F474348

General Info

Members Datasets Scaffolds Average Seq Length
674 374 1348 244

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100052343|Ga0068868_1000523434
Length 251
Sequence MATGTGAPKPVALVIGAGDATGGAIARRFAREGYVACVTRRHLDKLQPLVDEIVAAGGEAHGFASDARKEEEVIALVDQIESAIGPIEVLVFNIGANAPSSILEETARKYFKIWEMACFGGFLNAREVAKRMVAREGDGHKGTIIFTGATASLRGSANFGAFAGAKHALRALAQSMARELGPRGIHVAHVVVDGAIDTEFIRETFPQRYALKDQDGILNPDHIADNYWMLHRQPRDAWTHELDLRPWIEKF

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
205 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
206 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
210 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
211 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
242 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
243 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
244 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
245 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
246 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
247 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
248 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
249 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
250 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
251 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
252 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
253 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
254 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
255 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
256 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
257 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
258 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
259 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
260 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
261 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
262 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
263 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
264 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
265 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
266 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
267 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
274 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
275 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
280 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
281 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
282 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
283 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
284 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
285 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
288 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
289 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
303 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
329 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
337 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
342 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
343 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
344 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
345 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
346 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
347 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
348 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
349 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
350 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
351 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
356 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
357 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
358 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
359 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
360 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
361 2643221658 Variovorax sp. Root411 Isolate Unclassified
362 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
363 2643221672 Variovorax sp. Root434 Isolate Unclassified
364 2738541307 Variovorax sp. GV008 Isolate Unclassified
365 2738543013 Variovorax sp. BT01 Isolate Unclassified
366 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
367 2885266251 Ralstonia sp. SET104 Isolate Nodule
368 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
369 2904456579 Variovorax sp. 2002 Isolate Unclassified
370 2928058823 Ralstonia sp. 1138 Isolate Unclassified
371 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
372 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
373 2929520902 Variovorax beijingensis 502 Isolate Unclassified
374 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.74
Metatranscriptomes 0.74
Isolates 2.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.57
Nodule 1.04
Rhizoplane 5.19
Rhizosphere 76.85
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100052343 3300005338 Bacteria 3214
2 JGI24739J22299_10019621 3300001989 Bacteria 2419
3 JGI25156J39149_1003854 3300002705 Bacteria 4768
4 JGI25151J46595_10000732 3300003187 Bacteria 27119
5 Ga0006562J51391_1110457 3300003578 Bacteria 2700
6 Ga0006562J51391_1110458 3300003578 Bacteria 2692
7 Ga0006562J51391_1113999 3300003578 Bacteria 2341
8 Ga0006562J51391_1114001 3300003578 Bacteria 1800
9 Ga0055538_1002515 3300003751 Bacteria 2655
10 Ga0055533_1002572 3300003756 Bacteria 4053
11 Ga0055532_1000048 3300003758 Bacteria 175560
12 Ga0055535_1000035 3300003761 Bacteria 175560
13 Ga0055529_1000101 3300003763 Bacteria 130709
14 Ga0055526_1009224 3300003771 Bacteria 4786
15 Ga0055537_1000211 3300003773 Bacteria 43102
16 Ga0055537_1001221 3300003773 Bacteria 10815
17 Ga0055524_1001351 3300003775 Bacteria 14282
18 Ga0055536_1001127 3300003781 Bacteria 16744
19 Ga0055534_1000210 3300003784 Bacteria 43102
20 Ga0055528_1000852 3300003790 Bacteria 20709
21 Ga0055528_1033087 3300003790 Bacteria 1304
22 Ga0055530_10012071 3300003791 Bacteria 3041
23 Ga0055540_1000142 3300003792 Bacteria 71685
24 Ga0055540_1000440 3300003792 Bacteria 32622
25 Ga0055531_10000424 3300003794 Bacteria 40020
26 Ga0055531_10001478 3300003794 Bacteria 17287
27 Ga0065714_10002999 3300005288 Bacteria 16414
28 Ga0070658_10154081 3300005327 Bacteria 1925
29 Ga0070658_10157981 3300005327 Bacteria 1901
30 Ga0070676_10008256 3300005328 Bacteria 5606
31 Ga0070676_10035874 3300005328 Bacteria 2854
32 Ga0070676_10054380 3300005328 Bacteria 2360
33 Ga0070676_10118212 3300005328 Bacteria 1660
34 Ga0070683_100095147 3300005329 Bacteria 2800
35 Ga0070683_100423180 3300005329 Bacteria 1271
36 Ga0070690_100001686 3300005330 Bacteria 11638
37 Ga0070690_100017056 3300005330 Bacteria 4360
38 Ga0070670_100361184 3300005331 Bacteria 1277
39 Ga0070677_10025396 3300005333 Bacteria 2211
40 Ga0070677_10060993 3300005333 Bacteria 1556
41 Ga0070677_10086340 3300005333 Bacteria 1355
42 Ga0068869_100088813 3300005334 Bacteria 2320
43 Ga0068869_100135729 3300005334 Bacteria 1895
44 Ga0070666_10007800 3300005335 Bacteria 6612
45 Ga0070666_10532240 3300005335 Bacteria 854
46 Ga0068868_100000814 3300005338 Bacteria 21169
47 Ga0068868_100030698 3300005338 Bacteria 4121
48 Ga0068868_100033575 3300005338 Bacteria 3956
49 Ga0068868_100084956 3300005338 Bacteria 2542
50 Ga0068868_100387269 3300005338 Bacteria 1204
51 Ga0070689_100007835 3300005340 Bacteria 7487
52 Ga0070687_100000820 3300005343 Bacteria 10356
53 Ga0070687_100129053 3300005343 Bacteria 1457
54 Ga0070661_100120983 3300005344 Unclassified 1961
55 Ga0070661_100526060 3300005344 Bacteria 949
56 Ga0070692_10329626 3300005345 Bacteria 942
57 Ga0070668_100001217 3300005347 Bacteria 18276
58 Ga0070668_100035227 3300005347 Bacteria 3816
59 Ga0070668_100511059 3300005347 Bacteria 1041
60 Ga0070669_100045715 3300005353 Bacteria 3191
61 Ga0070675_100000562 3300005354 Bacteria 25576
62 Ga0070675_100050345 3300005354 Bacteria 3420
63 Ga0070671_100004823 3300005355 Bacteria 10722
64 Ga0070671_100054225 3300005355 Bacteria 3333
65 Ga0070674_100117807 3300005356 Bacteria 1961
66 Ga0070673_100005821 3300005364 Bacteria 7942
67 Ga0070673_100033026 3300005364 Bacteria 3903
68 Ga0070673_100434680 3300005364 Bacteria 1178
69 Ga0070673_100845287 3300005364 Bacteria 847
70 Ga0070659_100062096 3300005366 Bacteria 2953
71 Ga0070667_100017861 3300005367 Bacteria 5879
72 Ga0070667_100064340 3300005367 Bacteria 3112
73 Ga0070711_100017044 3300005439 Bacteria 4620
74 Ga0070711_100318674 3300005439 Unclassified 1241
75 Ga0070705_100265918 3300005440 Bacteria 1212
76 Ga0070694_100039919 3300005444 Bacteria 3127
77 Ga0070708_100023257 3300005445 Bacteria 5267
78 Ga0070708_100289792 3300005445 Bacteria 1541
79 Ga0070678_100010669 3300005456 Bacteria 5626
80 Ga0070662_100019528 3300005457 Bacteria 4601
81 Ga0070662_100046327 3300005457 Bacteria 3124
82 Ga0070662_100069781 3300005457 Bacteria 2588
83 Ga0070681_10693433 3300005458 Bacteria 934
84 Ga0068867_100004609 3300005459 Bacteria 9699
85 Ga0068867_100041458 3300005459 Bacteria 3364
86 Ga0068867_100102432 3300005459 Bacteria 2188
87 Ga0070706_100002496 3300005467 Bacteria 18534
88 Ga0070707_100366167 3300005468 Bacteria 1400
89 Ga0070679_100585020 3300005530 Bacteria 1060
90 Ga0070684_100224165 3300005535 Bacteria 1715
91 Ga0068853_100033865 3300005539 Bacteria 4334
92 Ga0068853_100047135 3300005539 Bacteria 3699
93 Ga0068853_100181082 3300005539 Bacteria 1911
94 Ga0070672_100012578 3300005543 Bacteria 5950
95 Ga0070672_100045895 3300005543 Bacteria 3383
96 Ga0070672_100056157 3300005543 Bacteria 3086
97 Ga0070672_100061128 3300005543 Bacteria 2969
98 Ga0070695_100164525 3300005545 Bacteria 1560
99 Ga0070665_100364412 3300005548 Bacteria 1451
100 Ga0070704_100019332 3300005549 Bacteria 4375
101 Ga0068855_100043550 3300005563 Bacteria 5316
102 Ga0070664_100047384 3300005564 Bacteria 3631
103 Ga0070664_100364151 3300005564 Bacteria 1317
104 Ga0068857_100106310 3300005577 Bacteria 2520
105 Ga0068857_100118879 3300005577 Bacteria 2378
106 Ga0068857_100181224 3300005577 Bacteria 1917
107 Ga0068857_100478428 3300005577 Bacteria 1167
108 Ga0068854_100000396 3300005578 Bacteria 27398
109 Ga0068854_100067625 3300005578 Bacteria 2603
110 Ga0068854_100067736 3300005578 Bacteria 2601
111 Ga0068856_100044068 3300005614 Bacteria 4389
112 Ga0068852_100014277 3300005616 Bacteria 6108
113 Ga0068852_100078523 3300005616 Bacteria 2920
114 Ga0068852_100242421 3300005616 Bacteria 1723
115 Ga0068859_100045863 3300005617 Bacteria 4390
116 Ga0068859_100125212 3300005617 Bacteria 2639
117 Ga0068859_100184011 3300005617 Bacteria 2173
118 Ga0068864_100000666 3300005618 Bacteria 28646
119 Ga0068864_100070863 3300005618 Bacteria 3034
120 Ga0068864_100248842 3300005618 Bacteria 1649
121 Ga0068864_100414273 3300005618 Bacteria 1283
122 Ga0068861_100311637 3300005719 Bacteria 1367
123 Ga0068851_10027581 3300005834 Bacteria 2800
124 Ga0068851_10073293 3300005834 Bacteria 1776
125 Ga0068851_10180623 3300005834 Bacteria 1168
126 Ga0068870_10181875 3300005840 Bacteria 1262
127 Ga0068863_100000585 3300005841 Bacteria 37128
128 Ga0068863_100009834 3300005841 Bacteria 9318
129 Ga0068863_100523186 3300005841 Bacteria 1170
130 Ga0068858_100004762 3300005842 Bacteria 13288
131 Ga0068858_100007104 3300005842 Bacteria 10869
132 Ga0068860_100002804 3300005843 Bacteria 18134
133 Ga0068860_100150781 3300005843 Bacteria 2239
134 Ga0068860_100681797 3300005843 Bacteria 1037
135 Ga0068862_100030063 3300005844 Bacteria 4577
136 Ga0068862_100057153 3300005844 Bacteria 3344
137 Ga0068862_100153122 3300005844 Bacteria 2053
138 Ga0081540_1001565 3300005983 Bacteria 19566
139 Ga0075365_10012156 3300006038 Bacteria 5098
140 Ga0075365_10037769 3300006038 Bacteria 3137
141 Ga0075365_10282573 3300006038 Bacteria 1168
142 Ga0075363_100236535 3300006048 Bacteria 1049
143 Ga0075432_10015003 3300006058 Bacteria 2640
144 Ga0075362_10000626 3300006177 Bacteria 10333
145 Ga0075362_10020852 3300006177 Bacteria 2742
146 Ga0075362_10037317 3300006177 Bacteria 2129
147 Ga0075367_10251727 3300006178 Bacteria 1108
148 Ga0075369_10017548 3300006186 Bacteria 2902
149 Ga0075366_10005412 3300006195 Bacteria 6917
150 Ga0075366_10158104 3300006195 Bacteria 1373
151 Ga0097621_100018619 3300006237 Bacteria 5310
152 Ga0075370_10001410 3300006353 Bacteria 10388
153 Ga0075370_10003126 3300006353 Bacteria 7817
154 Ga0075370_10003497 3300006353 Bacteria 7487
155 Ga0075370_10049456 3300006353 Bacteria 2383
156 Ga0068871_100115888 3300006358 Bacteria 2258
157 Ga0068871_100156753 3300006358 Bacteria 1945
158 Ga0068871_100335788 3300006358 Bacteria 1333
159 Ga0068871_100433289 3300006358 Bacteria 1176
160 Ga0075428_100204783 3300006844 Bacteria 2132
161 Ga0075430_100062615 3300006846 Bacteria 3125
162 Ga0075430_100098468 3300006846 Bacteria 2443
163 Ga0075430_100139949 3300006846 Bacteria 2015
164 Ga0075430_100296315 3300006846 Bacteria 1338
165 Ga0075430_100756689 3300006846 Bacteria 801
166 Ga0075431_100005375 3300006847 Bacteria 12641
167 Ga0075431_100127842 3300006847 Bacteria 2622
168 Ga0075433_10367920 3300006852 Bacteria 1270
169 Ga0075433_10633349 3300006852 Bacteria 938
170 Ga0075434_100112835 3300006871 Bacteria 2730
171 Ga0075434_100247469 3300006871 Bacteria 1802
172 Ga0075434_100972424 3300006871 Bacteria 863
173 Ga0075429_100097936 3300006880 Bacteria 2559
174 Ga0068865_100006103 3300006881 Bacteria 7348
175 Ga0068865_100077319 3300006881 Bacteria 2378
176 Ga0068865_100170487 3300006881 Bacteria 1668
177 Ga0068865_100228416 3300006881 Bacteria 1459
178 Ga0097620_100045862 3300006931 Bacteria 4390
179 Ga0097620_100125211 3300006931 Bacteria 2639
180 Ga0097620_100158505 3300006931 Bacteria 2342
181 Ga0097620_100184001 3300006931 Bacteria 2173
182 Ga0099826_10000019 3300006948 Bacteria 188386
183 Ga0099826_10000124 3300006948 Bacteria 34781
184 Ga0099826_10111361 3300006948 Bacteria 1631
185 Ga0105244_10003295 3300009036 Bacteria 11628
186 Ga0105244_10102435 3300009036 Bacteria 1399
187 Ga0105250_10030527 3300009092 Bacteria 2166
188 Ga0105240_10190147 3300009093 Bacteria 2415
189 Ga0105240_10310580 3300009093 Bacteria 1801
190 Ga0105240_10440467 3300009093 Bacteria 1460
191 Ga0105240_10919149 3300009093 Bacteria 940
192 Ga0111539_10203014 3300009094 Bacteria 2311
193 Ga0105245_10155162 3300009098 Bacteria 2168
194 Ga0105245_10183341 3300009098 Bacteria 2001
195 Ga0105245_10266984 3300009098 Bacteria 1667
196 Ga0114129_10286641 3300009147 Bacteria 2199
197 Ga0105243_10003586 3300009148 Bacteria 12526
198 Ga0105243_10063029 3300009148 Bacteria 2970
199 Ga0105243_10189747 3300009148 Bacteria 1794
200 Ga0105243_10491158 3300009148 Bacteria 1161
201 Ga0105243_10628500 3300009148 Bacteria 1038
202 Ga0105241_10147033 3300009174 Bacteria 1924
203 Ga0105241_10230179 3300009174 Bacteria 1562
204 Ga0105242_10058464 3300009176 Bacteria 3161
205 Ga0105242_10402952 3300009176 Bacteria 1277
206 Ga0105248_10056296 3300009177 Bacteria 4412
207 Ga0105248_10106475 3300009177 Bacteria 3162
208 Ga0105248_10130470 3300009177 Bacteria 2835
209 Ga0105238_10050991 3300009551 Bacteria 4164
210 Ga0105238_10169153 3300009551 Bacteria 2162
211 Ga0105238_10173478 3300009551 Bacteria 2133
212 Ga0105238_10204266 3300009551 Bacteria 1952
213 Ga0105249_10018226 3300009553 Bacteria 6240
214 Ga0105249_10029758 3300009553 Bacteria 4933
215 Ga0105249_10039617 3300009553 Bacteria 4278
216 Ga0105239_10053753 3300010375 Bacteria 4417
217 Ga0105239_10296013 3300010375 Bacteria 1822
218 Ga0105239_10425490 3300010375 Bacteria 1505
219 Ga0105246_10076816 3300011119 Bacteria 2367
220 Ga0105246_10672405 3300011119 Bacteria 904
221 Ga0157373_10008499 3300013100 Bacteria 7628
222 Ga0157373_10010780 3300013100 Bacteria 6728
223 Ga0157373_10067909 3300013100 Bacteria 2521
224 Ga0157371_10002198 3300013102 Bacteria 18932
225 Ga0157369_10004358 3300013105 Bacteria 16698
226 Ga0157369_10022415 3300013105 Bacteria 7047
227 Ga0157369_10216882 3300013105 Bacteria 2004
228 Ga0157374_10100543 3300013296 Bacteria 2772
229 Ga0157374_10126901 3300013296 Bacteria 2466
230 Ga0157378_10144762 3300013297 Bacteria 2210
231 Ga0163162_10005819 3300013306 Bacteria 11923
232 Ga0163162_10059527 3300013306 Bacteria 3852
233 Ga0163162_10100125 3300013306 Bacteria 2989
234 Ga0163162_10121194 3300013306 Bacteria 2720
235 Ga0163162_10138801 3300013306 Bacteria 2543
236 Ga0163162_10850727 3300013306 Bacteria 1027
237 Ga0157372_10029194 3300013307 Bacteria 6020
238 Ga0157372_10166503 3300013307 Bacteria 2549
239 Ga0157375_10007620 3300013308 Bacteria 9468
240 Ga0157375_10025238 3300013308 Bacteria 5518
241 Ga0157375_10208598 3300013308 Bacteria 2111
242 Ga0163163_10006619 3300014325 Bacteria 10147
243 Ga0157380_10581210 3300014326 Bacteria 1105
244 Ga0157380_10851981 3300014326 Bacteria 933
245 Ga0182008_10000669 3300014497 Bacteria 24850
246 Ga0182008_10011327 3300014497 Bacteria 4748
247 Ga0182008_10011982 3300014497 Bacteria 4593
248 Ga0157377_10139293 3300014745 Bacteria 1489
249 Ga0157379_10003595 3300014968 Bacteria 13145
250 Ga0157379_10046697 3300014968 Bacteria 3864
251 Ga0157379_10082433 3300014968 Bacteria 2882
252 Ga0157376_10006041 3300014969 Bacteria 8512
253 Ga0157376_10092389 3300014969 Bacteria 2624
254 Ga0182006_1003951 3300015261 Bacteria 7413
255 Ga0182006_1006971 3300015261 Bacteria 5200
256 Ga0182006_1009607 3300015261 Bacteria 4330
257 Ga0182006_1016779 3300015261 Bacteria 3121
258 Ga0182007_10003759 3300015262 Bacteria 7078
259 Ga0182007_10015387 3300015262 Bacteria 2855
260 Ga0163161_10005078 3300017792 Bacteria 9163
261 Ga0163161_10056146 3300017792 Bacteria 2860
262 Ga0206351_10377698 3300020077 Bacteria 3746
263 Ga0213876_10024079 3300021384 Bacteria 3215
264 Ga0213876_10126376 3300021384 Bacteria 1358
265 Ga0209784_101654 3300025224 Bacteria 2726
266 Ga0209566_103076 3300025225 Bacteria 2727
267 Ga0209674_103712 3300025226 Bacteria 2715
268 Ga0209672_100127 3300025228 Bacteria 78095
269 Ga0209147_100008 3300025229 Bacteria 777096
270 Ga0209563_102375 3300025230 Bacteria 4288
271 Ga0209563_105100 3300025230 Bacteria 2423
272 Ga0209258_100013 3300025242 Bacteria 777096
273 Ga0209148_1015709 3300025254 Bacteria 1317
274 Ga0209759_1001412 3300025256 Bacteria 13705
275 Ga0209759_1004529 3300025256 Bacteria 5146
276 Ga0209565_1000039 3300025263 Bacteria 278026
277 Ga0209565_1000077 3300025263 Bacteria 161163
278 Ga0209455_1000042 3300025272 Bacteria 419638
279 Ga0209673_1000146 3300025273 Bacteria 150871
280 Ga0209673_1024153 3300025273 Bacteria 2050
281 Ga0209675_1000030 3300025291 Bacteria 278026
282 Ga0209675_1002647 3300025291 Bacteria 9040
283 Ga0209676_1000152 3300025292 Bacteria 166700
284 Ga0209676_1013324 3300025292 Bacteria 3168
285 Ga0209025_1000231 3300025294 Bacteria 130671
286 Ga0209564_1000080 3300025295 Bacteria 263547
287 Ga0209564_1000274 3300025295 Bacteria 107980
288 Ga0209564_1031142 3300025295 Bacteria 1636
289 Ga0209758_1042613 3300025297 Bacteria 1681
290 Ga0209050_1000210 3300025298 Bacteria 129834
291 Ga0209256_1000119 3300025299 Bacteria 168215
292 Ga0209051_1000025 3300025303 Bacteria 415397
293 Ga0209051_1000074 3300025303 Bacteria 208667
294 Ga0209051_1000161 3300025303 Bacteria 125704
295 Ga0209257_1000039 3300025304 Bacteria 591694
296 Ga0209257_1000072 3300025304 Bacteria 332791
297 Ga0207697_10024529 3300025315 Bacteria 2469
298 Ga0207697_10036058 3300025315 Bacteria 2025
299 Ga0207655_1001284 3300025728 Bacteria 23851
300 Ga0207655_1015387 3300025728 Bacteria 4255
301 Ga0207655_1015752 3300025728 Bacteria 4181
302 Ga0207642_10019186 3300025899 Bacteria 2643
303 Ga0207688_10029592 3300025901 Bacteria 3016
304 Ga0207645_10002245 3300025907 Bacteria 15384
305 Ga0207645_10043273 3300025907 Bacteria 2882
306 Ga0207645_10047006 3300025907 Bacteria 2756
307 Ga0207645_10053872 3300025907 Bacteria 2570
308 Ga0207645_10087978 3300025907 Bacteria 1996
309 Ga0207643_10036455 3300025908 Bacteria 2758
310 Ga0207643_10427526 3300025908 Bacteria 840
311 Ga0207705_10110955 3300025909 Bacteria 2026
312 Ga0207705_10272171 3300025909 Unclassified 1295
313 Ga0207684_10019594 3300025910 Bacteria 5786
314 Ga0207654_10188462 3300025911 Bacteria 1350
315 Ga0207695_10000739 3300025913 Bacteria 63264
316 Ga0207695_10366422 3300025913 Bacteria 1327
317 Ga0207663_10009233 3300025916 Bacteria 5202
318 Ga0207662_10001818 3300025918 Bacteria 10475
319 Ga0207662_10067399 3300025918 Bacteria 2159
320 Ga0207657_10041050 3300025919 Bacteria 4094
321 Ga0207649_10078094 3300025920 Bacteria 2135
322 Ga0207646_10133980 3300025922 Bacteria 2231
323 Ga0207681_10131700 3300025923 Bacteria 1850
324 Ga0207681_10185837 3300025923 Bacteria 1586
325 Ga0207694_10116619 3300025924 Bacteria 2128
326 Ga0207650_10000856 3300025925 Bacteria 23101
327 Ga0207650_10043175 3300025925 Bacteria 3309
328 Ga0207650_10302337 3300025925 Bacteria 1307
329 Ga0207650_10532929 3300025925 Bacteria 983
330 Ga0207659_10001396 3300025926 Bacteria 14395
331 Ga0207659_10094953 3300025926 Bacteria 2235
332 Ga0207659_10117768 3300025926 Bacteria 2030
333 Ga0207659_10484234 3300025926 Bacteria 1046
334 Ga0207687_10125912 3300025927 Bacteria 1923
335 Ga0207687_10728662 3300025927 Bacteria 843
336 Ga0207644_10018092 3300025931 Bacteria 4764
337 Ga0207644_10030603 3300025931 Bacteria 3745
338 Ga0207644_10086595 3300025931 Bacteria 2326
339 Ga0207644_10209862 3300025931 Bacteria 1539
340 Ga0207644_10257453 3300025931 Bacteria 1394
341 Ga0207690_10052886 3300025932 Bacteria 2722
342 Ga0207690_10152525 3300025932 Bacteria 1714
343 Ga0207706_10006621 3300025933 Bacteria 10724
344 Ga0207706_10079459 3300025933 Bacteria 2884
345 Ga0207706_10102599 3300025933 Bacteria 2516
346 Ga0207706_10157950 3300025933 Bacteria 1994
347 Ga0207686_10008279 3300025934 Bacteria 5611
348 Ga0207709_10003293 3300025935 Bacteria 9694
349 Ga0207709_10127833 3300025935 Bacteria 1727
350 Ga0207709_10154628 3300025935 Bacteria 1592
351 Ga0207709_10491146 3300025935 Bacteria 956
352 Ga0207670_10011864 3300025936 Bacteria 5074
353 Ga0207669_10042458 3300025937 Bacteria 2655
354 Ga0207704_10011710 3300025938 Bacteria 4331
355 Ga0207704_10608494 3300025938 Bacteria 895
356 Ga0207665_10169566 3300025939 Bacteria 1575
357 Ga0207691_10042905 3300025940 Bacteria 4169
358 Ga0207691_10110267 3300025940 Bacteria 2448
359 Ga0207691_10133300 3300025940 Bacteria 2193
360 Ga0207691_10156980 3300025940 Bacteria 1998
361 Ga0207711_10040669 3300025941 Bacteria 3955
362 Ga0207711_10073327 3300025941 Bacteria 2975
363 Ga0207689_10001177 3300025942 Bacteria 25141
364 Ga0207689_10005845 3300025942 Bacteria 10904
365 Ga0207661_11040760 3300025944 Bacteria 754
366 Ga0207679_10007872 3300025945 Bacteria 6770
367 Ga0207679_10351562 3300025945 Bacteria 1285
368 Ga0207667_10123620 3300025949 Bacteria 2666
369 Ga0207651_10009043 3300025960 Bacteria 5421
370 Ga0207651_10024787 3300025960 Bacteria 3717
371 Ga0207651_10064944 3300025960 Bacteria 2557
372 Ga0207651_10205883 3300025960 Bacteria 1580
373 Ga0207651_10256796 3300025960 Bacteria 1433
374 Ga0207712_10676406 3300025961 Bacteria 899
375 Ga0207668_10011422 3300025972 Bacteria 5395
376 Ga0207640_10000058 3300025981 Bacteria 92862
377 Ga0207640_10038517 3300025981 Bacteria 3018
378 Ga0207658_10005206 3300025986 Bacteria 8952
379 Ga0207658_10005491 3300025986 Bacteria 8691
380 Ga0207658_10093633 3300025986 Bacteria 2336
381 Ga0207677_10001603 3300026023 Bacteria 12013
382 Ga0207677_10014282 3300026023 Bacteria 4632
383 Ga0207677_10115678 3300026023 Bacteria 2007
384 Ga0207703_10001832 3300026035 Bacteria 18948
385 Ga0207703_10007388 3300026035 Bacteria 8730
386 Ga0207639_10036440 3300026041 Bacteria 3645
387 Ga0207639_10113223 3300026041 Bacteria 2216
388 Ga0207639_10142888 3300026041 Bacteria 1996
389 Ga0207678_10013824 3300026067 Bacteria 7093
390 Ga0207678_10135116 3300026067 Bacteria 2104
391 Ga0207708_10009773 3300026075 Bacteria 7118
392 Ga0207641_10004752 3300026088 Bacteria 11709
393 Ga0207641_10007502 3300026088 Bacteria 9077
394 Ga0207641_10054157 3300026088 Bacteria 3403
395 Ga0207641_10480487 3300026088 Bacteria 1204
396 Ga0207648_10008479 3300026089 Bacteria 9946
397 Ga0207648_10009736 3300026089 Bacteria 9188
398 Ga0207648_10036649 3300026089 Bacteria 4321
399 Ga0207676_10005947 3300026095 Bacteria 8607
400 Ga0207676_10064545 3300026095 Bacteria 2912
401 Ga0207676_10067325 3300026095 Bacteria 2860
402 Ga0207674_10013420 3300026116 Bacteria 9092
403 Ga0207674_10037026 3300026116 Bacteria 5077
404 Ga0207674_10098923 3300026116 Bacteria 2900
405 Ga0207674_10221007 3300026116 Bacteria 1842
406 Ga0207674_10242196 3300026116 Bacteria 1750
407 Ga0207674_10711878 3300026116 Bacteria 969
408 Ga0207675_100017493 3300026118 Bacteria 6691
409 Ga0207675_100069363 3300026118 Bacteria 3295
410 Ga0207675_100886005 3300026118 Bacteria 908
411 Ga0207683_10004171 3300026121 Bacteria 12510
412 Ga0207683_10034448 3300026121 Bacteria 4400
413 Ga0207683_10046071 3300026121 Bacteria 3814
414 Ga0207683_10348811 3300026121 Bacteria 1358
415 Ga0207698_10015788 3300026142 Bacteria 5071
416 Ga0207698_10022489 3300026142 Bacteria 4383
417 Ga0207698_10171911 3300026142 Bacteria 1909
418 Ga0209282_1000148 3300027666 Bacteria 41213
419 Ga0209282_1000271 3300027666 Bacteria 25770
420 Ga0209282_1092749 3300027666 Bacteria 1577
421 Ga0207428_10061830 3300027907 Bacteria 2963
422 Ga0207428_10188209 3300027907 Bacteria 1557
423 Ga0268266_10195415 3300028379 Bacteria 1849
424 Ga0268265_10028549 3300028380 Bacteria 3995
425 Ga0268265_10167875 3300028380 Bacteria 1872
426 Ga0268265_10538108 3300028380 Bacteria 1107
427 Ga0268264_10032047 3300028381 Bacteria 4312
428 Ga0268264_10644293 3300028381 Bacteria 1048
429 Ga0268264_10837644 3300028381 Bacteria 921
430 Ga0316181_1140414 3300030744 Bacteria 1086
431 Ga0265332_10000014 3300031238 Bacteria 249035
432 Ga0265328_10034067 3300031239 Bacteria 1886
433 Ga0265327_10026190 3300031251 Bacteria 3383
434 Ga0307408_100025535 3300031548 Bacteria 4047
435 Ga0307408_100067122 3300031548 Bacteria 2637
436 Ga0307408_100239453 3300031548 Bacteria 1490
437 Ga0307408_100315472 3300031548 Bacteria 1315
438 Ga0307408_100504090 3300031548 Bacteria 1060
439 Ga0307408_100611555 3300031548 Bacteria 970
440 Ga0307408_100638469 3300031548 Bacteria 950
441 Ga0307508_10000540 3300031616 Bacteria 44861
442 Ga0316575_10106083 3300031665 Bacteria 1144
443 Ga0316578_10229714 3300031728 Unclassified 1115
444 Ga0307516_10002755 3300031730 Bacteria 23168
445 Ga0307405_10087738 3300031731 Bacteria 2051
446 Ga0307413_10049566 3300031824 Bacteria 2517
447 Ga0307413_10065116 3300031824 Bacteria 2268
448 Ga0307410_10046909 3300031852 Bacteria 2885
449 Ga0307406_10086285 3300031901 Bacteria 2101
450 Ga0307407_10336374 3300031903 Bacteria 1064
451 Ga0307412_10077763 3300031911 Bacteria 2283
452 Ga0307412_10128185 3300031911 Bacteria 1839
453 Ga0307412_10129338 3300031911 Bacteria 1831
454 Ga0307412_10191498 3300031911 Bacteria 1546
455 Ga0307409_100073132 3300031995 Bacteria 2733
456 Ga0307409_100261529 3300031995 Bacteria 1588
457 Ga0307416_100129803 3300032002 Bacteria 2266
458 Ga0307416_100627346 3300032002 Bacteria 1157
459 Ga0307414_10030580 3300032004 Bacteria 3520
460 Ga0307414_10089167 3300032004 Bacteria 2285
461 Ga0307411_10084373 3300032005 Bacteria 2197
462 Ga0307510_10202538 3300033180 Bacteria 1517
463 Ga0373944_0024531 3300035089 Bacteria 1768
464 Ga0373943_0240013 3300035170 Bacteria 1015
465 Ga0373946_0084044 3300035171 Bacteria 1399
466 Ga0316574_0042028 3300035398 Bacteria 2819
467 Ga0373924_0163708 3300035410 Bacteria 976
468 Ga0373927_0111346 3300035695 Bacteria 1784
469 Ga0373947_0161205 3300035725 Bacteria 1450
470 Ga0373937_0781581 3300036401 Bacteria 902
471 Ga0316584_0478966 3300036712 Unclassified 877
472 Ga0373925_0003358 3300037068 Bacteria 12416
473 Ga0373925_0005178 3300037068 Bacteria 9762
474 Ga0373925_0147075 3300037068 Bacteria 1847
475 Ga0395899_0000167 3300037312 Bacteria 100973
476 Ga0395899_0202396 3300037312 Bacteria 1384
477 Ga0395900_0000009 3300037418 Bacteria 476249
478 Ga0395900_0004085 3300037418 Bacteria 15559
479 Ga0395900_0033996 3300037418 Bacteria 5248
480 Ga0395898_0016157 3300037466 Bacteria 7644
481 Ga0395898_0527700 3300037466 Bacteria 1122
482 Ga0395905_0000954 3300037471 Bacteria 37082
483 Ga0395905_0007853 3300037471 Bacteria 10567
484 Ga0395905_0014728 3300037471 Bacteria 7456
485 Ga0395905_0109667 3300037471 Bacteria 2591
486 Ga0395905_0273363 3300037471 Bacteria 1575
487 Ga0395905_0472423 3300037471 Bacteria 1153
488 Ga0436364_1510508 3300037853 Bacteria 1335
489 Ga0395901_0000014 3300038443 Bacteria 375100
490 Ga0395901_0081149 3300038443 Bacteria 3388
491 Ga0395901_0090234 3300038443 Bacteria 3208
492 Ga0436365_0010849 3300039437 Bacteria 1025
493 Ga0436365_0045417 3300039437 Bacteria 1544
494 Ga0436365_1112386 3300039437 Bacteria 3401
495 Ga0439436_0091158 3300041404 Bacteria 849
496 Ga0439439_0021499 3300041406 Bacteria 1608
497 Ga0439447_017483 3300041407 Bacteria 1952
498 Ga0439461_0008914 3300041410 Bacteria 1810
499 Ga0439466_0013462 3300041411 Bacteria 2994
500 Ga0439465_0002620 3300041413 Bacteria 5872
501 Ga0439431_0009625 3300041997 Bacteria 2183
502 Ga0439433_0004321 3300041999 Bacteria 3061
503 Ga0439442_014798 3300042002 Bacteria 1606
504 Ga0439432_005849 3300042006 Bacteria 4413
505 Ga0439432_014181 3300042006 Bacteria 2698
506 Ga0439449_0000247 3300042007 Bacteria 19331
507 Ga0439449_0005204 3300042007 Bacteria 4991
508 Ga0439449_0017901 3300042007 Bacteria 2659
509 Ga0439452_009766 3300042010 Bacteria 2817
510 Ga0439457_017767 3300042014 Bacteria 1579
511 Ga0439462_0008533 3300042015 Bacteria 2586
512 Ga0439462_0021195 3300042015 Bacteria 1696
513 Ga0439462_0086393 3300042015 Bacteria 858
514 Ga0450920_024778 3300042122 Bacteria 1166
515 Ga0450890_002097 3300042127 Bacteria 2796
516 Ga0450896_022952 3300042133 Bacteria 921
517 Ga0450898_018504 3300042134 Bacteria 1207
518 Ga0450903_017704 3300042138 Bacteria 1112
519 Ga0439446_0038133 3300042156 Bacteria 1408
520 Ga0439434_0022567 3300042435 Bacteria 1892
521 Ga0439459_0023475 3300042438 Bacteria 1202
522 Ga0450918_001959 3300042531 Bacteria 3973
523 Ga0451577_0117470 3300042876 Bacteria 2382
524 Ga0466969_0049815 3300044656 Bacteria 2066
525 Ga0453683_0002378 3300044673 Bacteria 14700
526 Ga0466970_0294801 3300044765 Bacteria 914
527 Ga0451576_0007815 3300045051 Bacteria 12675
528 Ga0451576_0705789 3300045051 Bacteria 1060
529 Ga0466967_0080851 3300045976 Bacteria 2934
530 Ga0495617_000173 3300046452 Bacteria 40755
531 Ga0495629_0207622 3300046459 Bacteria 1353
532 Ga0495580_0000052 3300046472 Bacteria 66203
533 Ga0495580_0219698 3300046472 Bacteria 1306
534 Ga0495605_0000191 3300046474 Bacteria 76513
535 Ga0495605_0002922 3300046474 Bacteria 10362
536 Ga0495596_0000184 3300046500 Bacteria 43662
537 Ga0495607_0007490 3300046501 Bacteria 7546
538 Ga0495610_0000362 3300046512 Bacteria 47404
539 Ga0495610_0065701 3300046512 Bacteria 1711
540 Ga0495616_0004205 3300046513 Bacteria 9118
541 Ga0495632_0005145 3300046519 Bacteria 8731
542 Ga0495648_0021496 3300046524 Bacteria 4464
543 Ga0495598_0036444 3300046537 Bacteria 1413
544 Ga0495609_0007914 3300046538 Bacteria 5253
545 Ga0495621_0077057 3300046539 Bacteria 1237
546 Ga0495597_0009759 3300046542 Bacteria 4727
547 Ga0495633_0085213 3300046558 Bacteria 1470
548 Ga0495633_0137254 3300046558 Bacteria 1131
549 Ga0495656_0012345 3300046615 Bacteria 3150
550 Ga0495656_0042534 3300046615 Bacteria 1903
551 Ga0495625_0000224 3300046660 Bacteria 89521
552 Ga0495625_0033145 3300046660 Bacteria 3823
553 Ga0495659_0120422 3300046664 Bacteria 1033
554 Ga0495661_0002318 3300046665 Bacteria 14690
555 Ga0495599_0219509 3300046678 Bacteria 1164
556 Ga0495658_0098803 3300046683 Bacteria 1739
557 Ga0495669_0072193 3300046684 Bacteria 1575
558 Ga0495671_0002080 3300046692 Bacteria 12832
559 Ga0495649_0001610 3300046694 Bacteria 16823
560 Ga0495660_0014552 3300046810 Bacteria 4550
561 Ga0495581_0267370 3300047315 Bacteria 1000
562 Ga0495674_0044424 3300047319 Bacteria 3951
563 Ga0495672_0009637 3300047320 Bacteria 6970
564 Ga0495687_000196 3300047443 Bacteria 87053
565 Ga0495687_018609 3300047443 Bacteria 3431
566 Ga0495687_075566 3300047443 Bacteria 1335
567 Ga0495685_007602 3300047447 Bacteria 3584
568 Ga0495684_0114960 3300047471 Bacteria 2029
569 Ga0495686_0000966 3300047472 Bacteria 35392
570 Ga0495614_0079503 3300048089 Bacteria 1420
571 Ga0495626_0041260 3300048091 Bacteria 2175
572 Ga0496100_0161959 3300048903 Bacteria 1604
573 Ga0496100_0552865 3300048903 Bacteria 891
574 Ga0496101_0000635 3300048904 Bacteria 21296
575 Ga0496101_0471835 3300048904 Bacteria 991
576 Ga0496102_0005808 3300048905 Bacteria 10492
577 Ga0496102_0075001 3300048905 Bacteria 3109
578 Ga0496102_0300799 3300048905 Unclassified 1512
579 Ga0496103_0190326 3300048906 Bacteria 1319
580 Ga0496104_0024424 3300048907 Bacteria 5558
581 Ga0496104_0103618 3300048907 Unclassified 2726
582 Ga0496105_0013557 3300048908 Bacteria 6475
583 Ga0496106_0108055 3300048909 Unclassified 2164
584 Ga0496106_0242495 3300048909 Bacteria 1440
585 Ga0496106_0338159 3300048909 Bacteria 1209
586 Ga0496107_0015376 3300048910 Bacteria 5363
587 Ga0496107_0088700 3300048910 Bacteria 2258
588 Ga0496107_0134240 3300048910 Bacteria 1828
589 Ga0496108_0051852 3300048911 Bacteria 3437
590 Ga0496108_0193817 3300048911 Bacteria 1762
591 Ga0496108_0242938 3300048911 Bacteria 1566
592 Ga0496108_0320276 3300048911 Unclassified 1352
593 Ga0496109_0149812 3300048912 Bacteria 2184
594 Ga0496109_0284743 3300048912 Bacteria 1558
595 Ga0496109_0412295 3300048912 Bacteria 1276
596 Ga0496110_0074208 3300048913 Bacteria 3020
597 Ga0496110_0106461 3300048913 Bacteria 2516
598 Ga0496111_0018220 3300048914 Bacteria 4863
599 Ga0496111_0260751 3300048914 Bacteria 1286
600 Ga0496112_0123866 3300048915 Bacteria 2556
601 Ga0496113_0111883 3300048916 Bacteria 2126
602 Ga0496113_0187121 3300048916 Bacteria 1643
603 Ga0496114_0076605 3300048917 Bacteria 2818
604 Ga0496115_0009542 3300048918 Bacteria 7209
605 Ga0496115_0119214 3300048918 Unclassified 2170
606 Ga0496116_0002766 3300048919 Bacteria 18026
607 Ga0496116_0083250 3300048919 Bacteria 1976
608 Ga0496117_0017981 3300048920 Bacteria 5883
609 Ga0496118_0110091 3300048921 Bacteria 1831
610 Ga0496121_0002439 3300048924 Bacteria 28439
611 Ga0496121_0044718 3300048924 Bacteria 3815
612 Ga0496122_0004611 3300048925 Bacteria 16964
613 Ga0496123_0002704 3300048926 Bacteria 21311
614 Ga0496124_0139835 3300048927 Bacteria 1912
615 Ga0496125_0085219 3300048928 Bacteria 2395
616 Ga0495682_0017412 3300049460 Bacteria 2713
617 Ga0501032_0045980 3300049569 Bacteria 2951
618 Ga0501032_0111620 3300049569 Bacteria 1809
619 Ga0501033_0000165 3300049570 Bacteria 63213
620 Ga0501034_0018663 3300049571 Bacteria 7109
621 Ga0501034_0615750 3300049571 Bacteria 990
622 Ga0501036_0276376 3300049572 Bacteria 1406
623 Ga0501037_0023650 3300049573 Bacteria 4543
624 Ga0501038_0154089 3300049574 Bacteria 1872
625 Ga0501047_0069235 3300049581 Bacteria 3398
626 Ga0501068_0100682 3300049584 Bacteria 1791
627 Ga0501073_0064106 3300049589 Bacteria 2562
628 Ga0501080_0000678 3300049742 Bacteria 27197
629 Ga0501083_0219998 3300049744 Bacteria 1237
630 Ga0501035_0001055 3300049822 Bacteria 28892
631 Ga0501044_0264268 3300049823 Bacteria 1658
632 nmdc:mga03683_2500_c1 3300050489 Bacteria 5721
633 nmdc:mga03683_87072_c1 3300050489 Bacteria 1357
634 nmdc:mga03n38_38719_c1 3300050490 Bacteria 2064
635 nmdc:mga0yw44_385983_c1 3300050492 Bacteria 946
636 nmdc:mga0k408_168172_c1 3300050493 Bacteria 1307
637 nmdc:mga0k408_287262_c1 3300050493 Bacteria 982
638 nmdc:mga0k408_319333_c1 3300050493 Bacteria 927
639 nmdc:mga07m45_10347_c1 3300050496 Bacteria 4869
640 nmdc:mga07m45_5338_c1 3300050496 Bacteria 6394
641 nmdc:mga07m45_63216_c1 3300050496 Bacteria 2099
642 nmdc:mga07m45_9761_c1 3300050496 Bacteria 4992
643 nmdc:mga05p37_275394_c1 3300050507 Bacteria 2009
644 nmdc:mga09592_148270_c1 3300050508 Bacteria 2023
645 nmdc:mga0qj67_236595_c1 3300050509 Bacteria 1482
646 nmdc:mga0qj67_36735_c1 3300050509 Bacteria 3835
647 nmdc:mga06r32_267873_c1 3300050510 Bacteria 1696
648 nmdc:mga06r32_727143_c1 3300050510 Bacteria 957
649 nmdc:mga08y16_320507_c1 3300050511 Bacteria 1596
650 nmdc:mga08y16_328123_c1 3300050511 Bacteria 1575
651 nmdc:mga0n895_56020_c1 3300050512 Bacteria 3882
652 nmdc:mga0n895_595761_c1 3300050512 Bacteria 1108
653 nmdc:mga0sz30_2078_c1 3300050516 Bacteria 7150
654 Ga0495619_0105215 3300053085 Bacteria 1924
655 Ga0500608_004413 3300053122 Bacteria 5445
656 Ga0500616_0177739 3300053153 Bacteria 961
657 Ga0466962_0063115 3300061719 Bacteria 1769
658 2599444729 2599185178 Bacteria 5365746
659 2644029323 2643221603 Bacteria 6147767
660 2644158982 2643221628 Bacteria 5745828
661 2644328269 2643221658 Bacteria 6064537
662 2644362327 2643221665 Bacteria 4699229
663 2644400120 2643221672 Bacteria 6322190
664 2738881500 2738541307 Bacteria 8606193
665 2739249395 2738543013 Bacteria 5618633
666 2885195144 2885192300 Bacteria 5882526
667 2885266356 2885266251 Bacteria 4796748
668 2904453284 2904449895 Bacteria 6927402
669 2904459278 2904456579 Bacteria 6819253
670 2928059864 2928058823 Bacteria 5520022
671 2928118164 2928115317 Bacteria 6477646
672 2928517792 2928515477 Bacteria 4448421
673 2929525324 2929520902 Bacteria 6765052
674 2954771609 2954767861 Bacteria 5535784
675 Ga0068868_100052343
676 JGI24739J22299_10019621
677 JGI25156J39149_1003854
678 JGI25151J46595_10000732
679 Ga0006562J51391_1110457
680 Ga0006562J51391_1110458
681 Ga0006562J51391_1113999
682 Ga0006562J51391_1114001
683 Ga0055538_1002515
684 Ga0055533_1002572
685 Ga0055532_1000048
686 Ga0055535_1000035
687 Ga0055529_1000101
688 Ga0055526_1009224
689 Ga0055537_1000211
690 Ga0055537_1001221
691 Ga0055524_1001351
692 Ga0055536_1001127
693 Ga0055534_1000210
694 Ga0055528_1000852
695 Ga0055528_1033087
696 Ga0055530_10012071
697 Ga0055540_1000142
698 Ga0055540_1000440
699 Ga0055531_10000424
700 Ga0055531_10001478
701 Ga0065714_10002999
702 Ga0070658_10154081
703 Ga0070658_10157981
704 Ga0070676_10008256
705 Ga0070676_10035874
706 Ga0070676_10054380
707 Ga0070676_10118212
708 Ga0070683_100095147
709 Ga0070683_100423180
710 Ga0070690_100001686
711 Ga0070690_100017056
712 Ga0070670_100361184
713 Ga0070677_10025396
714 Ga0070677_10060993
715 Ga0070677_10086340
716 Ga0068869_100088813
717 Ga0068869_100135729
718 Ga0070666_10007800
719 Ga0070666_10532240
720 Ga0068868_100000814
721 Ga0068868_100030698
722 Ga0068868_100033575
723 Ga0068868_100084956
724 Ga0068868_100387269
725 Ga0070689_100007835
726 Ga0070687_100000820
727 Ga0070687_100129053
728 Ga0070661_100120983
729 Ga0070661_100526060
730 Ga0070692_10329626
731 Ga0070668_100001217
732 Ga0070668_100035227
733 Ga0070668_100511059
734 Ga0070669_100045715
735 Ga0070675_100000562
736 Ga0070675_100050345
737 Ga0070671_100004823
738 Ga0070671_100054225
739 Ga0070674_100117807
740 Ga0070673_100005821
741 Ga0070673_100033026
742 Ga0070673_100434680
743 Ga0070673_100845287
744 Ga0070659_100062096
745 Ga0070667_100017861
746 Ga0070667_100064340
747 Ga0070711_100017044
748 Ga0070711_100318674
749 Ga0070705_100265918
750 Ga0070694_100039919
751 Ga0070708_100023257
752 Ga0070708_100289792
753 Ga0070678_100010669
754 Ga0070662_100019528
755 Ga0070662_100046327
756 Ga0070662_100069781
757 Ga0070681_10693433
758 Ga0068867_100004609
759 Ga0068867_100041458
760 Ga0068867_100102432
761 Ga0070706_100002496
762 Ga0070707_100366167
763 Ga0070679_100585020
764 Ga0070684_100224165
765 Ga0068853_100033865
766 Ga0068853_100047135
767 Ga0068853_100181082
768 Ga0070672_100012578
769 Ga0070672_100045895
770 Ga0070672_100056157
771 Ga0070672_100061128
772 Ga0070695_100164525
773 Ga0070665_100364412
774 Ga0070704_100019332
775 Ga0068855_100043550
776 Ga0070664_100047384
777 Ga0070664_100364151
778 Ga0068857_100106310
779 Ga0068857_100118879
780 Ga0068857_100181224
781 Ga0068857_100478428
782 Ga0068854_100000396
783 Ga0068854_100067625
784 Ga0068854_100067736
785 Ga0068856_100044068
786 Ga0068852_100014277
787 Ga0068852_100078523
788 Ga0068852_100242421
789 Ga0068859_100045863
790 Ga0068859_100125212
791 Ga0068859_100184011
792 Ga0068864_100000666
793 Ga0068864_100070863
794 Ga0068864_100248842
795 Ga0068864_100414273
796 Ga0068861_100311637
797 Ga0068851_10027581
798 Ga0068851_10073293
799 Ga0068851_10180623
800 Ga0068870_10181875
801 Ga0068863_100000585
802 Ga0068863_100009834
803 Ga0068863_100523186
804 Ga0068858_100004762
805 Ga0068858_100007104
806 Ga0068860_100002804
807 Ga0068860_100150781
808 Ga0068860_100681797
809 Ga0068862_100030063
810 Ga0068862_100057153
811 Ga0068862_100153122
812 Ga0081540_1001565
813 Ga0075365_10012156
814 Ga0075365_10037769
815 Ga0075365_10282573
816 Ga0075363_100236535
817 Ga0075432_10015003
818 Ga0075362_10000626
819 Ga0075362_10020852
820 Ga0075362_10037317
821 Ga0075367_10251727
822 Ga0075369_10017548
823 Ga0075366_10005412
824 Ga0075366_10158104
825 Ga0097621_100018619
826 Ga0075370_10001410
827 Ga0075370_10003126
828 Ga0075370_10003497
829 Ga0075370_10049456
830 Ga0068871_100115888
831 Ga0068871_100156753
832 Ga0068871_100335788
833 Ga0068871_100433289
834 Ga0075428_100204783
835 Ga0075430_100062615
836 Ga0075430_100098468
837 Ga0075430_100139949
838 Ga0075430_100296315
839 Ga0075430_100756689
840 Ga0075431_100005375
841 Ga0075431_100127842
842 Ga0075433_10367920
843 Ga0075433_10633349
844 Ga0075434_100112835
845 Ga0075434_100247469
846 Ga0075434_100972424
847 Ga0075429_100097936
848 Ga0068865_100006103
849 Ga0068865_100077319
850 Ga0068865_100170487
851 Ga0068865_100228416
852 Ga0097620_100045862
853 Ga0097620_100125211
854 Ga0097620_100158505
855 Ga0097620_100184001
856 Ga0099826_10000019
857 Ga0099826_10000124
858 Ga0099826_10111361
859 Ga0105244_10003295
860 Ga0105244_10102435
861 Ga0105250_10030527
862 Ga0105240_10190147
863 Ga0105240_10310580
864 Ga0105240_10440467
865 Ga0105240_10919149
866 Ga0111539_10203014
867 Ga0105245_10155162
868 Ga0105245_10183341
869 Ga0105245_10266984
870 Ga0114129_10286641
871 Ga0105243_10003586
872 Ga0105243_10063029
873 Ga0105243_10189747
874 Ga0105243_10491158
875 Ga0105243_10628500
876 Ga0105241_10147033
877 Ga0105241_10230179
878 Ga0105242_10058464
879 Ga0105242_10402952
880 Ga0105248_10056296
881 Ga0105248_10106475
882 Ga0105248_10130470
883 Ga0105238_10050991
884 Ga0105238_10169153
885 Ga0105238_10173478
886 Ga0105238_10204266
887 Ga0105249_10018226
888 Ga0105249_10029758
889 Ga0105249_10039617
890 Ga0105239_10053753
891 Ga0105239_10296013
892 Ga0105239_10425490
893 Ga0105246_10076816
894 Ga0105246_10672405
895 Ga0157373_10008499
896 Ga0157373_10010780
897 Ga0157373_10067909
898 Ga0157371_10002198
899 Ga0157369_10004358
900 Ga0157369_10022415
901 Ga0157369_10216882
902 Ga0157374_10100543
903 Ga0157374_10126901
904 Ga0157378_10144762
905 Ga0163162_10005819
906 Ga0163162_10059527
907 Ga0163162_10100125
908 Ga0163162_10121194
909 Ga0163162_10138801
910 Ga0163162_10850727
911 Ga0157372_10029194
912 Ga0157372_10166503
913 Ga0157375_10007620
914 Ga0157375_10025238
915 Ga0157375_10208598
916 Ga0163163_10006619
917 Ga0157380_10581210
918 Ga0157380_10851981
919 Ga0182008_10000669
920 Ga0182008_10011327
921 Ga0182008_10011982
922 Ga0157377_10139293
923 Ga0157379_10003595
924 Ga0157379_10046697
925 Ga0157379_10082433
926 Ga0157376_10006041
927 Ga0157376_10092389
928 Ga0182006_1003951
929 Ga0182006_1006971
930 Ga0182006_1009607
931 Ga0182006_1016779
932 Ga0182007_10003759
933 Ga0182007_10015387
934 Ga0163161_10005078
935 Ga0163161_10056146
936 Ga0206351_10377698
937 Ga0213876_10024079
938 Ga0213876_10126376
939 Ga0209784_101654
940 Ga0209566_103076
941 Ga0209674_103712
942 Ga0209672_100127
943 Ga0209147_100008
944 Ga0209563_102375
945 Ga0209563_105100
946 Ga0209258_100013
947 Ga0209148_1015709
948 Ga0209759_1001412
949 Ga0209759_1004529
950 Ga0209565_1000039
951 Ga0209565_1000077
952 Ga0209455_1000042
953 Ga0209673_1000146
954 Ga0209673_1024153
955 Ga0209675_1000030
956 Ga0209675_1002647
957 Ga0209676_1000152
958 Ga0209676_1013324
959 Ga0209025_1000231
960 Ga0209564_1000080
961 Ga0209564_1000274
962 Ga0209564_1031142
963 Ga0209758_1042613
964 Ga0209050_1000210
965 Ga0209256_1000119
966 Ga0209051_1000025
967 Ga0209051_1000074
968 Ga0209051_1000161
969 Ga0209257_1000039
970 Ga0209257_1000072
971 Ga0207697_10024529
972 Ga0207697_10036058
973 Ga0207655_1001284
974 Ga0207655_1015387
975 Ga0207655_1015752
976 Ga0207642_10019186
977 Ga0207688_10029592
978 Ga0207645_10002245
979 Ga0207645_10043273
980 Ga0207645_10047006
981 Ga0207645_10053872
982 Ga0207645_10087978
983 Ga0207643_10036455
984 Ga0207643_10427526
985 Ga0207705_10110955
986 Ga0207705_10272171
987 Ga0207684_10019594
988 Ga0207654_10188462
989 Ga0207695_10000739
990 Ga0207695_10366422
991 Ga0207663_10009233
992 Ga0207662_10001818
993 Ga0207662_10067399
994 Ga0207657_10041050
995 Ga0207649_10078094
996 Ga0207646_10133980
997 Ga0207681_10131700
998 Ga0207681_10185837
999 Ga0207694_10116619
1000 Ga0207650_10000856
1001 Ga0207650_10043175
1002 Ga0207650_10302337
1003 Ga0207650_10532929
1004 Ga0207659_10001396
1005 Ga0207659_10094953
1006 Ga0207659_10117768
1007 Ga0207659_10484234
1008 Ga0207687_10125912
1009 Ga0207687_10728662
1010 Ga0207644_10018092
1011 Ga0207644_10030603
1012 Ga0207644_10086595
1013 Ga0207644_10209862
1014 Ga0207644_10257453
1015 Ga0207690_10052886
1016 Ga0207690_10152525
1017 Ga0207706_10006621
1018 Ga0207706_10079459
1019 Ga0207706_10102599
1020 Ga0207706_10157950
1021 Ga0207686_10008279
1022 Ga0207709_10003293
1023 Ga0207709_10127833
1024 Ga0207709_10154628
1025 Ga0207709_10491146
1026 Ga0207670_10011864
1027 Ga0207669_10042458
1028 Ga0207704_10011710
1029 Ga0207704_10608494
1030 Ga0207665_10169566
1031 Ga0207691_10042905
1032 Ga0207691_10110267
1033 Ga0207691_10133300
1034 Ga0207691_10156980
1035 Ga0207711_10040669
1036 Ga0207711_10073327
1037 Ga0207689_10001177
1038 Ga0207689_10005845
1039 Ga0207661_11040760
1040 Ga0207679_10007872
1041 Ga0207679_10351562
1042 Ga0207667_10123620
1043 Ga0207651_10009043
1044 Ga0207651_10024787
1045 Ga0207651_10064944
1046 Ga0207651_10205883
1047 Ga0207651_10256796
1048 Ga0207712_10676406
1049 Ga0207668_10011422
1050 Ga0207640_10000058
1051 Ga0207640_10038517
1052 Ga0207658_10005206
1053 Ga0207658_10005491
1054 Ga0207658_10093633
1055 Ga0207677_10001603
1056 Ga0207677_10014282
1057 Ga0207677_10115678
1058 Ga0207703_10001832
1059 Ga0207703_10007388
1060 Ga0207639_10036440
1061 Ga0207639_10113223
1062 Ga0207639_10142888
1063 Ga0207678_10013824
1064 Ga0207678_10135116
1065 Ga0207708_10009773
1066 Ga0207641_10004752
1067 Ga0207641_10007502
1068 Ga0207641_10054157
1069 Ga0207641_10480487
1070 Ga0207648_10008479
1071 Ga0207648_10009736
1072 Ga0207648_10036649
1073 Ga0207676_10005947
1074 Ga0207676_10064545
1075 Ga0207676_10067325
1076 Ga0207674_10013420
1077 Ga0207674_10037026
1078 Ga0207674_10098923
1079 Ga0207674_10221007
1080 Ga0207674_10242196
1081 Ga0207674_10711878
1082 Ga0207675_100017493
1083 Ga0207675_100069363
1084 Ga0207675_100886005
1085 Ga0207683_10004171
1086 Ga0207683_10034448
1087 Ga0207683_10046071
1088 Ga0207683_10348811
1089 Ga0207698_10015788
1090 Ga0207698_10022489
1091 Ga0207698_10171911
1092 Ga0209282_1000148
1093 Ga0209282_1000271
1094 Ga0209282_1092749
1095 Ga0207428_10061830
1096 Ga0207428_10188209
1097 Ga0268266_10195415
1098 Ga0268265_10028549
1099 Ga0268265_10167875
1100 Ga0268265_10538108
1101 Ga0268264_10032047
1102 Ga0268264_10644293
1103 Ga0268264_10837644
1104 Ga0316181_1140414
1105 Ga0265332_10000014
1106 Ga0265328_10034067
1107 Ga0265327_10026190
1108 Ga0307408_100025535
1109 Ga0307408_100067122
1110 Ga0307408_100239453
1111 Ga0307408_100315472
1112 Ga0307408_100504090
1113 Ga0307408_100611555
1114 Ga0307408_100638469
1115 Ga0307508_10000540
1116 Ga0316575_10106083
1117 Ga0316578_10229714
1118 Ga0307516_10002755
1119 Ga0307405_10087738
1120 Ga0307413_10049566
1121 Ga0307413_10065116
1122 Ga0307410_10046909
1123 Ga0307406_10086285
1124 Ga0307407_10336374
1125 Ga0307412_10077763
1126 Ga0307412_10128185
1127 Ga0307412_10129338
1128 Ga0307412_10191498
1129 Ga0307409_100073132
1130 Ga0307409_100261529
1131 Ga0307416_100129803
1132 Ga0307416_100627346
1133 Ga0307414_10030580
1134 Ga0307414_10089167
1135 Ga0307411_10084373
1136 Ga0307510_10202538
1137 Ga0373944_0024531
1138 Ga0373943_0240013
1139 Ga0373946_0084044
1140 Ga0316574_0042028
1141 Ga0373924_0163708
1142 Ga0373927_0111346
1143 Ga0373947_0161205
1144 Ga0373937_0781581
1145 Ga0316584_0478966
1146 Ga0373925_0003358
1147 Ga0373925_0005178
1148 Ga0373925_0147075
1149 Ga0395899_0000167
1150 Ga0395899_0202396
1151 Ga0395900_0000009
1152 Ga0395900_0004085
1153 Ga0395900_0033996
1154 Ga0395898_0016157
1155 Ga0395898_0527700
1156 Ga0395905_0000954
1157 Ga0395905_0007853
1158 Ga0395905_0014728
1159 Ga0395905_0109667
1160 Ga0395905_0273363
1161 Ga0395905_0472423
1162 Ga0436364_1510508
1163 Ga0395901_0000014
1164 Ga0395901_0081149
1165 Ga0395901_0090234
1166 Ga0436365_0010849
1167 Ga0436365_0045417
1168 Ga0436365_1112386
1169 Ga0439436_0091158
1170 Ga0439439_0021499
1171 Ga0439447_017483
1172 Ga0439461_0008914
1173 Ga0439466_0013462
1174 Ga0439465_0002620
1175 Ga0439431_0009625
1176 Ga0439433_0004321
1177 Ga0439442_014798
1178 Ga0439432_005849
1179 Ga0439432_014181
1180 Ga0439449_0000247
1181 Ga0439449_0005204
1182 Ga0439449_0017901
1183 Ga0439452_009766
1184 Ga0439457_017767
1185 Ga0439462_0008533
1186 Ga0439462_0021195
1187 Ga0439462_0086393
1188 Ga0450920_024778
1189 Ga0450890_002097
1190 Ga0450896_022952
1191 Ga0450898_018504
1192 Ga0450903_017704
1193 Ga0439446_0038133
1194 Ga0439434_0022567
1195 Ga0439459_0023475
1196 Ga0450918_001959
1197 Ga0451577_0117470
1198 Ga0466969_0049815
1199 Ga0453683_0002378
1200 Ga0466970_0294801
1201 Ga0451576_0007815
1202 Ga0451576_0705789
1203 Ga0466967_0080851
1204 Ga0495617_000173
1205 Ga0495629_0207622
1206 Ga0495580_0000052
1207 Ga0495580_0219698
1208 Ga0495605_0000191
1209 Ga0495605_0002922
1210 Ga0495596_0000184
1211 Ga0495607_0007490
1212 Ga0495610_0000362
1213 Ga0495610_0065701
1214 Ga0495616_0004205
1215 Ga0495632_0005145
1216 Ga0495648_0021496
1217 Ga0495598_0036444
1218 Ga0495609_0007914
1219 Ga0495621_0077057
1220 Ga0495597_0009759
1221 Ga0495633_0085213
1222 Ga0495633_0137254
1223 Ga0495656_0012345
1224 Ga0495656_0042534
1225 Ga0495625_0000224
1226 Ga0495625_0033145
1227 Ga0495659_0120422
1228 Ga0495661_0002318
1229 Ga0495599_0219509
1230 Ga0495658_0098803
1231 Ga0495669_0072193
1232 Ga0495671_0002080
1233 Ga0495649_0001610
1234 Ga0495660_0014552
1235 Ga0495581_0267370
1236 Ga0495674_0044424
1237 Ga0495672_0009637
1238 Ga0495687_000196
1239 Ga0495687_018609
1240 Ga0495687_075566
1241 Ga0495685_007602
1242 Ga0495684_0114960
1243 Ga0495686_0000966
1244 Ga0495614_0079503
1245 Ga0495626_0041260
1246 Ga0496100_0161959
1247 Ga0496100_0552865
1248 Ga0496101_0000635
1249 Ga0496101_0471835
1250 Ga0496102_0005808
1251 Ga0496102_0075001
1252 Ga0496102_0300799
1253 Ga0496103_0190326
1254 Ga0496104_0024424
1255 Ga0496104_0103618
1256 Ga0496105_0013557
1257 Ga0496106_0108055
1258 Ga0496106_0242495
1259 Ga0496106_0338159
1260 Ga0496107_0015376
1261 Ga0496107_0088700
1262 Ga0496107_0134240
1263 Ga0496108_0051852
1264 Ga0496108_0193817
1265 Ga0496108_0242938
1266 Ga0496108_0320276
1267 Ga0496109_0149812
1268 Ga0496109_0284743
1269 Ga0496109_0412295
1270 Ga0496110_0074208
1271 Ga0496110_0106461
1272 Ga0496111_0018220
1273 Ga0496111_0260751
1274 Ga0496112_0123866
1275 Ga0496113_0111883
1276 Ga0496113_0187121
1277 Ga0496114_0076605
1278 Ga0496115_0009542
1279 Ga0496115_0119214
1280 Ga0496116_0002766
1281 Ga0496116_0083250
1282 Ga0496117_0017981
1283 Ga0496118_0110091
1284 Ga0496121_0002439
1285 Ga0496121_0044718
1286 Ga0496122_0004611
1287 Ga0496123_0002704
1288 Ga0496124_0139835
1289 Ga0496125_0085219
1290 Ga0495682_0017412
1291 Ga0501032_0045980
1292 Ga0501032_0111620
1293 Ga0501033_0000165
1294 Ga0501034_0018663
1295 Ga0501034_0615750
1296 Ga0501036_0276376
1297 Ga0501037_0023650
1298 Ga0501038_0154089
1299 Ga0501047_0069235
1300 Ga0501068_0100682
1301 Ga0501073_0064106
1302 Ga0501080_0000678
1303 Ga0501083_0219998
1304 Ga0501035_0001055
1305 Ga0501044_0264268
1306 nmdc:mga03683_2500_c1
1307 nmdc:mga03683_87072_c1
1308 nmdc:mga03n38_38719_c1
1309 nmdc:mga0yw44_385983_c1
1310 nmdc:mga0k408_168172_c1
1311 nmdc:mga0k408_287262_c1
1312 nmdc:mga0k408_319333_c1
1313 nmdc:mga07m45_10347_c1
1314 nmdc:mga07m45_5338_c1
1315 nmdc:mga07m45_63216_c1
1316 nmdc:mga07m45_9761_c1
1317 nmdc:mga05p37_275394_c1
1318 nmdc:mga09592_148270_c1
1319 nmdc:mga0qj67_236595_c1
1320 nmdc:mga0qj67_36735_c1
1321 nmdc:mga06r32_267873_c1
1322 nmdc:mga06r32_727143_c1
1323 nmdc:mga08y16_320507_c1
1324 nmdc:mga08y16_328123_c1
1325 nmdc:mga0n895_56020_c1
1326 nmdc:mga0n895_595761_c1
1327 nmdc:mga0sz30_2078_c1
1328 Ga0495619_0105215
1329 Ga0500608_004413
1330 Ga0500616_0177739
1331 Ga0466962_0063115
1332 2599444729
1333 2644029323
1334 2644158982
1335 2644328269
1336 2644362327
1337 2644400120
1338 2738881500
1339 2739249395
1340 2885195144
1341 2885266356
1342 2904453284
1343 2904459278
1344 2928059864
1345 2928118164
1346 2928517792
1347 2929525324
1348 2954771609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

10

208

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

16

225

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h7a-assembly1.cif.gz_D crystal structure of short-chain dehydrogenase from rhodopseudomonas palustris 0.9494 6 242
3h7a-assembly1.cif.gz_D crystal structure of short-chain dehydrogenase from rhodopseudomonas palustris 0.945 6 242
1gz6-assembly1.cif.gz_B (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9285 10 221
3tfo-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9186 10 241
3rkr-assembly1.cif.gz_A-2 crystal structure of a metagenomic short-chain oxidoreductase (sdr) in complex with nadp 0.9127 7 244
ID Description Score Start End Superfamily
3h7aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9449 6 242 3.40.50.720
3h7aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9406 6 242 3.40.50.720
af_Q54Q52_3_240_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9163 10 246 3.40.50.720
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9131 10 186 3.40.50.720
3rkrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9127 7 244 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0S8B7B9-F1-model_v4 Glucose 1-dehydrogenase 0.9747 25 246
AF-A0A7V7WY37-F1-model_v4 SDR family oxidoreductase 0.9743 9 246
AF-Q1LFL2-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9722 7 246
AF-V2IPS4-F1-model_v4 Short-chain dehydrogenase 0.9713 5 246
AF-A0A2R6XL40-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9701 9 246

Map