F474341

General Info

Members Datasets Scaffolds Average Seq Length
674 205 1348 206

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10035127|JGI24740J21852_100351272
Length 205
Sequence MVRGLLAFAAGLALSAPLNAGALTVRVVDSAGKPVRDAVVTLYPSTGARAPKSGGRYVVSQQNLQFHPFLTIVPVGADVSFPNLDNTKHHVYSFSAAKRFELKLFAKDQSRTVHFDKPGVVALGCNIHDQMSAFIVVTDSTWTGRTNAQGLVAFDPPNSPARLTVWHPYLRAPGGLMQESIAAGQHIASFSIRLRPPPPTMPMDY

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
143 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
144 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
187 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.15
Rhizosphere 95.4
Stem 0
Stem Tuber 0
Unclassified 14.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10035127 3300001979 Unclassified 1571
2 JGI24740J21852_10002142 3300001979 Bacteria 9023
3 JGI24739J22299_10007827 3300001989 Bacteria 4000
4 JGI24737J22298_10003735 3300001990 Bacteria 5358
5 JGI24737J22298_10005971 3300001990 Bacteria 4182
6 JGI24737J22298_10012136 3300001990 Bacteria 2812
7 JGI24738J21930_10003524 3300002075 Bacteria 3939
8 JGI24744J21845_10000142 3300002077 Bacteria 10247
9 JGI24742J22300_10013075 3300002244 Unclassified 1388
10 rootH2_10125871 3300003320 Bacteria 1347
11 rootH1_10047180 3300003323 Bacteria 1638
12 Ga0070658_10000220 3300005327 Bacteria 50700
13 Ga0070658_10058356 3300005327 Bacteria 3141
14 Ga0070658_10388100 3300005327 Unclassified 1198
15 Ga0070683_100003373 3300005329 Bacteria 12941
16 Ga0070683_100026563 3300005329 Bacteria 5215
17 Ga0070683_100382398 3300005329 Bacteria 1341
18 Ga0070670_100029707 3300005331 Bacteria 4707
19 Ga0070670_100112564 3300005331 Bacteria 2346
20 Ga0070670_100440699 3300005331 Unclassified 1153
21 Ga0070670_100472322 3300005331 Unclassified 1113
22 Ga0070670_100628868 3300005331 Bacteria 962
23 Ga0070677_10019752 3300005333 Bacteria 2445
24 Ga0070677_10032232 3300005333 Bacteria 2009
25 Ga0068869_100018291 3300005334 Bacteria 4768
26 Ga0070666_10001142 3300005335 Bacteria 16157
27 Ga0070666_10046850 3300005335 Bacteria 2901
28 Ga0070666_10202503 3300005335 Bacteria 1397
29 Ga0070680_100002838 3300005336 Bacteria 12874
30 Ga0070680_100045108 3300005336 Bacteria 3583
31 Ga0070680_100457422 3300005336 Bacteria 1090
32 Ga0070682_100039547 3300005337 Bacteria 2898
33 Ga0070682_100221167 3300005337 Unclassified 1348
34 Ga0068868_100045946 3300005338 Bacteria 3418
35 Ga0068868_100187884 3300005338 Unclassified 1717
36 Ga0068868_100372760 3300005338 Bacteria 1227
37 Ga0070660_100000218 3300005339 Bacteria 37921
38 Ga0070660_100004849 3300005339 Bacteria 9291
39 Ga0070660_100022814 3300005339 Bacteria 4634
40 Ga0070660_100065325 3300005339 Bacteria 2831
41 Ga0070660_100077798 3300005339 Bacteria 2600
42 Ga0070660_100129489 3300005339 Bacteria 2018
43 Ga0070660_100168289 3300005339 Bacteria 1769
44 Ga0070660_100248565 3300005339 Unclassified 1450
45 Ga0070660_100270061 3300005339 Bacteria 1390
46 Ga0070691_10007027 3300005341 Bacteria 5159
47 Ga0070691_10322638 3300005341 Bacteria 850
48 Ga0070661_100000181 3300005344 Bacteria 52052
49 Ga0070661_100014908 3300005344 Bacteria 5481
50 Ga0070661_100015490 3300005344 Bacteria 5380
51 Ga0070661_100052683 3300005344 Bacteria 2978
52 Ga0070661_100091779 3300005344 Bacteria 2249
53 Ga0070661_100309315 3300005344 Bacteria 1232
54 Ga0070661_100354056 3300005344 Unclassified 1152
55 Ga0070661_100389221 3300005344 Bacteria 1100
56 Ga0070692_10025958 3300005345 Bacteria 2892
57 Ga0070668_100485017 3300005347 Bacteria 1068
58 Ga0070669_100180194 3300005353 Unclassified 1652
59 Ga0070675_100257574 3300005354 Bacteria 1528
60 Ga0070671_100002350 3300005355 Bacteria 14596
61 Ga0070671_100007089 3300005355 Bacteria 8970
62 Ga0070671_100016329 3300005355 Bacteria 6003
63 Ga0070671_100082129 3300005355 Bacteria 2694
64 Ga0070674_100003417 3300005356 Bacteria 8907
65 Ga0070674_100047957 3300005356 Bacteria 2930
66 Ga0070674_100054061 3300005356 Bacteria 2776
67 Ga0070674_100142704 3300005356 Bacteria 1799
68 Ga0070673_100057159 3300005364 Unclassified 3082
69 Ga0070673_100116181 3300005364 Bacteria 2225
70 Ga0070673_100206926 3300005364 Unclassified 1692
71 Ga0070673_100281467 3300005364 Bacteria 1459
72 Ga0070659_100000310 3300005366 Bacteria 37921
73 Ga0070659_100000992 3300005366 Bacteria 20821
74 Ga0070659_100078072 3300005366 Bacteria 2641
75 Ga0070659_100083423 3300005366 Bacteria 2554
76 Ga0070659_100103934 3300005366 Unclassified 2288
77 Ga0070659_100179319 3300005366 Unclassified 1738
78 Ga0070659_100188340 3300005366 Bacteria 1695
79 Ga0070667_100028182 3300005367 Bacteria 4675
80 Ga0070667_100034286 3300005367 Bacteria 4246
81 Ga0070667_100055671 3300005367 Bacteria 3340
82 Ga0070667_100187298 3300005367 Bacteria 1832
83 Ga0070667_100198231 3300005367 Unclassified 1781
84 Ga0070667_100312811 3300005367 Bacteria 1416
85 Ga0070667_100366319 3300005367 Bacteria 1307
86 Ga0070714_100026810 3300005435 Bacteria 4765
87 Ga0070714_100082578 3300005435 Bacteria 2800
88 Ga0070713_100004043 3300005436 Bacteria 9770
89 Ga0070713_100224110 3300005436 Unclassified 1707
90 Ga0070713_100640372 3300005436 Bacteria 1012
91 Ga0070663_100005572 3300005455 Bacteria 7496
92 Ga0070663_100075207 3300005455 Bacteria 2468
93 Ga0070663_100157345 3300005455 Bacteria 1747
94 Ga0070663_100352742 3300005455 Bacteria 1191
95 Ga0070663_100484152 3300005455 Bacteria 1025
96 Ga0070663_100904413 3300005455 Bacteria 762
97 Ga0070678_100007482 3300005456 Bacteria 6483
98 Ga0070678_100057349 3300005456 Bacteria 2853
99 Ga0070678_100680518 3300005456 Bacteria 925
100 Ga0070678_100807783 3300005456 Unclassified 852
101 Ga0070662_100000080 3300005457 Bacteria 53280
102 Ga0070662_100014583 3300005457 Bacteria 5253
103 Ga0070662_100033688 3300005457 Bacteria 3608
104 Ga0070662_100053969 3300005457 Bacteria 2911
105 Ga0070662_100078973 3300005457 Bacteria 2446
106 Ga0070662_100082561 3300005457 Bacteria 2397
107 Ga0070662_100208234 3300005457 Bacteria 1555
108 Ga0070681_10539949 3300005458 Bacteria 1079
109 Ga0070681_10766473 3300005458 Bacteria 881
110 Ga0068867_100115979 3300005459 Bacteria 2063
111 Ga0070679_100150160 3300005530 Bacteria 2307
112 Ga0070679_100265736 3300005530 Unclassified 1670
113 Ga0070679_100497329 3300005530 Bacteria 1163
114 Ga0070679_100499963 3300005530 Unclassified 1160
115 Ga0070679_100573709 3300005530 Bacteria 1072
116 Ga0070679_100775727 3300005530 Bacteria 902
117 Ga0070679_100917454 3300005530 Bacteria 819
118 Ga0070684_100001026 3300005535 Bacteria 19914
119 Ga0070684_100004556 3300005535 Bacteria 10560
120 Ga0070684_100007195 3300005535 Bacteria 8646
121 Ga0070684_100010648 3300005535 Bacteria 7293
122 Ga0070684_100245954 3300005535 Bacteria 1634
123 Ga0068853_100000134 3300005539 Bacteria 50184
124 Ga0068853_100081958 3300005539 Bacteria 2825
125 Ga0068853_100112457 3300005539 Bacteria 2420
126 Ga0068853_100386652 3300005539 Unclassified 1307
127 Ga0068853_100874739 3300005539 Bacteria 862
128 Ga0070672_100056056 3300005543 Bacteria 3089
129 Ga0070672_100242001 3300005543 Bacteria 1518
130 Ga0070672_100273059 3300005543 Bacteria 1428
131 Ga0070672_100423882 3300005543 Unclassified 1143
132 Ga0070693_100016218 3300005547 Bacteria 3852
133 Ga0070693_100028818 3300005547 Bacteria 3022
134 Ga0070693_100049202 3300005547 Bacteria 2404
135 Ga0070693_100090121 3300005547 Bacteria 1847
136 Ga0070665_100003354 3300005548 Bacteria 17135
137 Ga0070665_100016180 3300005548 Bacteria 7484
138 Ga0070665_100937875 3300005548 Unclassified 878
139 Ga0068855_100002690 3300005563 Bacteria 21916
140 Ga0068855_100194602 3300005563 Unclassified 2285
141 Ga0068855_100198964 3300005563 Bacteria 2257
142 Ga0068855_100202207 3300005563 Bacteria 2236
143 Ga0068855_100294208 3300005563 Unclassified 1799
144 Ga0068855_100760128 3300005563 Bacteria 1033
145 Ga0068855_100846135 3300005563 Bacteria 970
146 Ga0070664_100000961 3300005564 Bacteria 22520
147 Ga0070664_100001303 3300005564 Bacteria 19939
148 Ga0070664_100004154 3300005564 Bacteria 11633
149 Ga0070664_100010774 3300005564 Bacteria 7413
150 Ga0070664_100026022 3300005564 Bacteria 4851
151 Ga0070664_100062463 3300005564 Bacteria 3175
152 Ga0070664_100073184 3300005564 Unclassified 2939
153 Ga0070664_100087062 3300005564 Bacteria 2700
154 Ga0070664_100101809 3300005564 Bacteria 2498
155 Ga0070664_100113597 3300005564 Bacteria 2365
156 Ga0070664_100524192 3300005564 Bacteria 1094
157 Ga0068857_100011560 3300005577 Bacteria 7680
158 Ga0068857_100023595 3300005577 Bacteria 5416
159 Ga0068857_100032307 3300005577 Bacteria 4628
160 Ga0068854_100031373 3300005578 Bacteria 3692
161 Ga0068854_100093495 3300005578 Bacteria 2241
162 Ga0068854_100117564 3300005578 Bacteria 2013
163 Ga0068854_100140945 3300005578 Unclassified 1850
164 Ga0068854_100341170 3300005578 Bacteria 1223
165 Ga0068854_100402213 3300005578 Bacteria 1133
166 Ga0068856_100001082 3300005614 Bacteria 28757
167 Ga0068856_100021054 3300005614 Bacteria 6338
168 Ga0068856_100360305 3300005614 Bacteria 1473
169 Ga0068856_100491959 3300005614 Bacteria 1247
170 Ga0068856_100516985 3300005614 Unclassified 1215
171 Ga0070702_100176043 3300005615 Bacteria 1396
172 Ga0068852_100004509 3300005616 Bacteria 9849
173 Ga0068852_100019403 3300005616 Bacteria 5380
174 Ga0068852_100030020 3300005616 Bacteria 4470
175 Ga0068852_100129618 3300005616 Bacteria 2321
176 Ga0068852_100292754 3300005616 Bacteria 1573
177 Ga0068852_100321540 3300005616 Unclassified 1503
178 Ga0068852_100340872 3300005616 Bacteria 1461
179 Ga0068859_100038199 3300005617 Bacteria 4817
180 Ga0068859_100055519 3300005617 Bacteria 3986
181 Ga0068864_100007190 3300005618 Bacteria 9145
182 Ga0068864_100008233 3300005618 Bacteria 8600
183 Ga0068864_100426842 3300005618 Bacteria 1264
184 Ga0068864_100583995 3300005618 Bacteria 1083
185 Ga0068866_10028604 3300005718 Bacteria 2657
186 Ga0068851_10021014 3300005834 Bacteria 3166
187 Ga0068851_10025812 3300005834 Bacteria 2884
188 Ga0068851_10175672 3300005834 Bacteria 1184
189 Ga0068863_100024815 3300005841 Bacteria 5718
190 Ga0068863_100025508 3300005841 Bacteria 5636
191 Ga0068858_100010659 3300005842 Bacteria 8695
192 Ga0068858_100048231 3300005842 Bacteria 3947
193 Ga0068858_100079799 3300005842 Bacteria 3040
194 Ga0068858_100578828 3300005842 Unclassified 1088
195 Ga0068860_100039934 3300005843 Bacteria 4487
196 Ga0068860_100498808 3300005843 Unclassified 1215
197 Ga0070717_10090051 3300006028 Bacteria 2588
198 Ga0070716_100056252 3300006173 Bacteria 2255
199 Ga0070712_100025292 3300006175 Bacteria 3945
200 Ga0097621_100014753 3300006237 Bacteria 5857
201 Ga0097621_100046322 3300006237 Unclassified 3518
202 Ga0097621_100144234 3300006237 Unclassified 2037
203 Ga0097621_100146957 3300006237 Unclassified 2019
204 Ga0097621_100502548 3300006237 Bacteria 1098
205 Ga0068871_100006328 3300006358 Bacteria 8368
206 Ga0068871_100184128 3300006358 Unclassified 1796
207 Ga0068871_100236536 3300006358 Bacteria 1587
208 Ga0068871_100327643 3300006358 Unclassified 1350
209 Ga0068865_100071602 3300006881 Bacteria 2460
210 Ga0097620_100038199 3300006931 Bacteria 4817
211 Ga0097620_100055517 3300006931 Bacteria 3986
212 Ga0105240_10071401 3300009093 Bacteria 4294
213 Ga0105245_10511837 3300009098 Unclassified 1218
214 Ga0105241_10072782 3300009174 Bacteria 2672
215 Ga0105241_10098645 3300009174 Bacteria 2318
216 Ga0105248_10000276 3300009177 Bacteria 60451
217 Ga0105248_10008738 3300009177 Bacteria 11126
218 Ga0105248_10015579 3300009177 Bacteria 8381
219 Ga0105248_10349843 3300009177 Bacteria 1664
220 Ga0105248_10362713 3300009177 Bacteria 1631
221 Ga0105248_10710449 3300009177 Bacteria 1134
222 Ga0105237_10426402 3300009545 Unclassified 1332
223 Ga0105237_10495411 3300009545 Unclassified 1228
224 Ga0105238_10006724 3300009551 Bacteria 11478
225 Ga0105238_10060545 3300009551 Bacteria 3790
226 Ga0105239_10864809 3300010375 Bacteria 1037
227 Ga0105239_11022152 3300010375 Unclassified 950
228 Ga0157373_10012858 3300013100 Bacteria 6146
229 Ga0157373_10065805 3300013100 Bacteria 2565
230 Ga0157373_10108036 3300013100 Bacteria 1956
231 Ga0157373_10371801 3300013100 Bacteria 1022
232 Ga0157371_10002431 3300013102 Bacteria 17754
233 Ga0157371_10011285 3300013102 Bacteria 6898
234 Ga0157371_10074826 3300013102 Bacteria 2398
235 Ga0157371_10147749 3300013102 Bacteria 1676
236 Ga0157371_10232515 3300013102 Bacteria 1325
237 Ga0157371_10527646 3300013102 Unclassified 874
238 Ga0157370_10010842 3300013104 Bacteria 9572
239 Ga0157370_10033722 3300013104 Bacteria 4990
240 Ga0157370_10051075 3300013104 Bacteria 3950
241 Ga0157370_10131358 3300013104 Unclassified 2336
242 Ga0157369_10016239 3300013105 Bacteria 8379
243 Ga0157369_10057404 3300013105 Unclassified 4200
244 Ga0157369_10168351 3300013105 Bacteria 2310
245 Ga0157369_10199325 3300013105 Unclassified 2101
246 Ga0157369_10360406 3300013105 Bacteria 1510
247 Ga0157369_10611153 3300013105 Unclassified 1125
248 Ga0157369_11062661 3300013105 Bacteria 828
249 Ga0157374_10040314 3300013296 Bacteria 4300
250 Ga0157374_10300329 3300013296 Bacteria 1588
251 Ga0157378_10042918 3300013297 Bacteria 4015
252 Ga0157378_10230675 3300013297 Unclassified 1764
253 Ga0157378_10288150 3300013297 Bacteria 1585
254 Ga0157378_10957817 3300013297 Bacteria 889
255 Ga0163162_10047096 3300013306 Bacteria 4322
256 Ga0157372_10021480 3300013307 Bacteria 6974
257 Ga0157372_10095364 3300013307 Bacteria 3390
258 Ga0157372_10358807 3300013307 Bacteria 1698
259 Ga0157372_10487679 3300013307 Unclassified 1437
260 Ga0157372_10490163 3300013307 Bacteria 1433
261 Ga0157372_10951265 3300013307 Unclassified 996
262 Ga0157372_11247876 3300013307 Bacteria 858
263 Ga0157375_10498955 3300013308 Unclassified 1381
264 Ga0163163_10000799 3300014325 Bacteria 26696
265 Ga0163163_10210861 3300014325 Bacteria 1992
266 Ga0182008_10237801 3300014497 Bacteria 936
267 Ga0157379_10031246 3300014968 Bacteria 4744
268 Ga0157379_10123357 3300014968 Bacteria 2331
269 Ga0206356_11342232 3300020070 Unclassified 689
270 Ga0206353_10607450 3300020082 Bacteria 2041
271 Ga0207697_10022692 3300025315 Bacteria 2570
272 Ga0207697_10085268 3300025315 Unclassified 1334
273 Ga0207656_10001598 3300025321 Bacteria 7535
274 Ga0207656_10003347 3300025321 Bacteria 5497
275 Ga0207682_10003134 3300025893 Bacteria 7244
276 Ga0207682_10059489 3300025893 Bacteria 1596
277 Ga0207642_10077824 3300025899 Unclassified 1601
278 Ga0207688_10040937 3300025901 Bacteria 2576
279 Ga0207688_10299588 3300025901 Bacteria 983
280 Ga0207680_10001282 3300025903 Bacteria 11894
281 Ga0207680_10012874 3300025903 Bacteria 4275
282 Ga0207680_10158491 3300025903 Bacteria 1515
283 Ga0207680_10267484 3300025903 Bacteria 1185
284 Ga0207680_10654782 3300025903 Bacteria 752
285 Ga0207680_10710426 3300025903 Bacteria 720
286 Ga0207647_10003773 3300025904 Bacteria 11329
287 Ga0207647_10082861 3300025904 Bacteria 1921
288 Ga0207647_10086811 3300025904 Bacteria 1870
289 Ga0207699_10319516 3300025906 Bacteria 1089
290 Ga0207645_10068556 3300025907 Bacteria 2269
291 Ga0207643_10053646 3300025908 Bacteria 2290
292 Ga0207705_10000164 3300025909 Bacteria 71606
293 Ga0207705_10005666 3300025909 Bacteria 9323
294 Ga0207705_10023528 3300025909 Bacteria 4394
295 Ga0207705_10027026 3300025909 Bacteria 4090
296 Ga0207705_10027985 3300025909 Bacteria 4018
297 Ga0207705_10256622 3300025909 Unclassified 1334
298 Ga0207705_10305013 3300025909 Bacteria 1222
299 Ga0207705_10440333 3300025909 Bacteria 1010
300 Ga0207705_10681712 3300025909 Bacteria 799
301 Ga0207654_10091830 3300025911 Unclassified 1852
302 Ga0207654_10150421 3300025911 Bacteria 1494
303 Ga0207707_10142012 3300025912 Bacteria 2099
304 Ga0207707_10221864 3300025912 Bacteria 1645
305 Ga0207707_10480624 3300025912 Unclassified 1061
306 Ga0207695_10078982 3300025913 Bacteria 3337
307 Ga0207671_10116700 3300025914 Bacteria 2036
308 Ga0207693_10086383 3300025915 Unclassified 2458
309 Ga0207660_10013348 3300025917 Bacteria 5383
310 Ga0207660_10183715 3300025917 Bacteria 1625
311 Ga0207657_10000090 3300025919 Bacteria 86852
312 Ga0207657_10005658 3300025919 Bacteria 13043
313 Ga0207657_10010838 3300025919 Bacteria 9070
314 Ga0207657_10015081 3300025919 Bacteria 7505
315 Ga0207657_10015209 3300025919 Bacteria 7465
316 Ga0207657_10093955 3300025919 Bacteria 2497
317 Ga0207657_10100421 3300025919 Bacteria 2402
318 Ga0207657_10141119 3300025919 Bacteria 1968
319 Ga0207657_10150061 3300025919 Bacteria 1899
320 Ga0207657_10165371 3300025919 Bacteria 1795
321 Ga0207657_10198165 3300025919 Bacteria 1617
322 Ga0207657_10299594 3300025919 Bacteria 1274
323 Ga0207649_10000324 3300025920 Bacteria 36296
324 Ga0207649_10006680 3300025920 Bacteria 6269
325 Ga0207649_10019228 3300025920 Bacteria 3901
326 Ga0207649_10026965 3300025920 Bacteria 3367
327 Ga0207649_10070496 3300025920 Bacteria 2229
328 Ga0207649_10085523 3300025920 Bacteria 2052
329 Ga0207649_10128440 3300025920 Bacteria 1718
330 Ga0207649_10293521 3300025920 Bacteria 1186
331 Ga0207649_10323105 3300025920 Unclassified 1134
332 Ga0207649_10724502 3300025920 Unclassified 772
333 Ga0207652_10073767 3300025921 Bacteria 2970
334 Ga0207652_10088090 3300025921 Bacteria 2723
335 Ga0207652_10384340 3300025921 Unclassified 1267
336 Ga0207694_10077935 3300025924 Bacteria 2597
337 Ga0207650_10008672 3300025925 Bacteria 6947
338 Ga0207650_10021503 3300025925 Bacteria 4559
339 Ga0207650_10091071 3300025925 Bacteria 2330
340 Ga0207650_10277986 3300025925 Bacteria 1362
341 Ga0207650_10725784 3300025925 Bacteria 840
342 Ga0207659_10087615 3300025926 Bacteria 2318
343 Ga0207687_10063754 3300025927 Bacteria 2610
344 Ga0207700_10046983 3300025928 Bacteria 3197
345 Ga0207664_10094725 3300025929 Bacteria 2455
346 Ga0207664_10137160 3300025929 Unclassified 2065
347 Ga0207644_10012582 3300025931 Bacteria 5625
348 Ga0207644_10014159 3300025931 Bacteria 5334
349 Ga0207644_10031124 3300025931 Bacteria 3716
350 Ga0207644_10039392 3300025931 Bacteria 3335
351 Ga0207644_10051702 3300025931 Bacteria 2950
352 Ga0207644_10509452 3300025931 Bacteria 993
353 Ga0207690_10000184 3300025932 Bacteria 48035
354 Ga0207690_10001341 3300025932 Bacteria 15473
355 Ga0207690_10017580 3300025932 Bacteria 4370
356 Ga0207690_10021476 3300025932 Bacteria 4004
357 Ga0207690_10035058 3300025932 Bacteria 3237
358 Ga0207690_10037098 3300025932 Bacteria 3162
359 Ga0207690_10087541 3300025932 Bacteria 2192
360 Ga0207690_10096382 3300025932 Bacteria 2103
361 Ga0207690_10108373 3300025932 Bacteria 1996
362 Ga0207690_10386835 3300025932 Unclassified 1113
363 Ga0207706_10000110 3300025933 Bacteria 87522
364 Ga0207706_10004468 3300025933 Bacteria 13134
365 Ga0207706_10016228 3300025933 Bacteria 6730
366 Ga0207706_10018829 3300025933 Bacteria 6209
367 Ga0207706_10021424 3300025933 Bacteria 5805
368 Ga0207706_10028135 3300025933 Bacteria 5022
369 Ga0207706_10038125 3300025933 Bacteria 4263
370 Ga0207706_10039480 3300025933 Bacteria 4185
371 Ga0207706_10047857 3300025933 Bacteria 3783
372 Ga0207706_10093693 3300025933 Bacteria 2641
373 Ga0207669_10033115 3300025937 Bacteria 2912
374 Ga0207669_10044873 3300025937 Unclassified 2601
375 Ga0207669_10129793 3300025937 Bacteria 1729
376 Ga0207704_10118542 3300025938 Bacteria 1805
377 Ga0207665_10125061 3300025939 Bacteria 1820
378 Ga0207691_10058090 3300025940 Bacteria 3519
379 Ga0207691_10141699 3300025940 Bacteria 2118
380 Ga0207691_10355148 3300025940 Bacteria 1254
381 Ga0207691_10494322 3300025940 Unclassified 1039
382 Ga0207711_10000586 3300025941 Bacteria 36944
383 Ga0207711_10014767 3300025941 Bacteria 6490
384 Ga0207711_10103717 3300025941 Bacteria 2518
385 Ga0207711_10194007 3300025941 Bacteria 1852
386 Ga0207711_10234846 3300025941 Bacteria 1680
387 Ga0207689_10101992 3300025942 Bacteria 2357
388 Ga0207661_10000179 3300025944 Bacteria 40861
389 Ga0207661_10015420 3300025944 Bacteria 5622
390 Ga0207661_10353232 3300025944 Bacteria 1327
391 Ga0207661_10629507 3300025944 Unclassified 986
392 Ga0207679_10001192 3300025945 Bacteria 16514
393 Ga0207679_10005199 3300025945 Bacteria 8157
394 Ga0207679_10015204 3300025945 Bacteria 5078
395 Ga0207679_10027237 3300025945 Bacteria 3951
396 Ga0207679_10042441 3300025945 Bacteria 3269
397 Ga0207679_10088891 3300025945 Bacteria 2383
398 Ga0207679_10101838 3300025945 Bacteria 2248
399 Ga0207679_10346609 3300025945 Unclassified 1293
400 Ga0207679_10470610 3300025945 Bacteria 1117
401 Ga0207679_11118636 3300025945 Bacteria 723
402 Ga0207667_10002920 3300025949 Bacteria 21220
403 Ga0207667_10031772 3300025949 Bacteria 5696
404 Ga0207667_10279491 3300025949 Unclassified 1706
405 Ga0207667_10298616 3300025949 Bacteria 1645
406 Ga0207667_10643270 3300025949 Bacteria 1067
407 Ga0207667_11198354 3300025949 Unclassified 739
408 Ga0207651_10044806 3300025960 Bacteria 2963
409 Ga0207651_10247214 3300025960 Bacteria 1457
410 Ga0207651_10604848 3300025960 Bacteria 959
411 Ga0207651_10734093 3300025960 Bacteria 872
412 Ga0207668_10425587 3300025972 Bacteria 1128
413 Ga0207640_10006207 3300025981 Bacteria 6544
414 Ga0207640_10024567 3300025981 Bacteria 3637
415 Ga0207640_10036797 3300025981 Bacteria 3076
416 Ga0207640_10079032 3300025981 Bacteria 2241
417 Ga0207640_10115459 3300025981 Bacteria 1912
418 Ga0207640_10186173 3300025981 Unclassified 1561
419 Ga0207640_10355100 3300025981 Bacteria 1179
420 Ga0207658_10036251 3300025986 Bacteria 3535
421 Ga0207658_10832771 3300025986 Bacteria 839
422 Ga0207677_10072516 3300026023 Bacteria 2434
423 Ga0207677_10272084 3300026023 Bacteria 1386
424 Ga0207677_10299882 3300026023 Bacteria 1327
425 Ga0207677_10305180 3300026023 Unclassified 1316
426 Ga0207703_10290265 3300026035 Bacteria 1488
427 Ga0207639_10000458 3300026041 Bacteria 28145
428 Ga0207639_10004341 3300026041 Bacteria 9559
429 Ga0207639_10017401 3300026041 Bacteria 5096
430 Ga0207639_10032131 3300026041 Bacteria 3862
431 Ga0207639_10245742 3300026041 Bacteria 1558
432 Ga0207639_10822095 3300026041 Bacteria 866
433 Ga0207678_10003179 3300026067 Bacteria 14855
434 Ga0207678_10006368 3300026067 Bacteria 10481
435 Ga0207678_10014156 3300026067 Bacteria 7012
436 Ga0207678_10025025 3300026067 Bacteria 5212
437 Ga0207678_10034857 3300026067 Bacteria 4382
438 Ga0207678_10144106 3300026067 Bacteria 2033
439 Ga0207678_10455989 3300026067 Bacteria 1112
440 Ga0207702_10000391 3300026078 Bacteria 49957
441 Ga0207702_10005629 3300026078 Bacteria 10928
442 Ga0207702_10040278 3300026078 Bacteria 3917
443 Ga0207702_10073046 3300026078 Bacteria 2957
444 Ga0207702_10261940 3300026078 Bacteria 1628
445 Ga0207702_10266742 3300026078 Bacteria 1614
446 Ga0207702_10458475 3300026078 Unclassified 1238
447 Ga0207702_10465235 3300026078 Bacteria 1229
448 Ga0207641_10020301 3300026088 Bacteria 5457
449 Ga0207641_10637896 3300026088 Bacteria 1045
450 Ga0207648_10005798 3300026089 Bacteria 12374
451 Ga0207648_10041645 3300026089 Bacteria 4034
452 Ga0207676_10006116 3300026095 Bacteria 8497
453 Ga0207676_10050226 3300026095 Bacteria 3250
454 Ga0207676_10126890 3300026095 Unclassified 2162
455 Ga0207676_10676280 3300026095 Bacteria 998
456 Ga0207674_10001888 3300026116 Bacteria 26661
457 Ga0207674_10003497 3300026116 Bacteria 19180
458 Ga0207674_10006502 3300026116 Bacteria 13740
459 Ga0207674_10025954 3300026116 Bacteria 6235
460 Ga0207674_10058884 3300026116 Bacteria 3889
461 Ga0207675_100118064 3300026118 Bacteria 2508
462 Ga0207683_10014318 3300026121 Bacteria 6758
463 Ga0207683_10014621 3300026121 Bacteria 6684
464 Ga0207683_10151664 3300026121 Bacteria 2092
465 Ga0207683_10660820 3300026121 Bacteria 968
466 Ga0207698_10000737 3300026142 Bacteria 18984
467 Ga0207698_10009636 3300026142 Bacteria 6167
468 Ga0207698_10014041 3300026142 Bacteria 5308
469 Ga0207698_10028864 3300026142 Bacteria 3963
470 Ga0207698_10075477 3300026142 Bacteria 2694
471 Ga0207698_10235898 3300026142 Bacteria 1664
472 Ga0207698_10284905 3300026142 Bacteria 1530
473 Ga0207698_11225121 3300026142 Bacteria 765
474 Ga0268266_10004144 3300028379 Bacteria 13996
475 Ga0268266_10088729 3300028379 Bacteria 2706
476 Ga0268264_10295635 3300028381 Bacteria 1522
477 Ga0268264_10419979 3300028381 Bacteria 1289
478 Ga0268264_10525037 3300028381 Unclassified 1158
479 Ga0307406_10624944 3300031901 Unclassified 891
480 Ga0373930_0006567 3300034816 Bacteria 1973
481 Ga0373959_0012906 3300034820 Unclassified 1499
482 Ga0373952_0048681 3300035092 Unclassified 1003
483 Ga0373932_0009953 3300035112 Unclassified 2294
484 Ga0373941_0166536 3300035115 Bacteria 819
485 Ga0373954_0027683 3300035118 Bacteria 2603
486 Ga0373943_0001773 3300035170 Bacteria 9770
487 Ga0373943_0287383 3300035170 Unclassified 931
488 Ga0373946_0030036 3300035171 Bacteria 2167
489 Ga0373955_0000958 3300035172 Bacteria 12298
490 Ga0373961_0051316 3300035241 Unclassified 1224
491 Ga0373924_0100991 3300035410 Bacteria 1241
492 Ga0373931_0059549 3300035691 Bacteria 2054
493 Ga0373935_0323241 3300035692 Unclassified 1095
494 Ga0373927_0045523 3300035695 Bacteria 2838
495 Ga0373947_0072174 3300035725 Bacteria 2119
496 Ga0373937_0081860 3300036401 Unclassified 2986
497 Ga0373925_0009900 3300037068 Bacteria 6926
498 Ga0395899_0008522 3300037312 Bacteria 7896
499 Ga0395899_0014826 3300037312 Bacteria 5949
500 Ga0395899_0034166 3300037312 Bacteria 3817
501 Ga0395899_0038454 3300037312 Bacteria 3584
502 Ga0395899_0076254 3300037312 Bacteria 2448
503 Ga0395899_0082608 3300037312 Unclassified 2336
504 Ga0395899_0089155 3300037312 Bacteria 2237
505 Ga0395899_0090487 3300037312 Bacteria 2218
506 Ga0395899_0100939 3300037312 Bacteria 2083
507 Ga0395899_0268337 3300037312 Unclassified 1165
508 Ga0395899_0304906 3300037312 Unclassified 1077
509 Ga0395899_0437977 3300037312 Unclassified 858
510 Ga0395900_0000336 3300037418 Bacteria 69212
511 Ga0395900_0005450 3300037418 Bacteria 13332
512 Ga0395900_0005557 3300037418 Bacteria 13198
513 Ga0395900_0014397 3300037418 Bacteria 8073
514 Ga0395900_0019866 3300037418 Bacteria 6848
515 Ga0395900_0030623 3300037418 Bacteria 5526
516 Ga0395900_0039543 3300037418 Bacteria 4859
517 Ga0395900_0078615 3300037418 Bacteria 3389
518 Ga0395900_0094892 3300037418 Bacteria 3065
519 Ga0395900_0103492 3300037418 Bacteria 2924
520 Ga0395900_0144336 3300037418 Bacteria 2435
521 Ga0395900_0194473 3300037418 Bacteria 2055
522 Ga0395900_0320353 3300037418 Bacteria 1531
523 Ga0395900_0449144 3300037418 Bacteria 1246
524 Ga0395900_0470106 3300037418 Unclassified 1211
525 Ga0395898_0000055 3300037466 Bacteria 278557
526 Ga0395898_0008753 3300037466 Bacteria 10673
527 Ga0395898_0044312 3300037466 Bacteria 4381
528 Ga0395898_0070580 3300037466 Bacteria 3377
529 Ga0395898_0122517 3300037466 Bacteria 2491
530 Ga0395898_0127730 3300037466 Bacteria 2435
531 Ga0395898_0159708 3300037466 Bacteria 2156
532 Ga0395898_0165050 3300037466 Bacteria 2118
533 Ga0395898_0180879 3300037466 Bacteria 2015
534 Ga0395898_0182230 3300037466 Bacteria 2007
535 Ga0395898_0379263 3300037466 Bacteria 1348
536 Ga0395898_0396682 3300037466 Bacteria 1315
537 Ga0395898_0757664 3300037466 Bacteria 912
538 Ga0395898_0923068 3300037466 Unclassified 811
539 Ga0395905_0000067 3300037471 Bacteria 181887
540 Ga0395905_0000204 3300037471 Bacteria 92152
541 Ga0395905_0000215 3300037471 Bacteria 89274
542 Ga0395905_0002584 3300037471 Bacteria 19935
543 Ga0395905_0016729 3300037471 Bacteria 6969
544 Ga0395905_0018044 3300037471 Bacteria 6699
545 Ga0395905_0026726 3300037471 Bacteria 5442
546 Ga0395905_0027580 3300037471 Bacteria 5355
547 Ga0395905_0049957 3300037471 Bacteria 3919
548 Ga0395905_0053320 3300037471 Bacteria 3785
549 Ga0395905_0071808 3300037471 Bacteria 3245
550 Ga0395905_0103389 3300037471 Bacteria 2674
551 Ga0395905_0127248 3300037471 Bacteria 2395
552 Ga0395905_0129700 3300037471 Bacteria 2371
553 Ga0395905_0155106 3300037471 Bacteria 2154
554 Ga0395905_0176393 3300037471 Bacteria 2006
555 Ga0395905_0218932 3300037471 Bacteria 1782
556 Ga0395905_0281062 3300037471 Bacteria 1550
557 Ga0395905_0325349 3300037471 Bacteria 1427
558 Ga0395905_0337202 3300037471 Bacteria 1398
559 Ga0395905_0337556 3300037471 Unclassified 1398
560 Ga0395905_0446992 3300037471 Unclassified 1190
561 Ga0395905_0831325 3300037471 Bacteria 826
562 Ga0395901_0000648 3300038443 Bacteria 40227
563 Ga0395901_0001244 3300038443 Bacteria 27197
564 Ga0395901_0012333 3300038443 Bacteria 8671
565 Ga0395901_0026568 3300038443 Bacteria 5945
566 Ga0395901_0028637 3300038443 Bacteria 5729
567 Ga0395901_0041779 3300038443 Bacteria 4753
568 Ga0395901_0052734 3300038443 Bacteria 4227
569 Ga0395901_0056070 3300038443 Bacteria 4099
570 Ga0395901_0091427 3300038443 Bacteria 3185
571 Ga0395901_0138943 3300038443 Bacteria 2553
572 Ga0395901_0170796 3300038443 Bacteria 2281
573 Ga0395901_0184702 3300038443 Bacteria 2187
574 Ga0395901_0213438 3300038443 Unclassified 2019
575 Ga0395901_0325323 3300038443 Unclassified 1590
576 Ga0395901_0482041 3300038443 Unclassified 1265
577 Ga0395901_1286959 3300038443 Bacteria 693
578 Ga0436363_0830406 3300039450 Bacteria 1986
579 Ga0439448_0010622 3300042005 Bacteria 2733
580 Ga0439448_0134120 3300042005 Bacteria 855
581 Ga0439458_0000200 3300042157 Bacteria 13792
582 Ga0439458_0001085 3300042157 Bacteria 6932
583 Ga0466969_0011279 3300044656 Bacteria 4731
584 Ga0466969_0062339 3300044656 Bacteria 1809
585 Ga0466972_0105873 3300044658 Bacteria 1330
586 Ga0466972_0202275 3300044658 Unclassified 930
587 Ga0466965_0310879 3300044683 Unclassified 857
588 Ga0466966_0009227 3300044684 Bacteria 6533
589 Ga0466966_0016198 3300044684 Bacteria 4929
590 Ga0466966_0018309 3300044684 Bacteria 4620
591 Ga0466966_0169846 3300044684 Bacteria 1325
592 Ga0466961_0098789 3300044693 Bacteria 1840
593 Ga0466961_0103622 3300044693 Unclassified 1791
594 Ga0466963_0012698 3300044694 Bacteria 5158
595 Ga0466963_0015975 3300044694 Bacteria 4660
596 Ga0466963_0107695 3300044694 Bacteria 1911
597 Ga0466963_0152823 3300044694 Bacteria 1603
598 Ga0466964_0015188 3300044706 Bacteria 2931
599 Ga0466971_0026688 3300044719 Bacteria 2583
600 Ga0466971_0106482 3300044719 Bacteria 1292
601 Ga0466970_0010451 3300044765 Bacteria 4714
602 Ga0466970_0029697 3300044765 Bacteria 2880
603 Ga0466957_0002384 3300044842 Bacteria 10096
604 Ga0466957_0053910 3300044842 Bacteria 2453
605 Ga0466957_0099796 3300044842 Unclassified 1829
606 Ga0466957_0257901 3300044842 Bacteria 1161
607 Ga0466959_0022840 3300045049 Bacteria 4624
608 Ga0466959_0092870 3300045049 Bacteria 2166
609 Ga0466959_0212586 3300045049 Bacteria 1343
610 Ga0466958_0075021 3300045836 Bacteria 2074
611 Ga0466958_0124134 3300045836 Bacteria 1618
612 Ga0466958_0157403 3300045836 Bacteria 1434
613 Ga0466967_0000100 3300045976 Bacteria 31122
614 Ga0466967_0107964 3300045976 Bacteria 2553
615 Ga0466967_0175010 3300045976 Unclassified 2022
616 Ga0466967_0187555 3300045976 Bacteria 1953
617 Ga0466967_0197600 3300045976 Bacteria 1903
618 Ga0466967_0344886 3300045976 Bacteria 1441
619 Ga0466967_0406121 3300045976 Bacteria 1326
620 Ga0466967_0498341 3300045976 Bacteria 1195
621 Ga0466967_0602647 3300045976 Bacteria 1084
622 Ga0466967_1012652 3300045976 Bacteria 827
623 Ga0466967_1475162 3300045976 Bacteria 677
624 Ga0495621_0000147 3300046539 Bacteria 15233
625 Ga0495621_0052596 3300046539 Bacteria 1460
626 Ga0495633_0015971 3300046558 Bacteria 3884
627 Ga0495633_0157134 3300046558 Bacteria 1049
628 Ga0495668_0124991 3300046616 Bacteria 1408
629 Ga0495668_0311275 3300046616 Bacteria 863
630 Ga0495623_0022758 3300046679 Bacteria 4046
631 Ga0495669_0000090 3300046684 Bacteria 60222
632 Ga0495669_0004106 3300046684 Bacteria 5991
633 Ga0495669_0037647 3300046684 Bacteria 2141
634 Ga0495669_0040058 3300046684 Bacteria 2076
635 Ga0495669_0043236 3300046684 Unclassified 2005
636 Ga0495669_0091816 3300046684 Unclassified 1402
637 Ga0495669_0263025 3300046684 Bacteria 829
638 Ga0495670_0000192 3300046691 Bacteria 27204
639 Ga0495677_0029848 3300047445 Bacteria 1983
640 Ga0495685_050631 3300047447 Bacteria 1410
641 Ga0495602_0081348 3300048088 Bacteria 2724
642 Ga0496101_0145355 3300048904 Bacteria 1810
643 Ga0496101_0808815 3300048904 Bacteria 739
644 Ga0496102_0103045 3300048905 Bacteria 2654
645 Ga0496102_0492352 3300048905 Bacteria 1148
646 Ga0496103_0006948 3300048906 Bacteria 6759
647 Ga0496103_0031502 3300048906 Bacteria 3231
648 Ga0496104_0241147 3300048907 Bacteria 1720
649 Ga0496104_0569468 3300048907 Bacteria 1043
650 Ga0496106_0680859 3300048909 Unclassified 820
651 Ga0496107_0043761 3300048910 Bacteria 3217
652 Ga0496107_0046986 3300048910 Bacteria 3107
653 Ga0496107_0081451 3300048910 Unclassified 2361
654 Ga0496107_0113504 3300048910 Bacteria 1993
655 Ga0496107_0120454 3300048910 Bacteria 1933
656 Ga0496109_0070267 3300048912 Bacteria 3212
657 Ga0496109_0154409 3300048912 Bacteria 2150
658 Ga0496109_0219793 3300048912 Unclassified 1787
659 Ga0496110_0066008 3300048913 Bacteria 3199
660 Ga0496110_0269296 3300048913 Bacteria 1551
661 Ga0496110_0680667 3300048913 Bacteria 929
662 Ga0496111_0010755 3300048914 Bacteria 6152
663 Ga0496111_0031203 3300048914 Bacteria 3795
664 Ga0496111_0745282 3300048914 Bacteria 711
665 Ga0496112_0017858 3300048915 Bacteria 6677
666 Ga0496112_0169925 3300048915 Bacteria 2146
667 Ga0496112_0669798 3300048915 Bacteria 966
668 Ga0496113_0025885 3300048916 Bacteria 4188
669 Ga0496115_0014491 3300048918 Bacteria 5969
670 Ga0501034_0900281 3300049571 Bacteria 773
671 Ga0501080_0018064 3300049742 Bacteria 6528
672 Ga0495612_0061199 3300053078 Unclassified 1559
673 Ga0495655_0005689 3300053083 Bacteria 2218
674 Ga0466962_0040923 3300061719 Bacteria 2218
675 JGI24740J21852_10035127
676 JGI24740J21852_10002142
677 JGI24739J22299_10007827
678 JGI24737J22298_10003735
679 JGI24737J22298_10005971
680 JGI24737J22298_10012136
681 JGI24738J21930_10003524
682 JGI24744J21845_10000142
683 JGI24742J22300_10013075
684 rootH2_10125871
685 rootH1_10047180
686 Ga0070658_10000220
687 Ga0070658_10058356
688 Ga0070658_10388100
689 Ga0070683_100003373
690 Ga0070683_100026563
691 Ga0070683_100382398
692 Ga0070670_100029707
693 Ga0070670_100112564
694 Ga0070670_100440699
695 Ga0070670_100472322
696 Ga0070670_100628868
697 Ga0070677_10019752
698 Ga0070677_10032232
699 Ga0068869_100018291
700 Ga0070666_10001142
701 Ga0070666_10046850
702 Ga0070666_10202503
703 Ga0070680_100002838
704 Ga0070680_100045108
705 Ga0070680_100457422
706 Ga0070682_100039547
707 Ga0070682_100221167
708 Ga0068868_100045946
709 Ga0068868_100187884
710 Ga0068868_100372760
711 Ga0070660_100000218
712 Ga0070660_100004849
713 Ga0070660_100022814
714 Ga0070660_100065325
715 Ga0070660_100077798
716 Ga0070660_100129489
717 Ga0070660_100168289
718 Ga0070660_100248565
719 Ga0070660_100270061
720 Ga0070691_10007027
721 Ga0070691_10322638
722 Ga0070661_100000181
723 Ga0070661_100014908
724 Ga0070661_100015490
725 Ga0070661_100052683
726 Ga0070661_100091779
727 Ga0070661_100309315
728 Ga0070661_100354056
729 Ga0070661_100389221
730 Ga0070692_10025958
731 Ga0070668_100485017
732 Ga0070669_100180194
733 Ga0070675_100257574
734 Ga0070671_100002350
735 Ga0070671_100007089
736 Ga0070671_100016329
737 Ga0070671_100082129
738 Ga0070674_100003417
739 Ga0070674_100047957
740 Ga0070674_100054061
741 Ga0070674_100142704
742 Ga0070673_100057159
743 Ga0070673_100116181
744 Ga0070673_100206926
745 Ga0070673_100281467
746 Ga0070659_100000310
747 Ga0070659_100000992
748 Ga0070659_100078072
749 Ga0070659_100083423
750 Ga0070659_100103934
751 Ga0070659_100179319
752 Ga0070659_100188340
753 Ga0070667_100028182
754 Ga0070667_100034286
755 Ga0070667_100055671
756 Ga0070667_100187298
757 Ga0070667_100198231
758 Ga0070667_100312811
759 Ga0070667_100366319
760 Ga0070714_100026810
761 Ga0070714_100082578
762 Ga0070713_100004043
763 Ga0070713_100224110
764 Ga0070713_100640372
765 Ga0070663_100005572
766 Ga0070663_100075207
767 Ga0070663_100157345
768 Ga0070663_100352742
769 Ga0070663_100484152
770 Ga0070663_100904413
771 Ga0070678_100007482
772 Ga0070678_100057349
773 Ga0070678_100680518
774 Ga0070678_100807783
775 Ga0070662_100000080
776 Ga0070662_100014583
777 Ga0070662_100033688
778 Ga0070662_100053969
779 Ga0070662_100078973
780 Ga0070662_100082561
781 Ga0070662_100208234
782 Ga0070681_10539949
783 Ga0070681_10766473
784 Ga0068867_100115979
785 Ga0070679_100150160
786 Ga0070679_100265736
787 Ga0070679_100497329
788 Ga0070679_100499963
789 Ga0070679_100573709
790 Ga0070679_100775727
791 Ga0070679_100917454
792 Ga0070684_100001026
793 Ga0070684_100004556
794 Ga0070684_100007195
795 Ga0070684_100010648
796 Ga0070684_100245954
797 Ga0068853_100000134
798 Ga0068853_100081958
799 Ga0068853_100112457
800 Ga0068853_100386652
801 Ga0068853_100874739
802 Ga0070672_100056056
803 Ga0070672_100242001
804 Ga0070672_100273059
805 Ga0070672_100423882
806 Ga0070693_100016218
807 Ga0070693_100028818
808 Ga0070693_100049202
809 Ga0070693_100090121
810 Ga0070665_100003354
811 Ga0070665_100016180
812 Ga0070665_100937875
813 Ga0068855_100002690
814 Ga0068855_100194602
815 Ga0068855_100198964
816 Ga0068855_100202207
817 Ga0068855_100294208
818 Ga0068855_100760128
819 Ga0068855_100846135
820 Ga0070664_100000961
821 Ga0070664_100001303
822 Ga0070664_100004154
823 Ga0070664_100010774
824 Ga0070664_100026022
825 Ga0070664_100062463
826 Ga0070664_100073184
827 Ga0070664_100087062
828 Ga0070664_100101809
829 Ga0070664_100113597
830 Ga0070664_100524192
831 Ga0068857_100011560
832 Ga0068857_100023595
833 Ga0068857_100032307
834 Ga0068854_100031373
835 Ga0068854_100093495
836 Ga0068854_100117564
837 Ga0068854_100140945
838 Ga0068854_100341170
839 Ga0068854_100402213
840 Ga0068856_100001082
841 Ga0068856_100021054
842 Ga0068856_100360305
843 Ga0068856_100491959
844 Ga0068856_100516985
845 Ga0070702_100176043
846 Ga0068852_100004509
847 Ga0068852_100019403
848 Ga0068852_100030020
849 Ga0068852_100129618
850 Ga0068852_100292754
851 Ga0068852_100321540
852 Ga0068852_100340872
853 Ga0068859_100038199
854 Ga0068859_100055519
855 Ga0068864_100007190
856 Ga0068864_100008233
857 Ga0068864_100426842
858 Ga0068864_100583995
859 Ga0068866_10028604
860 Ga0068851_10021014
861 Ga0068851_10025812
862 Ga0068851_10175672
863 Ga0068863_100024815
864 Ga0068863_100025508
865 Ga0068858_100010659
866 Ga0068858_100048231
867 Ga0068858_100079799
868 Ga0068858_100578828
869 Ga0068860_100039934
870 Ga0068860_100498808
871 Ga0070717_10090051
872 Ga0070716_100056252
873 Ga0070712_100025292
874 Ga0097621_100014753
875 Ga0097621_100046322
876 Ga0097621_100144234
877 Ga0097621_100146957
878 Ga0097621_100502548
879 Ga0068871_100006328
880 Ga0068871_100184128
881 Ga0068871_100236536
882 Ga0068871_100327643
883 Ga0068865_100071602
884 Ga0097620_100038199
885 Ga0097620_100055517
886 Ga0105240_10071401
887 Ga0105245_10511837
888 Ga0105241_10072782
889 Ga0105241_10098645
890 Ga0105248_10000276
891 Ga0105248_10008738
892 Ga0105248_10015579
893 Ga0105248_10349843
894 Ga0105248_10362713
895 Ga0105248_10710449
896 Ga0105237_10426402
897 Ga0105237_10495411
898 Ga0105238_10006724
899 Ga0105238_10060545
900 Ga0105239_10864809
901 Ga0105239_11022152
902 Ga0157373_10012858
903 Ga0157373_10065805
904 Ga0157373_10108036
905 Ga0157373_10371801
906 Ga0157371_10002431
907 Ga0157371_10011285
908 Ga0157371_10074826
909 Ga0157371_10147749
910 Ga0157371_10232515
911 Ga0157371_10527646
912 Ga0157370_10010842
913 Ga0157370_10033722
914 Ga0157370_10051075
915 Ga0157370_10131358
916 Ga0157369_10016239
917 Ga0157369_10057404
918 Ga0157369_10168351
919 Ga0157369_10199325
920 Ga0157369_10360406
921 Ga0157369_10611153
922 Ga0157369_11062661
923 Ga0157374_10040314
924 Ga0157374_10300329
925 Ga0157378_10042918
926 Ga0157378_10230675
927 Ga0157378_10288150
928 Ga0157378_10957817
929 Ga0163162_10047096
930 Ga0157372_10021480
931 Ga0157372_10095364
932 Ga0157372_10358807
933 Ga0157372_10487679
934 Ga0157372_10490163
935 Ga0157372_10951265
936 Ga0157372_11247876
937 Ga0157375_10498955
938 Ga0163163_10000799
939 Ga0163163_10210861
940 Ga0182008_10237801
941 Ga0157379_10031246
942 Ga0157379_10123357
943 Ga0206356_11342232
944 Ga0206353_10607450
945 Ga0207697_10022692
946 Ga0207697_10085268
947 Ga0207656_10001598
948 Ga0207656_10003347
949 Ga0207682_10003134
950 Ga0207682_10059489
951 Ga0207642_10077824
952 Ga0207688_10040937
953 Ga0207688_10299588
954 Ga0207680_10001282
955 Ga0207680_10012874
956 Ga0207680_10158491
957 Ga0207680_10267484
958 Ga0207680_10654782
959 Ga0207680_10710426
960 Ga0207647_10003773
961 Ga0207647_10082861
962 Ga0207647_10086811
963 Ga0207699_10319516
964 Ga0207645_10068556
965 Ga0207643_10053646
966 Ga0207705_10000164
967 Ga0207705_10005666
968 Ga0207705_10023528
969 Ga0207705_10027026
970 Ga0207705_10027985
971 Ga0207705_10256622
972 Ga0207705_10305013
973 Ga0207705_10440333
974 Ga0207705_10681712
975 Ga0207654_10091830
976 Ga0207654_10150421
977 Ga0207707_10142012
978 Ga0207707_10221864
979 Ga0207707_10480624
980 Ga0207695_10078982
981 Ga0207671_10116700
982 Ga0207693_10086383
983 Ga0207660_10013348
984 Ga0207660_10183715
985 Ga0207657_10000090
986 Ga0207657_10005658
987 Ga0207657_10010838
988 Ga0207657_10015081
989 Ga0207657_10015209
990 Ga0207657_10093955
991 Ga0207657_10100421
992 Ga0207657_10141119
993 Ga0207657_10150061
994 Ga0207657_10165371
995 Ga0207657_10198165
996 Ga0207657_10299594
997 Ga0207649_10000324
998 Ga0207649_10006680
999 Ga0207649_10019228
1000 Ga0207649_10026965
1001 Ga0207649_10070496
1002 Ga0207649_10085523
1003 Ga0207649_10128440
1004 Ga0207649_10293521
1005 Ga0207649_10323105
1006 Ga0207649_10724502
1007 Ga0207652_10073767
1008 Ga0207652_10088090
1009 Ga0207652_10384340
1010 Ga0207694_10077935
1011 Ga0207650_10008672
1012 Ga0207650_10021503
1013 Ga0207650_10091071
1014 Ga0207650_10277986
1015 Ga0207650_10725784
1016 Ga0207659_10087615
1017 Ga0207687_10063754
1018 Ga0207700_10046983
1019 Ga0207664_10094725
1020 Ga0207664_10137160
1021 Ga0207644_10012582
1022 Ga0207644_10014159
1023 Ga0207644_10031124
1024 Ga0207644_10039392
1025 Ga0207644_10051702
1026 Ga0207644_10509452
1027 Ga0207690_10000184
1028 Ga0207690_10001341
1029 Ga0207690_10017580
1030 Ga0207690_10021476
1031 Ga0207690_10035058
1032 Ga0207690_10037098
1033 Ga0207690_10087541
1034 Ga0207690_10096382
1035 Ga0207690_10108373
1036 Ga0207690_10386835
1037 Ga0207706_10000110
1038 Ga0207706_10004468
1039 Ga0207706_10016228
1040 Ga0207706_10018829
1041 Ga0207706_10021424
1042 Ga0207706_10028135
1043 Ga0207706_10038125
1044 Ga0207706_10039480
1045 Ga0207706_10047857
1046 Ga0207706_10093693
1047 Ga0207669_10033115
1048 Ga0207669_10044873
1049 Ga0207669_10129793
1050 Ga0207704_10118542
1051 Ga0207665_10125061
1052 Ga0207691_10058090
1053 Ga0207691_10141699
1054 Ga0207691_10355148
1055 Ga0207691_10494322
1056 Ga0207711_10000586
1057 Ga0207711_10014767
1058 Ga0207711_10103717
1059 Ga0207711_10194007
1060 Ga0207711_10234846
1061 Ga0207689_10101992
1062 Ga0207661_10000179
1063 Ga0207661_10015420
1064 Ga0207661_10353232
1065 Ga0207661_10629507
1066 Ga0207679_10001192
1067 Ga0207679_10005199
1068 Ga0207679_10015204
1069 Ga0207679_10027237
1070 Ga0207679_10042441
1071 Ga0207679_10088891
1072 Ga0207679_10101838
1073 Ga0207679_10346609
1074 Ga0207679_10470610
1075 Ga0207679_11118636
1076 Ga0207667_10002920
1077 Ga0207667_10031772
1078 Ga0207667_10279491
1079 Ga0207667_10298616
1080 Ga0207667_10643270
1081 Ga0207667_11198354
1082 Ga0207651_10044806
1083 Ga0207651_10247214
1084 Ga0207651_10604848
1085 Ga0207651_10734093
1086 Ga0207668_10425587
1087 Ga0207640_10006207
1088 Ga0207640_10024567
1089 Ga0207640_10036797
1090 Ga0207640_10079032
1091 Ga0207640_10115459
1092 Ga0207640_10186173
1093 Ga0207640_10355100
1094 Ga0207658_10036251
1095 Ga0207658_10832771
1096 Ga0207677_10072516
1097 Ga0207677_10272084
1098 Ga0207677_10299882
1099 Ga0207677_10305180
1100 Ga0207703_10290265
1101 Ga0207639_10000458
1102 Ga0207639_10004341
1103 Ga0207639_10017401
1104 Ga0207639_10032131
1105 Ga0207639_10245742
1106 Ga0207639_10822095
1107 Ga0207678_10003179
1108 Ga0207678_10006368
1109 Ga0207678_10014156
1110 Ga0207678_10025025
1111 Ga0207678_10034857
1112 Ga0207678_10144106
1113 Ga0207678_10455989
1114 Ga0207702_10000391
1115 Ga0207702_10005629
1116 Ga0207702_10040278
1117 Ga0207702_10073046
1118 Ga0207702_10261940
1119 Ga0207702_10266742
1120 Ga0207702_10458475
1121 Ga0207702_10465235
1122 Ga0207641_10020301
1123 Ga0207641_10637896
1124 Ga0207648_10005798
1125 Ga0207648_10041645
1126 Ga0207676_10006116
1127 Ga0207676_10050226
1128 Ga0207676_10126890
1129 Ga0207676_10676280
1130 Ga0207674_10001888
1131 Ga0207674_10003497
1132 Ga0207674_10006502
1133 Ga0207674_10025954
1134 Ga0207674_10058884
1135 Ga0207675_100118064
1136 Ga0207683_10014318
1137 Ga0207683_10014621
1138 Ga0207683_10151664
1139 Ga0207683_10660820
1140 Ga0207698_10000737
1141 Ga0207698_10009636
1142 Ga0207698_10014041
1143 Ga0207698_10028864
1144 Ga0207698_10075477
1145 Ga0207698_10235898
1146 Ga0207698_10284905
1147 Ga0207698_11225121
1148 Ga0268266_10004144
1149 Ga0268266_10088729
1150 Ga0268264_10295635
1151 Ga0268264_10419979
1152 Ga0268264_10525037
1153 Ga0307406_10624944
1154 Ga0373930_0006567
1155 Ga0373959_0012906
1156 Ga0373952_0048681
1157 Ga0373932_0009953
1158 Ga0373941_0166536
1159 Ga0373954_0027683
1160 Ga0373943_0001773
1161 Ga0373943_0287383
1162 Ga0373946_0030036
1163 Ga0373955_0000958
1164 Ga0373961_0051316
1165 Ga0373924_0100991
1166 Ga0373931_0059549
1167 Ga0373935_0323241
1168 Ga0373927_0045523
1169 Ga0373947_0072174
1170 Ga0373937_0081860
1171 Ga0373925_0009900
1172 Ga0395899_0008522
1173 Ga0395899_0014826
1174 Ga0395899_0034166
1175 Ga0395899_0038454
1176 Ga0395899_0076254
1177 Ga0395899_0082608
1178 Ga0395899_0089155
1179 Ga0395899_0090487
1180 Ga0395899_0100939
1181 Ga0395899_0268337
1182 Ga0395899_0304906
1183 Ga0395899_0437977
1184 Ga0395900_0000336
1185 Ga0395900_0005450
1186 Ga0395900_0005557
1187 Ga0395900_0014397
1188 Ga0395900_0019866
1189 Ga0395900_0030623
1190 Ga0395900_0039543
1191 Ga0395900_0078615
1192 Ga0395900_0094892
1193 Ga0395900_0103492
1194 Ga0395900_0144336
1195 Ga0395900_0194473
1196 Ga0395900_0320353
1197 Ga0395900_0449144
1198 Ga0395900_0470106
1199 Ga0395898_0000055
1200 Ga0395898_0008753
1201 Ga0395898_0044312
1202 Ga0395898_0070580
1203 Ga0395898_0122517
1204 Ga0395898_0127730
1205 Ga0395898_0159708
1206 Ga0395898_0165050
1207 Ga0395898_0180879
1208 Ga0395898_0182230
1209 Ga0395898_0379263
1210 Ga0395898_0396682
1211 Ga0395898_0757664
1212 Ga0395898_0923068
1213 Ga0395905_0000067
1214 Ga0395905_0000204
1215 Ga0395905_0000215
1216 Ga0395905_0002584
1217 Ga0395905_0016729
1218 Ga0395905_0018044
1219 Ga0395905_0026726
1220 Ga0395905_0027580
1221 Ga0395905_0049957
1222 Ga0395905_0053320
1223 Ga0395905_0071808
1224 Ga0395905_0103389
1225 Ga0395905_0127248
1226 Ga0395905_0129700
1227 Ga0395905_0155106
1228 Ga0395905_0176393
1229 Ga0395905_0218932
1230 Ga0395905_0281062
1231 Ga0395905_0325349
1232 Ga0395905_0337202
1233 Ga0395905_0337556
1234 Ga0395905_0446992
1235 Ga0395905_0831325
1236 Ga0395901_0000648
1237 Ga0395901_0001244
1238 Ga0395901_0012333
1239 Ga0395901_0026568
1240 Ga0395901_0028637
1241 Ga0395901_0041779
1242 Ga0395901_0052734
1243 Ga0395901_0056070
1244 Ga0395901_0091427
1245 Ga0395901_0138943
1246 Ga0395901_0170796
1247 Ga0395901_0184702
1248 Ga0395901_0213438
1249 Ga0395901_0325323
1250 Ga0395901_0482041
1251 Ga0395901_1286959
1252 Ga0436363_0830406
1253 Ga0439448_0010622
1254 Ga0439448_0134120
1255 Ga0439458_0000200
1256 Ga0439458_0001085
1257 Ga0466969_0011279
1258 Ga0466969_0062339
1259 Ga0466972_0105873
1260 Ga0466972_0202275
1261 Ga0466965_0310879
1262 Ga0466966_0009227
1263 Ga0466966_0016198
1264 Ga0466966_0018309
1265 Ga0466966_0169846
1266 Ga0466961_0098789
1267 Ga0466961_0103622
1268 Ga0466963_0012698
1269 Ga0466963_0015975
1270 Ga0466963_0107695
1271 Ga0466963_0152823
1272 Ga0466964_0015188
1273 Ga0466971_0026688
1274 Ga0466971_0106482
1275 Ga0466970_0010451
1276 Ga0466970_0029697
1277 Ga0466957_0002384
1278 Ga0466957_0053910
1279 Ga0466957_0099796
1280 Ga0466957_0257901
1281 Ga0466959_0022840
1282 Ga0466959_0092870
1283 Ga0466959_0212586
1284 Ga0466958_0075021
1285 Ga0466958_0124134
1286 Ga0466958_0157403
1287 Ga0466967_0000100
1288 Ga0466967_0107964
1289 Ga0466967_0175010
1290 Ga0466967_0187555
1291 Ga0466967_0197600
1292 Ga0466967_0344886
1293 Ga0466967_0406121
1294 Ga0466967_0498341
1295 Ga0466967_0602647
1296 Ga0466967_1012652
1297 Ga0466967_1475162
1298 Ga0495621_0000147
1299 Ga0495621_0052596
1300 Ga0495633_0015971
1301 Ga0495633_0157134
1302 Ga0495668_0124991
1303 Ga0495668_0311275
1304 Ga0495623_0022758
1305 Ga0495669_0000090
1306 Ga0495669_0004106
1307 Ga0495669_0037647
1308 Ga0495669_0040058
1309 Ga0495669_0043236
1310 Ga0495669_0091816
1311 Ga0495669_0263025
1312 Ga0495670_0000192
1313 Ga0495677_0029848
1314 Ga0495685_050631
1315 Ga0495602_0081348
1316 Ga0496101_0145355
1317 Ga0496101_0808815
1318 Ga0496102_0103045
1319 Ga0496102_0492352
1320 Ga0496103_0006948
1321 Ga0496103_0031502
1322 Ga0496104_0241147
1323 Ga0496104_0569468
1324 Ga0496106_0680859
1325 Ga0496107_0043761
1326 Ga0496107_0046986
1327 Ga0496107_0081451
1328 Ga0496107_0113504
1329 Ga0496107_0120454
1330 Ga0496109_0070267
1331 Ga0496109_0154409
1332 Ga0496109_0219793
1333 Ga0496110_0066008
1334 Ga0496110_0269296
1335 Ga0496110_0680667
1336 Ga0496111_0010755
1337 Ga0496111_0031203
1338 Ga0496111_0745282
1339 Ga0496112_0017858
1340 Ga0496112_0169925
1341 Ga0496112_0669798
1342 Ga0496113_0025885
1343 Ga0496115_0014491
1344 Ga0501034_0900281
1345 Ga0501080_0018064
1346 Ga0495612_0061199
1347 Ga0495655_0005689
1348 Ga0466962_0040923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xmo-assembly1.cif.gz_A x-ray crystal structure of pseudoazurin met16phe/thr36lys variant 0.8185 55 140
5ysg-assembly3.cif.gz_C x-ray crystal structure of pseudoazurin met16gly variant, reduced form. 0.8181 55 140
4bwu-assembly1.cif.gz_A three-dimensional structure of the k109a mutant of paracoccus pantotrophus pseudoazurin at ph 5.5 0.8116 55 140
1py0-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8006 56 140
5y23-assembly2.cif.gz_B x-ray crystal structure of pseudoazurin met16phe variant 0.7995 55 140
ID Description Score Start End Superfamily
af_P42787_1224_1309_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8029 23 195 2.60.40.1120
5b1jC00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.7966 55 139 2.60.40.420
af_P15087_375_469_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7886 23 195 2.60.40.1120
af_D4A536_407_501_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7877 23 196 2.60.40.1120
af_F1RAC0_1040_1118_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.786 23 196 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A429VCP4-F1-model_v4 Methylamine utilization protein 0.9085 12 199
AF-A0A6S6G0F3-F1-model_v4 Methylamine utilization protein 0.9041 17 196 GO:0030246
AF-A0A5C8L021-F1-model_v4 Methylamine utilization protein 0.8969 19 206
AF-A0A1I5QED1-F1-model_v4 Plastocyanin 0.8932 13 196
AF-A0A6S6G0F3-F1-model_v4 Methylamine utilization protein 0.8857 17 196 GO:0030246

Map