307414_10413798 3300032004 Bacteria 1174
371 Ga0307414_10419233 3300032004 Bacteria 1167
372 Ga0307414_10562222 3300032004 Bacteria 1018
373 Ga0307411_10004089 3300032005 Bacteria 6916
374 Ga0307411_10008563 3300032005 Bacteria 5310
375 Ga0307411_10009847 3300032005 Bacteria 5056
376 Ga0307411_10010011 3300032005 Bacteria 5025
377 Ga0307411_10023128 3300032005 Bacteria 3674
378 Ga0307411_10036137 3300032005 Bacteria 3092
379 Ga0307411_10136237 3300032005 Bacteria 1803
380 Ga0307411_10188055 3300032005 Bacteria 1574
381 Ga0307411_10208933 3300032005 Bacteria 1506
382 Ga0307411_10663709 3300032005 Bacteria 904
383 Ga0307415_100001210 3300032126 Bacteria 12111
384 Ga0307415_100020805 3300032126 Bacteria 4016
385 Ga0307415_100041964 3300032126 Bacteria 3041
386 Ga0307415_100046942 3300032126 Bacteria 2904
387 Ga0307415_100054076 3300032126 Bacteria 2739
388 Ga0307415_100077313 3300032126 Bacteria 2363
389 Ga0307415_100226066 3300032126 Bacteria 1504
390 Ga0307415_100606459 3300032126 Bacteria 975
391 Ga0307415_101232589 3300032126 Bacteria 706
392 Ga0307415_102541477 3300032126 Bacteria 505
393 Ga0373928_0014865 3300035084 Bacteria 1579
394 Ga0373929_0079919 3300035085 Bacteria 795
395 Ga0373929_0126946 3300035085 Bacteria 665
396 Ga0373940_0044441 3300035088 Bacteria 1231
397 Ga0373940_0173131 3300035088 Bacteria 698
398 Ga0373940_0199266 3300035088 Unclassified 657
399 Ga0373949_0226281 3300035090 Unclassified 570
400 Ga0373949_0286940 3300035090 Unclassified 519
401 Ga0373951_0018130 3300035091 Bacteria 1598
402 Ga0373932_0387810 3300035112 Bacteria 538
403 Ga0373939_0080402 3300035114 Bacteria 1081
404 Ga0373939_0154586 3300035114 Bacteria 838
405 Ga0373941_0058249 3300035115 Bacteria 1250
406 Ga0373941_0319340 3300035115 Unclassified 624
407 Ga0373960_0061604 3300035121 Bacteria 1140
408 Ga0373960_0091538 3300035121 Bacteria 973
409 Ga0373942_0023024 3300035207 Bacteria 1587
410 Ga0373961_0427118 3300035241 Bacteria 513
411 Ga0373962_0070139 3300035242 Bacteria 1046
412 Ga0373962_0138127 3300035242 Bacteria 790
413 Ga0373931_0054141 3300035691 Bacteria 2144
414 Ga0373931_0116197 3300035691 Bacteria 1524
415 Ga0373931_0558948 3300035691 Bacteria 744
416 Ga0373931_0576431 3300035691 Bacteria 733
417 Ga0373937_0117801 3300036401 Bacteria 2474
418 Ga0395905_0478378 3300037471 Bacteria 1145
419 Ga0395905_0539105 3300037471 Bacteria 1068
420 Ga0395905_1845704 3300037471 Bacteria 510
421 Ga0395901_0387432 3300038443 Bacteria 1438
422 Ga0395901_0992798 3300038443 Bacteria 816
423 Ga0242419_009502 3300038698 Bacteria 737
424 Ga0242420_004009 3300038996 Bacteria 2202
425 Ga0242420_066752 3300038996 Bacteria 725
426 Ga0242420_080861 3300038996 Bacteria 671
427 Ga0439441_066403 3300042001 Bacteria 767
428 Ga0439434_0091527 3300042435 Bacteria 973
429 Ga0439435_0035267 3300042436 Bacteria 1379
430 Ga0439459_0058676 3300042438 Bacteria 864
431 Ga0451577_0018318 3300042876 Bacteria 6453
432 Ga0451577_0291948 3300042876 Bacteria 1478
433 Ga0453683_0253843 3300044673 Bacteria 1121
434 Ga0453683_1201478 3300044673 Bacteria 508
435 Ga0453684_0221947 3300044712 Bacteria 2189
436 Ga0453684_1105708 3300044712 Bacteria 837
437 Ga0451576_1757787 3300045051 Bacteria 641
438 Ga0466967_1029796 3300045976 Bacteria 820
439 Ga0495592_0240070 3300046454 Bacteria 1203
440 Ga0495603_0008621 3300046455 Bacteria 6162
441 Ga0495641_0042347 3300046461 Bacteria 2111
442 Ga0495582_0176355 3300046473 Bacteria 1217
443 Ga0495639_0164715 3300046475 Bacteria 1074
444 Ga0495639_0242234 3300046475 Unclassified 890
445 Ga0495664_0010407 3300046477 Bacteria 5218
446 Ga0495594_0009149 3300046499 Bacteria 5111
447 Ga0495618_0005880 3300046514 Bacteria 7459
448 Ga0495630_0017989 3300046517 Bacteria 5186
449 Ga0495666_0018868 3300046526 Bacteria 3426
450 Ga0495640_0003406 3300046533 Bacteria 12796
451 Ga0495586_0024595 3300046535 Bacteria 3220
452 Ga0495633_0183904 3300046558 Bacteria 962
453 Ga0495667_0781200 3300046559 Bacteria 589
454 Ga0495656_0739499 3300046615 Unclassified 530
455 Ga0495634_0011818 3300046642 Bacteria 6349
456 Ga0495635_0860318 3300046663 Bacteria 582
457 Ga0495659_0080321 3300046664 Bacteria 1237
458 Ga0495647_0008341 3300046681 Bacteria 3482
459 Ga0495658_0003805 3300046683 Bacteria 7473
460 Ga0495613_0025942 3300046689 Bacteria 4366
461 Ga0495670_0044607 3300046691 Bacteria 2214
462 Ga0495636_0013911 3300047318 Bacteria 3197
463 Ga0495674_0006526 3300047319 Bacteria 11195
464 Ga0495680_0007903 3300047322 Bacteria 9706
465 Ga0495684_0105238 3300047471 Bacteria 2132
466 Ga0495593_0134558 3300047673 Bacteria 1254
467 Ga0495614_0048945 3300048089 Bacteria 1812
468 Ga0496100_0175105 3300048903 Bacteria 1548
469 Ga0496101_0045795 3300048904 Bacteria 3135
470 Ga0496101_0233359 3300048904 Bacteria 1431
471 Ga0496101_1105086 3300048904 Unclassified 622
472 Ga0496102_0129883 3300048905 Bacteria 2357
473 Ga0496102_0180956 3300048905 Bacteria 1986
474 Ga0496102_0309306 3300048905 Bacteria 1489
475 Ga0496102_0389966 3300048905 Bacteria 1310
476 Ga0496102_0679341 3300048905 Bacteria 953
477 Ga0496102_1952564 3300048905 Bacteria 503
478 Ga0496103_0036580 3300048906 Bacteria 3007
479 Ga0496103_0180793 3300048906 Bacteria 1356
480 Ga0496103_0299815 3300048906 Bacteria 1034
481 Ga0496104_0099730 3300048907 Bacteria 2780
482 Ga0496104_0203729 3300048907 Bacteria 1890
483 Ga0496104_0618949 3300048907 Bacteria 992
484 Ga0496105_0218864 3300048908 Bacteria 1550
485 Ga0496105_0642879 3300048908 Unclassified 819
486 Ga0496106_0023979 3300048909 Bacteria 4534
487 Ga0496106_0025578 3300048909 Bacteria 4394
488 Ga0496106_0050308 3300048909 Bacteria 3141
489 Ga0496106_0423328 3300048909 Bacteria 1070
490 Ga0496106_0810616 3300048909 Bacteria 742
491 Ga0496106_0884025 3300048909 Unclassified 706
492 Ga0496107_0162551 3300048910 Bacteria 1655
493 Ga0496107_0191963 3300048910 Bacteria 1518
494 Ga0496108_0007531 3300048911 Bacteria 8824
495 Ga0496108_0020371 3300048911 Bacteria 5451
496 Ga0496108_0030609 3300048911 Bacteria 4460
497 Ga0496109_0001213 3300048912 Bacteria 21423
498 Ga0496109_0007276 3300048912 Bacteria 9358
499 Ga0496109_0110285 3300048912 Bacteria 2558
500 Ga0496109_0344247 3300048912 Bacteria 1408
501 Ga0496109_1074714 3300048912 Bacteria 742
502 Ga0496110_0008231 3300048913 Bacteria 8381
503 Ga0496110_0086073 3300048913 Bacteria 2805
504 Ga0496110_0142950 3300048913 Bacteria 2163
505 Ga0496110_0264039 3300048913 Bacteria 1567
506 Ga0496111_0008696 3300048914 Bacteria 6736
507 Ga0496112_0007045 3300048915 Bacteria 9933
508 Ga0496112_0025715 3300048915 Bacteria 5653
509 Ga0496112_0027925 3300048915 Bacteria 5443
510 Ga0496112_0119722 3300048915 Bacteria 2603
511 Ga0496113_0004956 3300048916 Bacteria 8247
512 Ga0496113_0016734 3300048916 Bacteria 5071
513 Ga0496113_0214674 3300048916 Bacteria 1532
514 Ga0496114_0071341 3300048917 Bacteria 2919
515 Ga0496114_0442687 3300048917 Bacteria 1151
516 Ga0496114_0832360 3300048917 Bacteria 802
517 Ga0501299_018040 3300049522 Bacteria 1265
518 Ga0501031_0084686 3300049568 Bacteria 2067
519 Ga0501033_0126833 3300049570 Bacteria 1850
520 Ga0501036_0204346 3300049572 Bacteria 1661
521 Ga0501036_0394311 3300049572 Bacteria 1155
522 Ga0501037_0180745 3300049573 Bacteria 1497
523 Ga0501037_0548433 3300049573 Bacteria 780
524 Ga0501038_0123961 3300049574 Bacteria 2128
525 Ga0501038_0200000 3300049574 Bacteria 1604
526 Ga0501038_0590989 3300049574 Bacteria 841
527 Ga0501038_0679909 3300049574 Bacteria 773
528 Ga0501039_0074687 3300049575 Bacteria 2635
529 Ga0501040_0099029 3300049576 Bacteria 2032
530 Ga0501040_0202093 3300049576 Bacteria 1411
531 Ga0501040_0632261 3300049576 Bacteria 773
532 Ga0501040_1057784 3300049576 Unclassified 588
533 Ga0501041_0045136 3300049577 Bacteria 2679
534 Ga0501041_0584123 3300049577 Unclassified 713
535 Ga0501042_0232881 3300049578 Bacteria 1329
536 Ga0501043_0264848 3300049579 Bacteria 1321
537 Ga0501043_1199064 3300049579 Unclassified 533
538 Ga0501046_0123993 3300049580 Bacteria 1964
539 Ga0501046_0151832 3300049580 Bacteria 1747
540 Ga0501046_0306742 3300049580 Bacteria 1158
541 Ga0501046_1041884 3300049580 Unclassified 567
542 Ga0501048_0610630 3300049582 Bacteria 783
543 Ga0501067_0027880 3300049583 Bacteria 3130
544 Ga0501067_0081415 3300049583 Bacteria 1795
545 Ga0501067_0128229 3300049583 Bacteria 1411
546 Ga0501067_0326390 3300049583 Bacteria 855
547 Ga0501068_0071844 3300049584 Bacteria 2113
548 Ga0501068_0680197 3300049584 Bacteria 672
549 Ga0501069_0045087 3300049585 Bacteria 2442
550 Ga0501069_0132235 3300049585 Bacteria 1429
551 Ga0501069_0271244 3300049585 Bacteria 992
552 Ga0501070_0145673 3300049586 Bacteria 1955
553 Ga0501071_0033094 3300049587 Bacteria 3673
554 Ga0501072_0096123 3300049588 Bacteria 2354
555 Ga0501074_0037332 3300049590 Bacteria 3522
556 Ga0501074_0503850 3300049590 Bacteria 858
557 Ga0501075_0015555 3300049591 Bacteria 5460
558 Ga0501075_0360363 3300049591 Bacteria 1108
559 Ga0501075_0882133 3300049591 Unclassified 680
560 Ga0501075_0995661 3300049591 Unclassified 637
561 Ga0501076_0075407 3300049592 Bacteria 2703
562 Ga0501076_0173234 3300049592 Bacteria 1759
563 Ga0501076_0214594 3300049592 Bacteria 1573
564 Ga0501076_0306918 3300049592 Bacteria 1301
565 Ga0501076_0396839 3300049592 Bacteria 1134
566 Ga0501076_1508785 3300049592 Unclassified 552
567 Ga0501077_0001177 3300049593 Bacteria 15828
568 Ga0501077_0043784 3300049593 Bacteria 2845
569 Ga0501077_0051951 3300049593 Bacteria 2603
570 Ga0501077_0359910 3300049593 Bacteria 929
571 Ga0501077_0718566 3300049593 Unclassified 642
572 Ga0501199_005575 3300049650 Bacteria 1266
573 Ga0501209_033028 3300049656 Bacteria 1325
574 Ga0501209_035671 3300049656 Bacteria 1289
575 Ga0501209_057390 3300049656 Bacteria 1078
576 Ga0501209_142989 3300049656 Bacteria 718
577 Ga0501211_025768 3300049658 Bacteria 640
578 Ga0501216_027457 3300049660 Bacteria 1033
579 Ga0501217_015539 3300049661 Bacteria 1735
580 Ga0501233_018413 3300049668 Bacteria 1469
581 Ga0501233_023535 3300049668 Bacteria 1340
582 Ga0501243_030647 3300049675 Bacteria 917
583 Ga0501247_024646 3300049677 Bacteria 797
584 Ga0501249_016756 3300049679 Bacteria 1575
585 Ga0501249_046991 3300049679 Bacteria 987
586 Ga0501249_091688 3300049679 Bacteria 721
587 Ga0501249_099465 3300049679 Bacteria 695
588 Ga0501251_014722 3300049681 Unclassified 975
589 Ga0501253_106327 3300049683 Unclassified 664
590 Ga0501257_096248 3300049686 Bacteria 774
591 Ga0501258_001408 3300049687 Bacteria 1958
592 Ga0501221_010769 3300049704 Bacteria 1632
593 Ga0501225_0028841 3300049705 Bacteria 1525
594 Ga0501079_0069364 3300049741 Bacteria 2721
595 Ga0501079_0148048 3300049741 Bacteria 1830
596 Ga0501079_0165543 3300049741 Bacteria 1724
597 Ga0501079_0201756 3300049741 Bacteria 1553
598 Ga0501079_0451523 3300049741 Bacteria 1009
599 Ga0501080_0147413 3300049742 Bacteria 2176
600 Ga0501080_0481241 3300049742 Bacteria 1111
601 Ga0501080_0760252 3300049742 Bacteria 852
602 Ga0501081_0093036 3300049743 Bacteria 2122
603 Ga0501081_0123029 3300049743 Bacteria 1849
604 Ga0501081_0169682 3300049743 Bacteria 1575
605 Ga0501081_0235482 3300049743 Bacteria 1334
606 Ga0501081_0235671 3300049743 Bacteria 1334
607 Ga0501083_0126016 3300049744 Bacteria 1679
608 Ga0501083_0897602 3300049744 Unclassified 577
609 Ga0501264_020928 3300049761 Bacteria 695
610 Ga0501266_029634 3300049763 Bacteria 777
611 Ga0501267_005648 3300049764 Bacteria 1188
612 Ga0501270_025212 3300049767 Bacteria 940
613 Ga0501273_009919 3300049770 Bacteria 1163
614 Ga0501276_035464 3300049773 Unclassified 538
615 Ga0501283_006872 3300049779 Bacteria 1606
616 Ga0501283_024292 3300049779 Bacteria 987
617 Ga0501035_0229845 3300049822 Bacteria 1581
618 Ga0501035_1318551 3300049822 Bacteria 556
619 Ga0501045_0056535 3300049824 Bacteria 2870
620 Ga0501045_0120708 3300049824 Bacteria 1946
621 Ga0501045_0252193 3300049824 Bacteria 1313
622 Ga0501045_0716859 3300049824 Unclassified 738
623 Ga0501204_009290 3300049850 Bacteria 1134
624 Ga0501212_029659 3300049851 Bacteria 878
625 nmdc:mga05p37_148079_c1 3300050507 Bacteria 2873
626 nmdc:mga05p37_1933540_c1 3300050507 Unclassified 562
627 nmdc:mga05p37_291525_c1 3300050507 Bacteria 1280
628 nmdc:mga05p37_694322_c1 3300050507 Bacteria 1132
629 nmdc:mga05p37_715376_c1 3300050507 Bacteria 1110
630 nmdc:mga05p37_934377_c1 3300050507 Bacteria 930
631 nmdc:mga09592_568948_c1 3300050508 Bacteria 972
632 nmdc:mga09592_59953_c1 3300050508 Bacteria 3217
633 nmdc:mga0qj67_278760_c1 3300050509 Bacteria 1355
634 nmdc:mga0qj67_7368_c1 3300050509 Bacteria 8133
635 nmdc:mga06r32_1218704_c1 3300050510 Bacteria 698
636 nmdc:mga06r32_342801_c1 3300050510 Bacteria 1479
637 nmdc:mga06r32_511208_c1 3300050510 Bacteria 1177
638 nmdc:mga06r32_864959_c1 3300050510 Bacteria 862
639 nmdc:mga08y16_281292_c1 3300050511 Bacteria 1716
640 nmdc:mga08y16_415585_c1 3300050511 Bacteria 1375
641 nmdc:mga08y16_621829_c1 3300050511 Bacteria 1087
642 nmdc:mga0n895_1319348_c1 3300050512 Bacteria 692
643 nmdc:mga0n895_295528_c1 3300050512 Bacteria 1642
644 nmdc:mga0n895_569961_c1 3300050512 Bacteria 1137
645 nmdc:mga0rr50_643794_c1 3300050513 Bacteria 904
646 nmdc:mga0rr50_934934_c1 3300050513 Bacteria 739
647 nmdc:mga0a205_40614_c1 3300050515 Bacteria 4479
648 nmdc:mga0a205_85608_c1 3300050515 Bacteria 3044
649 Ga0501084_0006598 3300054114 Bacteria 9538
650 Ga0501084_0320495 3300054114 Bacteria 1309
651 Ga0501084_0559492 3300054114 Bacteria 966
652 Ga0590071_001573 3300059421 Bacteria 5973
653 Ga0590071_002778 3300059421 Bacteria 4384
654 Ga0590071_012194 3300059421 Bacteria 2014
655 Ga0590071_039033 3300059421 Bacteria 1141
656 Ga0590071_066097 3300059421 Bacteria 888
657 Ga0590074_028681 3300059423 Bacteria 978
658 Ga0590075_024941 3300059424 Bacteria 1502
659 Ga0590075_037947 3300059424 Bacteria 1229
660 Ga0590077_050286 3300059426 Bacteria 935
661 Ga0590077_083583 3300059426 Bacteria 736
662 Ga0587066_056959 3300059490 Bacteria 787
663 Ga0501082_0064431 3300060353 Bacteria 3156
664 Ga0501082_1011507 3300060353 Bacteria 727
665 Ga0501082_1371747 3300060353 Bacteria 617
666 Ga0501082_1443506 3300060353 Unclassified 601
667 Ga0501082_1785689 3300060353 Bacteria 536
668 Ga0530510_0200281 3300061734 Bacteria 1483
669 Ga0530510_0394416 3300061734 Bacteria 1043
670 Ga0530510_0417474 3300061734 Bacteria 1013
671 Ga0530510_0598932 3300061734 Bacteria 838
672 Ga0530510_0882050 3300061734 Bacteria 683
673 Ga0530510_1245687 3300061734 Bacteria 570

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_100002772 Ga0070674_1000027722 82
2 3300005445 Ga0070708_101901325 Ga0070708_1019013251 82
3 3300005459 Ga0068867_100001444 Ga0068867_10000144410 82
4 3300005467 Ga0070706_100268398 Ga0070706_1002683982 82
5 3300005468 Ga0070707_100069499 Ga0070707_1000694992 82
6 3300005471 Ga0070698_100139002 Ga0070698_1001390022 82
7 3300005518 Ga0070699_100008009 Ga0070699_1000080098 82
8 3300005618 Ga0068864_100001101 Ga0068864_10000110121 82
9 3300005718 Ga0068866_10000165 Ga0068866_1000016519 82
10 3300006358 Ga0068871_100094094 Ga0068871_1000940942 82
11 3300006881 Ga0068865_100001488 Ga0068865_10000148813 82
12 3300025907 Ga0207645_10000654 Ga0207645_1000065431 82
13 3300025921 Ga0207652_10558367 Ga0207652_105583672 82
14 3300025922 Ga0207646_10047328 Ga0207646_100473283 82
15 3300025927 Ga0207687_10149457 Ga0207687_101494572 82
16 3300025933 Ga0207706_10000244 Ga0207706_1000024412 82
17 3300025934 Ga0207686_10000739 Ga0207686_100007399 82
18 3300025937 Ga0207669_10000951 Ga0207669_1000095111 82
19 3300025942 Ga0207689_10004763 Ga0207689_100047633 82
20 3300026089 Ga0207648_10000273 Ga0207648_1000027349 82
21 3300026095 Ga0207676_10251708 Ga0207676_102517081 82
22 3300026121 Ga0207683_10006669 Ga0207683_100066698 82
23 3300032002 Ga0307416_101529157 Ga0307416_1015291572 82
24 3300036401 Ga0373937_0117801 Ga0373937_0117801_686_934 82
25 3300046454 Ga0495592_0240070 Ga0495592_0240070_450_698 82
26 3300046461 Ga0495641_0042347 Ga0495641_0042347_1446_1694 82
27 3300046473 Ga0495582_0176355 Ga0495582_0176355_103_351 82
28 3300046475 Ga0495639_0164715 Ga0495639_0164715_505_753 82
29 3300046477 Ga0495664_0010407 Ga0495664_0010407_3128_3376 82
30 3300046499 Ga0495594_0009149 Ga0495594_0009149_280_528 82
31 3300046514 Ga0495618_0005880 Ga0495618_0005880_4400_4648 82
32 3300046517 Ga0495630_0017989 Ga0495630_0017989_3033_3281 82
33 3300046526 Ga0495666_0018868 Ga0495666_0018868_601_849 82
34 3300046533 Ga0495640_0003406 Ga0495640_0003406_6024_6272 82
35 3300046535 Ga0495586_0024595 Ga0495586_0024595_2894_3142 82
36 3300046559 Ga0495667_0781200 Ga0495667_0781200_168_416 82
37 3300046642 Ga0495634_0011818 Ga0495634_0011818_6064_6312 82
38 3300046663 Ga0495635_0860318 Ga0495635_0860318_182_430 82
39 3300046681 Ga0495647_0008341 Ga0495647_0008341_392_640 82
40 3300046683 Ga0495658_0003805 Ga0495658_0003805_5352_5600 82
41 3300046689 Ga0495613_0025942 Ga0495613_0025942_2440_2688 82
42 3300047319 Ga0495674_0006526 Ga0495674_0006526_4870_5118 82
43 3300047322 Ga0495680_0007903 Ga0495680_0007903_4169_4417 82
44 3300047471 Ga0495684_0105238 Ga0495684_0105238_1378_1626 82
45 3300047673 Ga0495593_0134558 Ga0495593_0134558_324_572 82
46 3300048089 Ga0495614_0048945 Ga0495614_0048945_1191_1439 82
47 3300048917 Ga0496114_0832360 Ga0496114_0832360_541_789 82
48 3300035084 Ga0373928_0014865 Ga0373928_0014865_1085_1336 83
49 3300048909 Ga0496106_0884025 Ga0496106_0884025_28_279 83
50 3300048917 Ga0496114_0442687 Ga0496114_0442687_875_1126 83
51 3300049579 Ga0501043_1199064 Ga0501043_1199064_248_499 83
52 3300049582 Ga0501048_0610630 Ga0501048_0610630_10_261 83
53 3300049592 Ga0501076_0396839 Ga0501076_0396839_858_1109 83
54 3300049592 Ga0501076_1508785 Ga0501076_1508785_277_528 83
55 3300049743 Ga0501081_0093036 Ga0501081_0093036_32_283 83
56 3300060353 Ga0501082_1371747 Ga0501082_1371747_24_275 83
57 3300005295 Ga0065707_10466576 Ga0065707_104665761 96
58 3300005328 Ga0070676_10039684 Ga0070676_100396842 96
59 3300005330 Ga0070690_100056417 Ga0070690_1000564172 96
60 3300005333 Ga0070677_10127839 Ga0070677_101278392 96
61 3300005334 Ga0068869_100007142 Ga0068869_1000071425 96
62 3300005335 Ga0070666_10057226 Ga0070666_100572263 96
63 3300005336 Ga0070680_100390387 Ga0070680_1003903872 96
64 3300005336 Ga0070680_100931858 Ga0070680_1009318582 96
65 3300005336 Ga0070680_101874526 Ga0070680_1018745261 96
66 3300005341 Ga0070691_10008925 Ga0070691_100089252 96
67 3300005341 Ga0070691_10049859 Ga0070691_100498591 96
68 3300005344 Ga0070661_100433319 Ga0070661_1004333192 96
69 3300005345 Ga0070692_10062581 Ga0070692_100625812 96
70 3300005353 Ga0070669_100739979 Ga0070669_1007399792 96
71 3300005354 Ga0070675_100345992 Ga0070675_1003459922 96
72 3300005355 Ga0070671_100333480 Ga0070671_1003334802 96
73 3300005364 Ga0070673_102224785 Ga0070673_1022247851 96
74 3300005367 Ga0070667_100029374 Ga0070667_1000293742 96
75 3300005367 Ga0070667_100183574 Ga0070667_1001835742 96
76 3300005367 Ga0070667_101163471 Ga0070667_1011634712 96
77 3300005406 Ga0070703_10141841 Ga0070703_101418412 96
78 3300005437 Ga0070710_10378022 Ga0070710_103780222 96
79 3300005438 Ga0070701_10130807 Ga0070701_101308072 96
80 3300005438 Ga0070701_10178718 Ga0070701_101787181 96
81 3300005439 Ga0070711_100079919 Ga0070711_1000799192 96
82 3300005439 Ga0070711_100513021 Ga0070711_1005130211 96
83 3300005440 Ga0070705_100006861 Ga0070705_1000068614 96
84 3300005440 Ga0070705_100010366 Ga0070705_1000103662 96
85 3300005440 Ga0070705_100035580 Ga0070705_1000355803 96
86 3300005440 Ga0070705_100368171 Ga0070705_1003681712 96
87 3300005440 Ga0070705_100818014 Ga0070705_1008180142 96
88 3300005440 Ga0070705_100885179 Ga0070705_1008851791 96
89 3300005441 Ga0070700_100091200 Ga0070700_1000912002 96
90 3300005441 Ga0070700_100093439 Ga0070700_1000934392 96
91 3300005441 Ga0070700_101214915 Ga0070700_1012149151 96
92 3300005444 Ga0070694_100214296 Ga0070694_1002142962 96
93 3300005444 Ga0070694_100550160 Ga0070694_1005501602 96
94 3300005444 Ga0070694_101455798 Ga0070694_1014557981 96
95 3300005444 Ga0070694_101888520 Ga0070694_1018885201 96
96 3300005445 Ga0070708_100168293 Ga0070708_1001682932 96
97 3300005445 Ga0070708_100403511 Ga0070708_1004035112 96
98 3300005445 Ga0070708_100610896 Ga0070708_1006108961 96
99 3300005445 Ga0070708_101156705 Ga0070708_1011567052 96
100 3300005445 Ga0070708_101323539 Ga0070708_1013235391 96
101 3300005445 Ga0070708_102118961 Ga0070708_1021189611 96
102 3300005455 Ga0070663_100756666 Ga0070663_1007566662 96
103 3300005456 Ga0070678_100021674 Ga0070678_1000216742 96
104 3300005457 Ga0070662_100009215 Ga0070662_1000092156 96
105 3300005458 Ga0070681_10140844 Ga0070681_101408442 96
106 3300005459 Ga0068867_101600290 Ga0068867_1016002901 96
107 3300005467 Ga0070706_100321284 Ga0070706_1003212842 96
108 3300005467 Ga0070706_100421079 Ga0070706_1004210792 96
109 3300005467 Ga0070706_101144740 Ga0070706_1011447402 96
110 3300005468 Ga0070707_100247277 Ga0070707_1002472772 96
111 3300005471 Ga0070698_100111517 Ga0070698_1001115173 96
112 3300005471 Ga0070698_100177798 Ga0070698_1001777984 96
113 3300005471 Ga0070698_100223466 Ga0070698_1002234662 96
114 3300005471 Ga0070698_100478860 Ga0070698_1004788602 96
115 3300005471 Ga0070698_100873454 Ga0070698_1008734542 96
116 3300005471 Ga0070698_101139768 Ga0070698_1011397682 96
117 3300005471 Ga0070698_101227612 Ga0070698_1012276122 96
118 3300005518 Ga0070699_100093310 Ga0070699_1000933102 96
119 3300005518 Ga0070699_100135473 Ga0070699_1001354733 96
120 3300005518 Ga0070699_100213972 Ga0070699_1002139722 96
121 3300005518 Ga0070699_100909395 Ga0070699_1009093952 96
122 3300005518 Ga0070699_100959528 Ga0070699_1009595282 96
123 3300005518 Ga0070699_101181099 Ga0070699_1011810992 96
124 3300005530 Ga0070679_100311117 Ga0070679_1003111172 96
125 3300005530 Ga0070679_100715931 Ga0070679_1007159312 96
126 3300005535 Ga0070684_101966803 Ga0070684_1019668032 96
127 3300005536 Ga0070697_100021236 Ga0070697_1000212363 96
128 3300005536 Ga0070697_100101706 Ga0070697_1001017062 96
129 3300005536 Ga0070697_101075305 Ga0070697_1010753052 96
130 3300005536 Ga0070697_101295682 Ga0070697_1012956822 96
131 3300005536 Ga0070697_101388814 Ga0070697_1013888142 96
132 3300005539 Ga0068853_100226078 Ga0068853_1002260782 96
133 3300005544 Ga0070686_100263258 Ga0070686_1002632581 96
134 3300005544 Ga0070686_100637300 Ga0070686_1006373001 96
135 3300005545 Ga0070695_100075529 Ga0070695_1000755292 96
136 3300005545 Ga0070695_100984403 Ga0070695_1009844032 96
137 3300005545 Ga0070695_101660756 Ga0070695_1016607561 96
138 3300005546 Ga0070696_100004439 Ga0070696_1000044394 96
139 3300005546 Ga0070696_100017620 Ga0070696_1000176203 96
140 3300005546 Ga0070696_100037557 Ga0070696_1000375572 96
141 3300005546 Ga0070696_100481052 Ga0070696_1004810522 96
142 3300005546 Ga0070696_100645460 Ga0070696_1006454601 96
143 3300005546 Ga0070696_100788547 Ga0070696_1007885471 96
144 3300005546 Ga0070696_101228531 Ga0070696_1012285312 96
145 3300005547 Ga0070693_100321367 Ga0070693_1003213672 96
146 3300005549 Ga0070704_100063496 Ga0070704_1000634962 96
147 3300005549 Ga0070704_100178041 Ga0070704_1001780412 96
148 3300005549 Ga0070704_101298325 Ga0070704_1012983251 96
149 3300005563 Ga0068855_102183438 Ga0068855_1021834381 96
150 3300005564 Ga0070664_100162182 Ga0070664_1001621822 96
151 3300005564 Ga0070664_102118803 Ga0070664_1021188032 96
152 3300005577 Ga0068857_100050518 Ga0068857_1000505182 96
153 3300005577 Ga0068857_100193092 Ga0068857_1001930922 96
154 3300005577 Ga0068857_100617212 Ga0068857_1006172121 96
155 3300005578 Ga0068854_100010148 Ga0068854_1000101482 96
156 3300005578 Ga0068854_100953849 Ga0068854_1009538492 96
157 3300005617 Ga0068859_100076240 Ga0068859_1000762402 96
158 3300005617 Ga0068859_102380627 Ga0068859_1023806271 96
159 3300005618 Ga0068864_100112228 Ga0068864_1001122281 96
160 3300005618 Ga0068864_101009605 Ga0068864_1010096052 96
161 3300005719 Ga0068861_100101728 Ga0068861_1001017282 96
162 3300005719 Ga0068861_100243708 Ga0068861_1002437082 96
163 3300005719 Ga0068861_100549133 Ga0068861_1005491332 96
164 3300005719 Ga0068861_101418099 Ga0068861_1014180992 96
165 3300005719 Ga0068861_101772230 Ga0068861_1017722301 96
166 3300005840 Ga0068870_10066682 Ga0068870_100666822 96
167 3300005841 Ga0068863_100076993 Ga0068863_1000769932 96
168 3300005841 Ga0068863_100400310 Ga0068863_1004003102 96
169 3300005842 Ga0068858_100080197 Ga0068858_1000801972 96
170 3300005842 Ga0068858_101286174 Ga0068858_1012861742 96
171 3300005843 Ga0068860_100685615 Ga0068860_1006856152 96
172 3300005843 Ga0068860_100756488 Ga0068860_1007564882 96
173 3300005843 Ga0068860_100862405 Ga0068860_1008624052 96
174 3300005843 Ga0068860_101360423 Ga0068860_1013604232 96
175 3300005843 Ga0068860_101531584 Ga0068860_1015315842 96
176 3300005844 Ga0068862_101424342 Ga0068862_1014243422 96
177 3300005981 Ga0081538_10026610 Ga0081538_100266102 96
178 3300006163 Ga0070715_10229749 Ga0070715_102297492 96
179 3300006173 Ga0070716_101537939 Ga0070716_1015379392 96
180 3300006175 Ga0070712_100135387 Ga0070712_1001353872 96
181 3300006237 Ga0097621_100574481 Ga0097621_1005744811 96
182 3300006237 Ga0097621_101172255 Ga0097621_1011722552 96
183 3300006844 Ga0075428_100540701 Ga0075428_1005407012 96
184 3300006844 Ga0075428_102000718 Ga0075428_1020007182 96
185 3300006844 Ga0075428_102172427 Ga0075428_1021724272 96
186 3300006846 Ga0075430_100014773 Ga0075430_1000147733 96
187 3300006846 Ga0075430_100282639 Ga0075430_1002826392 96
188 3300006846 Ga0075430_100584295 Ga0075430_1005842952 96
189 3300006847 Ga0075431_100589047 Ga0075431_1005890472 96
190 3300006847 Ga0075431_101106014 Ga0075431_1011060142 96
191 3300006852 Ga0075433_10019313 Ga0075433_100193132 96
192 3300006852 Ga0075433_10142207 Ga0075433_101422072 96
193 3300006852 Ga0075433_11323646 Ga0075433_113236462 96
194 3300006871 Ga0075434_100197634 Ga0075434_1001976342 96
195 3300006871 Ga0075434_100402723 Ga0075434_1004027232 96
196 3300006871 Ga0075434_100747493 Ga0075434_1007474932 96
197 3300006880 Ga0075429_100063000 Ga0075429_1000630003 96
198 3300006881 Ga0068865_100922293 Ga0068865_1009222932 96
199 3300006881 Ga0068865_101695285 Ga0068865_1016952851 96
200 3300006931 Ga0097620_100076241 Ga0097620_1000762412 96
201 3300006931 Ga0097620_102380800 Ga0097620_1023808001 96
202 3300007076 Ga0075435_100513852 Ga0075435_1005138522 96
203 3300007076 Ga0075435_101166192 Ga0075435_1011661922 96
204 3300009093 Ga0105240_10032020 Ga0105240_100320205 96
205 3300009094 Ga0111539_10245983 Ga0111539_102459832 96
206 3300009094 Ga0111539_10332026 Ga0111539_103320262 96
207 3300009094 Ga0111539_10702318 Ga0111539_107023182 96
208 3300009098 Ga0105245_11937848 Ga0105245_119378482 96
209 3300009101 Ga0105247_10148183 Ga0105247_101481831 96
210 3300009147 Ga0114129_10209150 Ga0114129_102091503 96
211 3300009147 Ga0114129_10499446 Ga0114129_104994462 96
212 3300009147 Ga0114129_10817652 Ga0114129_108176522 96
213 3300009147 Ga0114129_11081202 Ga0114129_110812022 96
214 3300009147 Ga0114129_11351122 Ga0114129_113511222 96
215 3300009147 Ga0114129_12621611 Ga0114129_126216111 96
216 3300009148 Ga0105243_10034312 Ga0105243_100343122 96
217 3300009148 Ga0105243_10769122 Ga0105243_107691222 96
218 3300009174 Ga0105241_10006643 Ga0105241_100066438 96
219 3300009176 Ga0105242_10012015 Ga0105242_100120152 96
220 3300009176 Ga0105242_10566914 Ga0105242_105669142 96
221 3300009177 Ga0105248_10047348 Ga0105248_100473484 96
222 3300009177 Ga0105248_11911070 Ga0105248_119110702 96
223 3300009551 Ga0105238_10844137 Ga0105238_108441372 96
224 3300009553 Ga0105249_10058065 Ga0105249_100580654 96
225 3300009553 Ga0105249_10248890 Ga0105249_102488902 96
226 3300010375 Ga0105239_10023083 Ga0105239_100230835 96
227 3300010375 Ga0105239_13221016 Ga0105239_132210161 96
228 3300011119 Ga0105246_10089636 Ga0105246_100896361 96
229 3300011119 Ga0105246_10254083 Ga0105246_102540832 96
230 3300013102 Ga0157371_10021369 Ga0157371_100213693 96
231 3300013102 Ga0157371_11055541 Ga0157371_110555412 96
232 3300013297 Ga0157378_10075301 Ga0157378_100753012 96
233 3300013306 Ga0163162_11390379 Ga0163162_113903792 96
234 3300013306 Ga0163162_11902536 Ga0163162_119025362 96
235 3300013308 Ga0157375_10379332 Ga0157375_103793322 96
236 3300013308 Ga0157375_10617099 Ga0157375_106170992 96
237 3300014325 Ga0163163_10041997 Ga0163163_100419975 96
238 3300014325 Ga0163163_11051267 Ga0163163_110512672 96
239 3300014325 Ga0163163_12931526 Ga0163163_129315262 96
240 3300014326 Ga0157380_10496428 Ga0157380_104964282 96
241 3300014326 Ga0157380_11228549 Ga0157380_112285492 96
242 3300014497 Ga0182008_10544871 Ga0182008_105448711 96
243 3300014745 Ga0157377_11560736 Ga0157377_115607361 96
244 3300014968 Ga0157379_10077664 Ga0157379_100776642 96
245 3300014968 Ga0157379_10126392 Ga0157379_101263922 96
246 3300014968 Ga0157379_10450366 Ga0157379_104503662 96
247 3300014968 Ga0157379_11613073 Ga0157379_116130732 96
248 3300014969 Ga0157376_10694168 Ga0157376_106941682 96
249 3300017792 Ga0163161_10110208 Ga0163161_101102082 96
250 3300017792 Ga0163161_11493349 Ga0163161_114933491 96
251 3300025885 Ga0207653_10052792 Ga0207653_100527922 96
252 3300025893 Ga0207682_10158218 Ga0207682_101582182 96
253 3300025899 Ga0207642_10001600 Ga0207642_100016002 96
254 3300025901 Ga0207688_10542386 Ga0207688_105423862 96
255 3300025903 Ga0207680_10051914 Ga0207680_100519142 96
256 3300025905 Ga0207685_10029835 Ga0207685_100298352 96
257 3300025908 Ga0207643_10018495 Ga0207643_100184952 96
258 3300025910 Ga0207684_10209514 Ga0207684_102095142 96
259 3300025910 Ga0207684_10278157 Ga0207684_102781572 96
260 3300025910 Ga0207684_10486627 Ga0207684_104866272 96
261 3300025910 Ga0207684_10644146 Ga0207684_106441462 96
262 3300025911 Ga0207654_10022254 Ga0207654_100222541 96
263 3300025913 Ga0207695_10078707 Ga0207695_100787072 96
264 3300025915 Ga0207693_10116841 Ga0207693_101168412 96
265 3300025915 Ga0207693_10518527 Ga0207693_105185272 96
266 3300025916 Ga0207663_10096574 Ga0207663_100965742 96
267 3300025916 Ga0207663_10224832 Ga0207663_102248321 96
268 3300025917 Ga0207660_10065876 Ga0207660_100658762 96
269 3300025917 Ga0207660_10316595 Ga0207660_103165952 96
270 3300025917 Ga0207660_10458276 Ga0207660_104582762 96
271 3300025917 Ga0207660_11384837 Ga0207660_113848371 96
272 3300025919 Ga0207657_10192867 Ga0207657_101928672 96
273 3300025921 Ga0207652_10621990 Ga0207652_106219902 96
274 3300025922 Ga0207646_10027898 Ga0207646_100278985 96
275 3300025922 Ga0207646_11333605 Ga0207646_113336052 96
276 3300025922 Ga0207646_11829112 Ga0207646_118291122 96
277 3300025923 Ga0207681_10058353 Ga0207681_100583533 96
278 3300025923 Ga0207681_10483711 Ga0207681_104837112 96
279 3300025928 Ga0207700_10702151 Ga0207700_107021512 96
280 3300025931 Ga0207644_10269770 Ga0207644_102697702 96
281 3300025933 Ga0207706_10095957 Ga0207706_100959572 96
282 3300025935 Ga0207709_10010091 Ga0207709_100100913 96
283 3300025937 Ga0207669_11051127 Ga0207669_110511272 96
284 3300025938 Ga0207704_10047633 Ga0207704_100476333 96
285 3300025938 Ga0207704_10348203 Ga0207704_103482032 96
286 3300025938 Ga0207704_10460666 Ga0207704_104606662 96
287 3300025940 Ga0207691_10120126 Ga0207691_101201262 96
288 3300025941 Ga0207711_10014398 Ga0207711_100143983 96
289 3300025944 Ga0207661_10229177 Ga0207661_102291772 96
290 3300025945 Ga0207679_10897599 Ga0207679_108975992 96
291 3300025945 Ga0207679_11706128 Ga0207679_117061282 96
292 3300025960 Ga0207651_10130991 Ga0207651_101309911 96
293 3300025961 Ga0207712_10036673 Ga0207712_100366732 96
294 3300025961 Ga0207712_10150022 Ga0207712_101500222 96
295 3300025972 Ga0207668_10067824 Ga0207668_100678241 96
296 3300025981 Ga0207640_10003546 Ga0207640_100035465 96
297 3300025981 Ga0207640_10771645 Ga0207640_107716452 96
298 3300025986 Ga0207658_10459638 Ga0207658_104596381 96
299 3300025986 Ga0207658_10461392 Ga0207658_104613922 96
300 3300026023 Ga0207677_10414698 Ga0207677_104146982 96
301 3300026035 Ga0207703_10700002 Ga0207703_107000022 96
302 3300026035 Ga0207703_11508492 Ga0207703_115084921 96
303 3300026041 Ga0207639_10141825 Ga0207639_101418252 96
304 3300026041 Ga0207639_11719577 Ga0207639_117195772 96
305 3300026067 Ga0207678_10885472 Ga0207678_108854721 96
306 3300026067 Ga0207678_11690597 Ga0207678_116905972 96
307 3300026067 Ga0207678_11805379 Ga0207678_118053791 96
308 3300026075 Ga0207708_10050542 Ga0207708_100505422 96
309 3300026075 Ga0207708_10145613 Ga0207708_101456132 96
310 3300026075 Ga0207708_10659312 Ga0207708_106593122 96
311 3300026078 Ga0207702_10963890 Ga0207702_109638902 96
312 3300026088 Ga0207641_10014994 Ga0207641_100149944 96
313 3300026088 Ga0207641_10366685 Ga0207641_103666852 96
314 3300026089 Ga0207648_11750673 Ga0207648_117506732 96
315 3300026095 Ga0207676_10088565 Ga0207676_100885653 96
316 3300026095 Ga0207676_11021755 Ga0207676_110217551 96
317 3300026095 Ga0207676_11579351 Ga0207676_115793512 96
318 3300026116 Ga0207674_10037131 Ga0207674_100371312 96
319 3300026116 Ga0207674_10874572 Ga0207674_108745721 96
320 3300026118 Ga0207675_100022222 Ga0207675_1000222222 96
321 3300026118 Ga0207675_100793598 Ga0207675_1007935982 96
322 3300026118 Ga0207675_101018263 Ga0207675_1010182632 96
323 3300026118 Ga0207675_101504994 Ga0207675_1015049942 96
324 3300026121 Ga0207683_10693967 Ga0207683_106939672 96
325 3300026142 Ga0207698_10553202 Ga0207698_105532022 96
326 3300027717 Ga0209998_10069499 Ga0209998_100694992 96
327 3300027907 Ga0207428_10156595 Ga0207428_101565952 96
328 3300027907 Ga0207428_10176884 Ga0207428_101768842 96
329 3300028380 Ga0268265_10498898 Ga0268265_104988982 96
330 3300028380 Ga0268265_11309278 Ga0268265_113092782 96
331 3300028380 Ga0268265_11407957 Ga0268265_114079572 96
332 3300028381 Ga0268264_10313772 Ga0268264_103137722 96
333 3300031548 Ga0307408_100005949 Ga0307408_1000059495 96
334 3300031548 Ga0307408_100026791 Ga0307408_1000267913 96
335 3300031548 Ga0307408_100031731 Ga0307408_1000317312 96
336 3300031548 Ga0307408_100368456 Ga0307408_1003684562 96
337 3300031548 Ga0307408_100906506 Ga0307408_1009065062 96
338 3300031731 Ga0307405_10095960 Ga0307405_100959602 96
339 3300031731 Ga0307405_10250186 Ga0307405_102501862 96
340 3300031731 Ga0307405_10629985 Ga0307405_106299852 96
341 3300031824 Ga0307413_10013116 Ga0307413_100131164 96
342 3300031824 Ga0307413_10028104 Ga0307413_100281042 96
343 3300031824 Ga0307413_10028238 Ga0307413_100282382 96
344 3300031824 Ga0307413_10030957 Ga0307413_100309572 96
345 3300031824 Ga0307413_10045105 Ga0307413_100451053 96
346 3300031824 Ga0307413_10078817 Ga0307413_100788172 96
347 3300031824 Ga0307413_10849126 Ga0307413_108491262 96
348 3300031824 Ga0307413_10988661 Ga0307413_109886612 96
349 3300031852 Ga0307410_10002568 Ga0307410_100025689 96
350 3300031852 Ga0307410_10003332 Ga0307410_100033326 96
351 3300031852 Ga0307410_10006262 Ga0307410_100062623 96
352 3300031852 Ga0307410_10018020 Ga0307410_100180202 96
353 3300031852 Ga0307410_10032819 Ga0307410_100328194 96
354 3300031852 Ga0307410_10065406 Ga0307410_100654063 96
355 3300031852 Ga0307410_10075903 Ga0307410_100759032 96
356 3300031852 Ga0307410_10088549 Ga0307410_100885492 96
357 3300031852 Ga0307410_10125921 Ga0307410_101259212 96
358 3300031852 Ga0307410_10383126 Ga0307410_103831262 96
359 3300031852 Ga0307410_11069671 Ga0307410_110696711 96
360 3300031852 Ga0307410_11634905 Ga0307410_116349052 96
361 3300031852 Ga0307410_11701440 Ga0307410_117014402 96
362 3300031901 Ga0307406_10022221 Ga0307406_100222213 96
363 3300031901 Ga0307406_10027530 Ga0307406_100275302 96
364 3300031901 Ga0307406_10027577 Ga0307406_100275772 96
365 3300031901 Ga0307406_10056263 Ga0307406_100562632 96
366 3300031901 Ga0307406_10085881 Ga0307406_100858812 96
367 3300031903 Ga0307407_10047860 Ga0307407_100478602 96
368 3300031903 Ga0307407_10081642 Ga0307407_100816423 96
369 3300031903 Ga0307407_10342271 Ga0307407_103422712 96
370 3300031903 Ga0307407_10495924 Ga0307407_104959242 96
371 3300031903 Ga0307407_10582447 Ga0307407_105824471 96
372 3300031903 Ga0307407_10933014 Ga0307407_109330142 96
373 3300031903 Ga0307407_11278308 Ga0307407_112783081 96
374 3300031911 Ga0307412_10033086 Ga0307412_100330862 96
375 3300031911 Ga0307412_10045066 Ga0307412_100450662 96
376 3300031911 Ga0307412_10316143 Ga0307412_103161431 96
377 3300031911 Ga0307412_11974227 Ga0307412_119742272 96
378 3300031995 Ga0307409_100000665 Ga0307409_1000006657 96
379 3300031995 Ga0307409_100010974 Ga0307409_1000109742 96
380 3300031995 Ga0307409_100052697 Ga0307409_1000526974 96
381 3300031995 Ga0307409_100066895 Ga0307409_1000668952 96
382 3300031995 Ga0307409_100139059 Ga0307409_1001390592 96
383 3300031995 Ga0307409_100320000 Ga0307409_1003200002 96
384 3300031995 Ga0307409_100564770 Ga0307409_1005647702 96
385 3300031995 Ga0307409_101110484 Ga0307409_1011104842 96
386 3300032002 Ga0307416_100000169 Ga0307416_10000016919 96
387 3300032002 Ga0307416_100000867 Ga0307416_10000086715 96
388 3300032002 Ga0307416_100058032 Ga0307416_1000580323 96
389 3300032002 Ga0307416_100067890 Ga0307416_1000678904 96
390 3300032002 Ga0307416_100076556 Ga0307416_1000765563 96
391 3300032002 Ga0307416_100104769 Ga0307416_1001047693 96
392 3300032002 Ga0307416_100109195 Ga0307416_1001091951 96
393 3300032002 Ga0307416_100209651 Ga0307416_1002096512 96
394 3300032002 Ga0307416_100339171 Ga0307416_1003391712 96
395 3300032002 Ga0307416_100554186 Ga0307416_1005541862 96
396 3300032002 Ga0307416_100854964 Ga0307416_1008549642 96
397 3300032002 Ga0307416_101097655 Ga0307416_1010976551 96
398 3300032002 Ga0307416_102889113 Ga0307416_1028891132 96
399 3300032002 Ga0307416_103794208 Ga0307416_1037942081 96
400 3300032004 Ga0307414_10002833 Ga0307414_100028338 96
401 3300032004 Ga0307414_10010252 Ga0307414_100102523 96
402 3300032004 Ga0307414_10029303 Ga0307414_100293033 96
403 3300032004 Ga0307414_10413798 Ga0307414_104137981 96
404 3300032004 Ga0307414_10419233 Ga0307414_104192332 96
405 3300032004 Ga0307414_10562222 Ga0307414_105622221 96
406 3300032005 Ga0307411_10004089 Ga0307411_100040896 96
407 3300032005 Ga0307411_10008563 Ga0307411_100085632 96
408 3300032005 Ga0307411_10009847 Ga0307411_100098472 96
409 3300032005 Ga0307411_10010011 Ga0307411_100100114 96
410 3300032005 Ga0307411_10023128 Ga0307411_100231282 96
411 3300032005 Ga0307411_10036137 Ga0307411_100361372 96
412 3300032005 Ga0307411_10136237 Ga0307411_101362372 96
413 3300032005 Ga0307411_10188055 Ga0307411_101880552 96
414 3300032005 Ga0307411_10208933 Ga0307411_102089332 96
415 3300032005 Ga0307411_10663709 Ga0307411_106637092 96
416 3300032126 Ga0307415_100001210 Ga0307415_1000012104 96
417 3300032126 Ga0307415_100020805 Ga0307415_1000208053 96
418 3300032126 Ga0307415_100041964 Ga0307415_1000419641 96
419 3300032126 Ga0307415_100046942 Ga0307415_1000469422 96
420 3300032126 Ga0307415_100054076 Ga0307415_1000540762 96
421 3300032126 Ga0307415_100077313 Ga0307415_1000773132 96
422 3300032126 Ga0307415_100226066 Ga0307415_1002260662 96
423 3300032126 Ga0307415_100606459 Ga0307415_1006064592 96
424 3300032126 Ga0307415_101232589 Ga0307415_1012325892 96
425 3300032126 Ga0307415_102541477 Ga0307415_1025414772 96
426 3300035085 Ga0373929_0079919 Ga0373929_0079919_192_482 96
427 3300035085 Ga0373929_0126946 Ga0373929_0126946_230_520 96
428 3300035088 Ga0373940_0044441 Ga0373940_0044441_251_541 96
429 3300035088 Ga0373940_0173131 Ga0373940_0173131_270_560 96
430 3300035088 Ga0373940_0199266 Ga0373940_0199266_227_517 96
431 3300035090 Ga0373949_0226281 Ga0373949_0226281_134_424 96
432 3300035090 Ga0373949_0286940 Ga0373949_0286940_32_322 96
433 3300035091 Ga0373951_0018130 Ga0373951_0018130_1044_1334 96
434 3300035112 Ga0373932_0387810 Ga0373932_0387810_111_401 96
435 3300035114 Ga0373939_0080402 Ga0373939_0080402_428_736 96
436 3300035114 Ga0373939_0154586 Ga0373939_0154586_226_516 96
437 3300035115 Ga0373941_0058249 Ga0373941_0058249_174_464 96
438 3300035115 Ga0373941_0319340 Ga0373941_0319340_237_527 96
439 3300035121 Ga0373960_0061604 Ga0373960_0061604_812_1102 96
440 3300035121 Ga0373960_0091538 Ga0373960_0091538_383_673 96
441 3300035207 Ga0373942_0023024 Ga0373942_0023024_327_617 96
442 3300035241 Ga0373961_0427118 Ga0373961_0427118_179_487 96
443 3300035242 Ga0373962_0070139 Ga0373962_0070139_247_537 96
444 3300035242 Ga0373962_0138127 Ga0373962_0138127_48_338 96
445 3300035691 Ga0373931_0054141 Ga0373931_0054141_525_815 96
446 3300035691 Ga0373931_0116197 Ga0373931_0116197_1097_1387 96
447 3300035691 Ga0373931_0558948 Ga0373931_0558948_424_714 96
448 3300035691 Ga0373931_0576431 Ga0373931_0576431_326_616 96
449 3300037471 Ga0395905_0478378 Ga0395905_0478378_235_525 96
450 3300037471 Ga0395905_0539105 Ga0395905_0539105_443_733 96
451 3300037471 Ga0395905_1845704 Ga0395905_1845704_57_347 96
452 3300038443 Ga0395901_0387432 Ga0395901_0387432_438_728 96
453 3300038443 Ga0395901_0992798 Ga0395901_0992798_476_766 96
454 3300038698 Ga0242419_009502 Ga0242419_009502_350_640 96
455 3300038996 Ga0242420_004009 Ga0242420_004009_1470_1760 96
456 3300038996 Ga0242420_066752 Ga0242420_066752_236_544 96
457 3300038996 Ga0242420_080861 Ga0242420_080861_80_370 96
458 3300042001 Ga0439441_066403 Ga0439441_066403_388_678 96
459 3300042435 Ga0439434_0091527 Ga0439434_0091527_306_596 96
460 3300042436 Ga0439435_0035267 Ga0439435_0035267_987_1277 96
461 3300042438 Ga0439459_0058676 Ga0439459_0058676_209_499 96
462 3300042876 Ga0451577_0018318 Ga0451577_0018318_195_485 96
463 3300042876 Ga0451577_0291948 Ga0451577_0291948_616_906 96
464 3300044673 Ga0453683_0253843 Ga0453683_0253843_641_931 96
465 3300044673 Ga0453683_1201478 Ga0453683_1201478_136_426 96
466 3300044712 Ga0453684_0221947 Ga0453684_0221947_1673_1963 96
467 3300044712 Ga0453684_1105708 Ga0453684_1105708_196_486 96
468 3300045051 Ga0451576_1757787 Ga0451576_1757787_191_481 96
469 3300045976 Ga0466967_1029796 Ga0466967_1029796_349_639 96
470 3300046455 Ga0495603_0008621 Ga0495603_0008621_3821_4111 96
471 3300046475 Ga0495639_0242234 Ga0495639_0242234_268_558 96
472 3300046558 Ga0495633_0183904 Ga0495633_0183904_294_584 96
473 3300046615 Ga0495656_0739499 Ga0495656_0739499_47_337 96
474 3300046664 Ga0495659_0080321 Ga0495659_0080321_869_1159 96
475 3300046691 Ga0495670_0044607 Ga0495670_0044607_664_954 96
476 3300047318 Ga0495636_0013911 Ga0495636_0013911_510_800 96
477 3300048903 Ga0496100_0175105 Ga0496100_0175105_108_398 96
478 3300048904 Ga0496101_0045795 Ga0496101_0045795_1718_2008 96
479 3300048904 Ga0496101_0233359 Ga0496101_0233359_716_1006 96
480 3300048904 Ga0496101_1105086 Ga0496101_1105086_131_421 96
481 3300048905 Ga0496102_0129883 Ga0496102_0129883_83_373 96
482 3300048905 Ga0496102_0180956 Ga0496102_0180956_1138_1428 96
483 3300048905 Ga0496102_0309306 Ga0496102_0309306_1098_1388 96
484 3300048905 Ga0496102_0389966 Ga0496102_0389966_391_681 96
485 3300048905 Ga0496102_0679341 Ga0496102_0679341_322_612 96
486 3300048905 Ga0496102_1952564 Ga0496102_1952564_159_449 96
487 3300048906 Ga0496103_0036580 Ga0496103_0036580_547_837 96
488 3300048906 Ga0496103_0180793 Ga0496103_0180793_661_951 96
489 3300048906 Ga0496103_0299815 Ga0496103_0299815_681_971 96
490 3300048907 Ga0496104_0099730 Ga0496104_0099730_1203_1493 96
491 3300048907 Ga0496104_0203729 Ga0496104_0203729_378_668 96
492 3300048907 Ga0496104_0618949 Ga0496104_0618949_630_938 96
493 3300048908 Ga0496105_0218864 Ga0496105_0218864_375_665 96
494 3300048908 Ga0496105_0642879 Ga0496105_0642879_184_474 96
495 3300048909 Ga0496106_0023979 Ga0496106_0023979_2469_2759 96
496 3300048909 Ga0496106_0025578 Ga0496106_0025578_2321_2611 96
497 3300048909 Ga0496106_0050308 Ga0496106_0050308_2806_3096 96
498 3300048909 Ga0496106_0423328 Ga0496106_0423328_511_801 96
499 3300048909 Ga0496106_0810616 Ga0496106_0810616_430_720 96
500 3300048910 Ga0496107_0162551 Ga0496107_0162551_18_308 96
501 3300048910 Ga0496107_0191963 Ga0496107_0191963_783_1073 96
502 3300048911 Ga0496108_0007531 Ga0496108_0007531_1462_1752 96
503 3300048911 Ga0496108_0020371 Ga0496108_0020371_4220_4510 96
504 3300048911 Ga0496108_0030609 Ga0496108_0030609_3011_3319 96
505 3300048912 Ga0496109_0001213 Ga0496109_0001213_19457_19747 96
506 3300048912 Ga0496109_0007276 Ga0496109_0007276_1347_1655 96
507 3300048912 Ga0496109_0110285 Ga0496109_0110285_770_1060 96
508 3300048912 Ga0496109_0344247 Ga0496109_0344247_255_545 96
509 3300048912 Ga0496109_1074714 Ga0496109_1074714_164_454 96
510 3300048913 Ga0496110_0008231 Ga0496110_0008231_1839_2129 96
511 3300048913 Ga0496110_0086073 Ga0496110_0086073_1885_2175 96
512 3300048913 Ga0496110_0142950 Ga0496110_0142950_1667_1975 96
513 3300048913 Ga0496110_0264039 Ga0496110_0264039_665_955 96
514 3300048914 Ga0496111_0008696 Ga0496111_0008696_3449_3739 96
515 3300048915 Ga0496112_0007045 Ga0496112_0007045_4369_4659 96
516 3300048915 Ga0496112_0025715 Ga0496112_0025715_5272_5562 96
517 3300048915 Ga0496112_0027925 Ga0496112_0027925_2503_2811 96
518 3300048915 Ga0496112_0119722 Ga0496112_0119722_680_970 96
519 3300048916 Ga0496113_0004956 Ga0496113_0004956_7314_7604 96
520 3300048916 Ga0496113_0016734 Ga0496113_0016734_336_626 96
521 3300048916 Ga0496113_0214674 Ga0496113_0214674_596_904 96
522 3300048917 Ga0496114_0071341 Ga0496114_0071341_1133_1423 96
523 3300049522 Ga0501299_018040 Ga0501299_018040_899_1189 96
524 3300049568 Ga0501031_0084686 Ga0501031_0084686_797_1087 96
525 3300049570 Ga0501033_0126833 Ga0501033_0126833_486_776 96
526 3300049572 Ga0501036_0204346 Ga0501036_0204346_1214_1504 96
527 3300049572 Ga0501036_0394311 Ga0501036_0394311_321_611 96
528 3300049573 Ga0501037_0180745 Ga0501037_0180745_487_777 96
529 3300049573 Ga0501037_0548433 Ga0501037_0548433_367_657 96
530 3300049574 Ga0501038_0123961 Ga0501038_0123961_103_393 96
531 3300049574 Ga0501038_0200000 Ga0501038_0200000_1175_1465 96
532 3300049574 Ga0501038_0590989 Ga0501038_0590989_17_307 96
533 3300049574 Ga0501038_0679909 Ga0501038_0679909_423_713 96
534 3300049575 Ga0501039_0074687 Ga0501039_0074687_1780_2070 96
535 3300049576 Ga0501040_0099029 Ga0501040_0099029_583_873 96
536 3300049576 Ga0501040_0202093 Ga0501040_0202093_975_1265 96
537 3300049576 Ga0501040_0632261 Ga0501040_0632261_228_518 96
538 3300049576 Ga0501040_1057784 Ga0501040_1057784_200_490 96
539 3300049577 Ga0501041_0045136 Ga0501041_0045136_1362_1652 96
540 3300049577 Ga0501041_0584123 Ga0501041_0584123_305_595 96
541 3300049578 Ga0501042_0232881 Ga0501042_0232881_516_806 96
542 3300049579 Ga0501043_0264848 Ga0501043_0264848_975_1265 96
543 3300049580 Ga0501046_0123993 Ga0501046_0123993_983_1273 96
544 3300049580 Ga0501046_0151832 Ga0501046_0151832_272_562 96
545 3300049580 Ga0501046_0306742 Ga0501046_0306742_558_848 96
546 3300049580 Ga0501046_1041884 Ga0501046_1041884_188_478 96
547 3300049583 Ga0501067_0027880 Ga0501067_0027880_1849_2139 96
548 3300049583 Ga0501067_0081415 Ga0501067_0081415_1440_1730 96
549 3300049583 Ga0501067_0128229 Ga0501067_0128229_698_994 96
550 3300049583 Ga0501067_0326390 Ga0501067_0326390_134_424 96
551 3300049584 Ga0501068_0071844 Ga0501068_0071844_678_968 96
552 3300049584 Ga0501068_0680197 Ga0501068_0680197_214_504 96
553 3300049585 Ga0501069_0045087 Ga0501069_0045087_942_1232 96
554 3300049585 Ga0501069_0132235 Ga0501069_0132235_20_310 96
555 3300049585 Ga0501069_0271244 Ga0501069_0271244_579_869 96
556 3300049586 Ga0501070_0145673 Ga0501070_0145673_754_1044 96
557 3300049587 Ga0501071_0033094 Ga0501071_0033094_1562_1852 96
558 3300049588 Ga0501072_0096123 Ga0501072_0096123_761_1051 96
559 3300049590 Ga0501074_0037332 Ga0501074_0037332_3214_3504 96
560 3300049590 Ga0501074_0503850 Ga0501074_0503850_207_497 96
561 3300049591 Ga0501075_0015555 Ga0501075_0015555_3573_3863 96
562 3300049591 Ga0501075_0360363 Ga0501075_0360363_84_374 96
563 3300049591 Ga0501075_0882133 Ga0501075_0882133_179_469 96
564 3300049591 Ga0501075_0995661 Ga0501075_0995661_293_583 96
565 3300049592 Ga0501076_0075407 Ga0501076_0075407_1917_2207 96
566 3300049592 Ga0501076_0173234 Ga0501076_0173234_990_1280 96
567 3300049592 Ga0501076_0214594 Ga0501076_0214594_511_801 96
568 3300049592 Ga0501076_0306918 Ga0501076_0306918_539_829 96
569 3300049593 Ga0501077_0001177 Ga0501077_0001177_15280_15570 96
570 3300049593 Ga0501077_0043784 Ga0501077_0043784_1855_2145 96
571 3300049593 Ga0501077_0051951 Ga0501077_0051951_587_877 96
572 3300049593 Ga0501077_0359910 Ga0501077_0359910_260_550 96
573 3300049593 Ga0501077_0718566 Ga0501077_0718566_336_626 96
574 3300049650 Ga0501199_005575 Ga0501199_005575_98_388 96
575 3300049656 Ga0501209_033028 Ga0501209_033028_468_758 96
576 3300049656 Ga0501209_035671 Ga0501209_035671_356_646 96
577 3300049656 Ga0501209_057390 Ga0501209_057390_754_1044 96
578 3300049656 Ga0501209_142989 Ga0501209_142989_145_435 96
579 3300049658 Ga0501211_025768 Ga0501211_025768_207_506 96
580 3300049660 Ga0501216_027457 Ga0501216_027457_292_582 96
581 3300049661 Ga0501217_015539 Ga0501217_015539_478_768 96
582 3300049668 Ga0501233_018413 Ga0501233_018413_460_750 96
583 3300049668 Ga0501233_023535 Ga0501233_023535_922_1212 96
584 3300049675 Ga0501243_030647 Ga0501243_030647_589_879 96
585 3300049677 Ga0501247_024646 Ga0501247_024646_459_749 96
586 3300049679 Ga0501249_016756 Ga0501249_016756_335_625 96
587 3300049679 Ga0501249_046991 Ga0501249_046991_593_883 96
588 3300049679 Ga0501249_091688 Ga0501249_091688_22_312 96
589 3300049679 Ga0501249_099465 Ga0501249_099465_133_423 96
590 3300049681 Ga0501251_014722 Ga0501251_014722_507_797 96
591 3300049683 Ga0501253_106327 Ga0501253_106327_306_596 96
592 3300049686 Ga0501257_096248 Ga0501257_096248_95_385 96
593 3300049687 Ga0501258_001408 Ga0501258_001408_27_317 96
594 3300049704 Ga0501221_010769 Ga0501221_010769_164_454 96
595 3300049705 Ga0501225_0028841 Ga0501225_0028841_207_497 96
596 3300049741 Ga0501079_0069364 Ga0501079_0069364_1437_1727 96
597 3300049741 Ga0501079_0148048 Ga0501079_0148048_245_535 96
598 3300049741 Ga0501079_0165543 Ga0501079_0165543_882_1172 96
599 3300049741 Ga0501079_0201756 Ga0501079_0201756_804_1094 96
600 3300049741 Ga0501079_0451523 Ga0501079_0451523_18_308 96
601 3300049742 Ga0501080_0147413 Ga0501080_0147413_673_963 96
602 3300049742 Ga0501080_0481241 Ga0501080_0481241_55_345 96
603 3300049742 Ga0501080_0760252 Ga0501080_0760252_497_787 96
604 3300049743 Ga0501081_0123029 Ga0501081_0123029_186_476 96
605 3300049743 Ga0501081_0169682 Ga0501081_0169682_1051_1341 96
606 3300049743 Ga0501081_0235482 Ga0501081_0235482_702_992 96
607 3300049743 Ga0501081_0235671 Ga0501081_0235671_559_849 96
608 3300049744 Ga0501083_0126016 Ga0501083_0126016_207_497 96
609 3300049744 Ga0501083_0897602 Ga0501083_0897602_36_326 96
610 3300049761 Ga0501264_020928 Ga0501264_020928_259_549 96
611 3300049763 Ga0501266_029634 Ga0501266_029634_259_549 96
612 3300049764 Ga0501267_005648 Ga0501267_005648_456_746 96
613 3300049767 Ga0501270_025212 Ga0501270_025212_570_860 96
614 3300049770 Ga0501273_009919 Ga0501273_009919_534_824 96
615 3300049773 Ga0501276_035464 Ga0501276_035464_143_433 96
616 3300049779 Ga0501283_006872 Ga0501283_006872_242_532 96
617 3300049779 Ga0501283_024292 Ga0501283_024292_599_889 96
618 3300049822 Ga0501035_0229845 Ga0501035_0229845_392_682 96
619 3300049822 Ga0501035_1318551 Ga0501035_1318551_209_499 96
620 3300049824 Ga0501045_0056535 Ga0501045_0056535_383_673 96
621 3300049824 Ga0501045_0120708 Ga0501045_0120708_1640_1930 96
622 3300049824 Ga0501045_0252193 Ga0501045_0252193_824_1114 96
623 3300049824 Ga0501045_0716859 Ga0501045_0716859_30_320 96
624 3300049850 Ga0501204_009290 Ga0501204_009290_249_539 96
625 3300049851 Ga0501212_029659 Ga0501212_029659_76_366 96
626 3300050507 nmdc:mga05p37_148079_c1 nmdc:mga05p37_148079_c1_280_570 96
627 3300050507 nmdc:mga05p37_1933540_c1 nmdc:mga05p37_1933540_c1_183_473 96
628 3300050507 nmdc:mga05p37_291525_c1 nmdc:mga05p37_291525_c1_132_422 96
629 3300050507 nmdc:mga05p37_694322_c1 nmdc:mga05p37_694322_c1_408_698 96
630 3300050507 nmdc:mga05p37_715376_c1 nmdc:mga05p37_715376_c1_225_515 96
631 3300050507 nmdc:mga05p37_934377_c1 nmdc:mga05p37_934377_c1_210_500 96
632 3300050508 nmdc:mga09592_568948_c1 nmdc:mga09592_568948_c1_25_315 96
633 3300050508 nmdc:mga09592_59953_c1 nmdc:mga09592_59953_c1_1713_2012 96
634 3300050509 nmdc:mga0qj67_278760_c1 nmdc:mga0qj67_278760_c1_1042_1332 96
635 3300050509 nmdc:mga0qj67_7368_c1 nmdc:mga0qj67_7368_c1_3718_4008 96
636 3300050510 nmdc:mga06r32_1218704_c1 nmdc:mga06r32_1218704_c1_93_383 96
637 3300050510 nmdc:mga06r32_342801_c1 nmdc:mga06r32_342801_c1_804_1094 96
638 3300050510 nmdc:mga06r32_511208_c1 nmdc:mga06r32_511208_c1_666_956 96
639 3300050510 nmdc:mga06r32_864959_c1 nmdc:mga06r32_864959_c1_359_658 96
640 3300050511 nmdc:mga08y16_281292_c1 nmdc:mga08y16_281292_c1_1402_1692 96
641 3300050511 nmdc:mga08y16_415585_c1 nmdc:mga08y16_415585_c1_832_1122 96
642 3300050511 nmdc:mga08y16_621829_c1 nmdc:mga08y16_621829_c1_519_809 96
643 3300050512 nmdc:mga0n895_1319348_c1 nmdc:mga0n895_1319348_c1_366_656 96
644 3300050512 nmdc:mga0n895_295528_c1 nmdc:mga0n895_295528_c1_867_1166 96
645 3300050512 nmdc:mga0n895_569961_c1 nmdc:mga0n895_569961_c1_632_922 96
646 3300050513 nmdc:mga0rr50_643794_c1 nmdc:mga0rr50_643794_c1_552_842 96
647 3300050513 nmdc:mga0rr50_934934_c1 nmdc:mga0rr50_934934_c1_13_303 96
648 3300050515 nmdc:mga0a205_40614_c1 nmdc:mga0a205_40614_c1_864_1163 96
649 3300050515 nmdc:mga0a205_85608_c1 nmdc:mga0a205_85608_c1_495_785 96
650 3300054114 Ga0501084_0006598 Ga0501084_0006598_1187_1477 96
651 3300054114 Ga0501084_0320495 Ga0501084_0320495_496_786 96
652 3300054114 Ga0501084_0559492 Ga0501084_0559492_538_828 96
653 3300059421 Ga0590071_001573 Ga0590071_001573_4261_4551 96
654 3300059421 Ga0590071_002778 Ga0590071_002778_920_1210 96
655 3300059421 Ga0590071_012194 Ga0590071_012194_1106_1396 96
656 3300059421 Ga0590071_039033 Ga0590071_039033_626_916 96
657 3300059421 Ga0590071_066097 Ga0590071_066097_223_513 96
658 3300059423 Ga0590074_028681 Ga0590074_028681_230_520 96
659 3300059424 Ga0590075_024941 Ga0590075_024941_446_736 96
660 3300059424 Ga0590075_037947 Ga0590075_037947_683_973 96
661 3300059426 Ga0590077_050286 Ga0590077_050286_478_768 96
662 3300059426 Ga0590077_083583 Ga0590077_083583_344_634 96
663 3300059490 Ga0587066_056959 Ga0587066_056959_65_355 96
664 3300060353 Ga0501082_0064431 Ga0501082_0064431_1205_1495 96
665 3300060353 Ga0501082_1011507 Ga0501082_1011507_224_514 96
666 3300060353 Ga0501082_1443506 Ga0501082_1443506_137_427 96
667 3300060353 Ga0501082_1785689 Ga0501082_1785689_130_420 96
668 3300061734 Ga0530510_0200281 Ga0530510_0200281_724_1014 96
669 3300061734 Ga0530510_0394416 Ga0530510_0394416_587_877 96
670 3300061734 Ga0530510_0417474 Ga0530510_0417474_593_883 96
671 3300061734 Ga0530510_0598932 Ga0530510_0598932_101_391 96
672 3300061734 Ga0530510_0882050 Ga0530510_0882050_270_560 96
673 3300061734 Ga0530510_1245687 Ga0530510_1245687_256_546 96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f6q-assembly1.cif.gz_A crystal structure of metallothiol transferase from bacillus anthracis str. ames 0.832 16 52
5cj3-assembly1.cif.gz_B crystal structure of the zorbamycin binding protein (zbma) from streptomyces flavoviridis with zorbamycin 0.8152 15 52
2zfd-assembly1.cif.gz_B the crystal structure of plant specific calcium binding protein atcbl2 in complex with the regulatory domain of atcipk14 0.7834 2 83
4iag-assembly1.cif.gz_A-2 crystal structure of zbma, the zorbamycin binding protein from streptomyces flavoviridis 0.774 18 52
3tdh-assembly1.cif.gz_A structure of the regulatory fragment of sccharomyces cerevisiae ampk in complex with amp 0.7417 5 81
ID Description Score Start End Superfamily
af_B9EW50_2_100_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.8376 1 65 3.30.310.80
af_I1L7C7_308_422_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.8294 2 82 3.30.310.80
af_O22932_303_426_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.8062 2 81 3.30.310.80
af_A0A1D6F284_331_456_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.7999 2 82 3.30.310.80
af_A0A0R0IJS9_306_438_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.7912 2 86 3.30.310.80
ID Description Score Start End GO Terms
AF-A0A838QJF3-F1-model_v4 Uncharacterized protein 0.9814 1 96
AF-A0A2H6A4H8-F1-model_v4 Uncharacterized protein 0.9636 1 96
AF-A0A2V7PU17-F1-model_v4 Uncharacterized protein 0.946 15 96
AF-A0A1G0M0E6-F1-model_v4 Uncharacterized protein 0.9371 1 96
AF-A0A1G0M0E6-F1-model_v4 Uncharacterized protein 0.9279 1 96

Feature Viewer

pLDDT pTM Quality
93.84 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map