F474367

General Info

Members Datasets Scaffolds Average Seq Length
674 303 1348 200

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10004061|Ga0213874_100040611
Length 227
Sequence MTCGXXXAPRVQRRARAEAARMFTGIVQDVGRVLSFEERGGDARLTVGCARLDLSTLRAGDSVCVQGCCLTALEIAASAFAADLSRETLALTTLGELRAGAAVNLEPALRAGDALGGHLVSGHIDGVAVIAEVHADARSLRLTIETPAGLARYLAPKGSVAVDGVSLTINEVSGASFGVNIIPHTQTNTTLGGLAAGARVNLEVDQLARYVYRLMLPYIGFQSGGQN

Samples

Sample ID Description Type Environment
1 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
172 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
173 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
215 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
216 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
217 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
218 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
221 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
284 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
297 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
298 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
299 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
300 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
303 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 4.6
Rhizosphere 88.72
Stem 0
Stem Tuber 0
Unclassified 8.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213874_10004061 3300021377 Bacteria 3304
2 JGI25406J46586_10010232 3300003203 Bacteria 4168
3 rootL2_10093429 3300003322 Bacteria 1200
4 rootL2_10117227 3300003322 Unclassified 2225
5 rootH1_10143352 3300003323 Bacteria 1331
6 rootH1_10152696 3300003323 Bacteria 2244
7 Ga0070676_10218496 3300005328 Bacteria 1258
8 Ga0070683_100018632 3300005329 Bacteria 6152
9 Ga0070683_100111258 3300005329 Bacteria 2584
10 Ga0070690_100001646 3300005330 Bacteria 11751
11 Ga0070690_100010352 3300005330 Bacteria 5424
12 Ga0070690_100158084 3300005330 Bacteria 1551
13 Ga0070677_10006099 3300005333 Bacteria 3998
14 Ga0068869_100056472 3300005334 Bacteria 2863
15 Ga0068869_100869647 3300005334 Bacteria 778
16 Ga0070666_10003170 3300005335 Bacteria 9995
17 Ga0070666_10067333 3300005335 Bacteria 2431
18 Ga0070666_10195265 3300005335 Bacteria 1423
19 Ga0070680_100005445 3300005336 Bacteria 9631
20 Ga0070680_100016414 3300005336 Bacteria 5828
21 Ga0070680_100120282 3300005336 Bacteria 2192
22 Ga0070680_100183356 3300005336 Unclassified 1763
23 Ga0070680_100703821 3300005336 Bacteria 869
24 Ga0070682_100014192 3300005337 Bacteria 4601
25 Ga0070682_100016525 3300005337 Bacteria 4292
26 Ga0070682_100075178 3300005337 Bacteria 2172
27 Ga0070682_100098155 3300005337 Bacteria 1929
28 Ga0070682_100161506 3300005337 Bacteria 1548
29 Ga0068868_100005559 3300005338 Bacteria 8864
30 Ga0070660_100428152 3300005339 Bacteria 1096
31 Ga0070689_100012028 3300005340 Bacteria 6221
32 Ga0070689_100475274 3300005340 Unclassified 1067
33 Ga0070691_10028848 3300005341 Bacteria 2595
34 Ga0070691_10292894 3300005341 Bacteria 887
35 Ga0070687_100014699 3300005343 Bacteria 3522
36 Ga0070687_100052163 3300005343 Bacteria 2122
37 Ga0070661_100392602 3300005344 Bacteria 1096
38 Ga0070692_10226659 3300005345 Bacteria 1107
39 Ga0070668_100763552 3300005347 Bacteria 857
40 Ga0070669_100026977 3300005353 Bacteria 4134
41 Ga0070669_100073452 3300005353 Bacteria 2533
42 Ga0070669_100241728 3300005353 Bacteria 1434
43 Ga0070675_100022988 3300005354 Bacteria 4981
44 Ga0070675_100031891 3300005354 Bacteria 4262
45 Ga0070675_100473246 3300005354 Bacteria 1126
46 Ga0070671_100000873 3300005355 Bacteria 22083
47 Ga0070671_100291011 3300005355 Bacteria 1390
48 Ga0070671_100870989 3300005355 Unclassified 786
49 Ga0070674_100142274 3300005356 Bacteria 1801
50 Ga0070674_100432383 3300005356 Bacteria 1083
51 Ga0070673_100036914 3300005364 Bacteria 3719
52 Ga0070688_100627045 3300005365 Bacteria 826
53 Ga0070667_100022817 3300005367 Bacteria 5189
54 Ga0070667_100144494 3300005367 Bacteria 2085
55 Ga0070667_100298351 3300005367 Unclassified 1451
56 Ga0070667_100656944 3300005367 Bacteria 968
57 Ga0070667_100983061 3300005367 Unclassified 787
58 Ga0070709_10000870 3300005434 Bacteria 16902
59 Ga0070709_10003561 3300005434 Bacteria 8364
60 Ga0070709_10142781 3300005434 Bacteria 1646
61 Ga0070714_100000478 3300005435 Bacteria 28985
62 Ga0070714_100040546 3300005435 Bacteria 3924
63 Ga0070714_100053243 3300005435 Bacteria 3454
64 Ga0070714_100113171 3300005435 Bacteria 2406
65 Ga0070713_100001001 3300005436 Bacteria 18082
66 Ga0070713_100042941 3300005436 Bacteria 3693
67 Ga0070713_100505071 3300005436 Bacteria 1141
68 Ga0070713_100737098 3300005436 Unclassified 942
69 Ga0070713_100797817 3300005436 Bacteria 905
70 Ga0070710_10002459 3300005437 Bacteria 8775
71 Ga0070710_10347238 3300005437 Bacteria 981
72 Ga0070701_10000698 3300005438 Bacteria 11877
73 Ga0070711_100039447 3300005439 Bacteria 3181
74 Ga0070711_100086562 3300005439 Bacteria 2247
75 Ga0070705_100028109 3300005440 Bacteria 3077
76 Ga0070705_100103329 3300005440 Bacteria 1804
77 Ga0070700_100044257 3300005441 Bacteria 2741
78 Ga0070700_100313145 3300005441 Bacteria 1150
79 Ga0070694_100149944 3300005444 Bacteria 1702
80 Ga0070694_100332229 3300005444 Bacteria 1173
81 Ga0070694_100664513 3300005444 Bacteria 844
82 Ga0070663_100217908 3300005455 Bacteria 1497
83 Ga0070678_100004992 3300005456 Bacteria 7603
84 Ga0070678_100081036 3300005456 Bacteria 2459
85 Ga0070662_100309368 3300005457 Bacteria 1286
86 Ga0070681_10001671 3300005458 Bacteria 19798
87 Ga0070681_10006781 3300005458 Bacteria 11150
88 Ga0070681_10016465 3300005458 Bacteria 7382
89 Ga0070681_10065613 3300005458 Bacteria 3598
90 Ga0070681_10472275 3300005458 Bacteria 1167
91 Ga0068867_100183561 3300005459 Bacteria 1665
92 Ga0068867_100190015 3300005459 Bacteria 1638
93 Ga0070685_10247688 3300005466 Bacteria 1179
94 Ga0070685_10306079 3300005466 Bacteria 1073
95 Ga0070685_10396260 3300005466 Bacteria 955
96 Ga0070707_100197944 3300005468 Bacteria 1959
97 Ga0070698_100116942 3300005471 Bacteria 2629
98 Ga0070699_100172336 3300005518 Bacteria 1918
99 Ga0070679_100012984 3300005530 Bacteria 7978
100 Ga0070679_100038855 3300005530 Bacteria 4732
101 Ga0070679_100067660 3300005530 Unclassified 3562
102 Ga0070679_100125756 3300005530 Bacteria 2546
103 Ga0070679_100531434 3300005530 Unclassified 1120
104 Ga0070684_100029288 3300005535 Bacteria 4664
105 Ga0070684_100111609 3300005535 Unclassified 2452
106 Ga0068853_100324807 3300005539 Bacteria 1427
107 Ga0068853_100731634 3300005539 Bacteria 945
108 Ga0070672_100022182 3300005543 Bacteria 4658
109 Ga0070672_100054080 3300005543 Bacteria 3142
110 Ga0070672_100296362 3300005543 Bacteria 1370
111 Ga0070686_100037446 3300005544 Bacteria 3009
112 Ga0070686_100092935 3300005544 Bacteria 2021
113 Ga0070686_100204584 3300005544 Bacteria 1417
114 Ga0070695_100001482 3300005545 Bacteria 13034
115 Ga0070695_100148836 3300005545 Bacteria 1632
116 Ga0070695_100432852 3300005545 Bacteria 1004
117 Ga0070695_100784411 3300005545 Bacteria 762
118 Ga0070693_100048794 3300005547 Bacteria 2412
119 Ga0070665_100000547 3300005548 Bacteria 52634
120 Ga0070665_100000769 3300005548 Bacteria 42290
121 Ga0070665_100009866 3300005548 Bacteria 9653
122 Ga0070665_100022514 3300005548 Bacteria 6342
123 Ga0070665_100023013 3300005548 Bacteria 6274
124 Ga0070665_100029181 3300005548 Bacteria 5551
125 Ga0070665_100289769 3300005548 Bacteria 1639
126 Ga0070665_100440966 3300005548 Bacteria 1311
127 Ga0070665_100954540 3300005548 Unclassified 870
128 Ga0070704_100366250 3300005549 Bacteria 1221
129 Ga0068855_100003826 3300005563 Bacteria 18404
130 Ga0068855_100015568 3300005563 Bacteria 9156
131 Ga0068855_100283698 3300005563 Bacteria 1838
132 Ga0068855_100988642 3300005563 Unclassified 885
133 Ga0070664_100047554 3300005564 Bacteria 3624
134 Ga0070664_100125105 3300005564 Bacteria 2254
135 Ga0070664_100278778 3300005564 Bacteria 1507
136 Ga0070664_100593110 3300005564 Bacteria 1027
137 Ga0068857_100235927 3300005577 Bacteria 1673
138 Ga0068856_100128983 3300005614 Bacteria 2533
139 Ga0068856_100360839 3300005614 Bacteria 1472
140 Ga0068856_100439773 3300005614 Bacteria 1324
141 Ga0070702_100028497 3300005615 Bacteria 3027
142 Ga0068852_100183688 3300005616 Bacteria 1968
143 Ga0068852_101118146 3300005616 Bacteria 808
144 Ga0068859_100000172 3300005617 Bacteria 62990
145 Ga0068859_100203834 3300005617 Bacteria 2063
146 Ga0068859_100207967 3300005617 Bacteria 2043
147 Ga0068859_100336017 3300005617 Bacteria 1605
148 Ga0068859_100485050 3300005617 Bacteria 1331
149 Ga0068859_100957477 3300005617 Bacteria 939
150 Ga0068859_101069765 3300005617 Bacteria 887
151 Ga0068864_100150218 3300005618 Bacteria 2109
152 Ga0068866_10050134 3300005718 Bacteria 2119
153 Ga0068861_100000511 3300005719 Bacteria 22624
154 Ga0068861_100019498 3300005719 Bacteria 4844
155 Ga0068861_100088841 3300005719 Bacteria 2435
156 Ga0068861_100831849 3300005719 Bacteria 869
157 Ga0068870_10020676 3300005840 Bacteria 3209
158 Ga0068863_100006736 3300005841 Bacteria 11264
159 Ga0068863_100020143 3300005841 Bacteria 6381
160 Ga0068863_100075414 3300005841 Bacteria 3191
161 Ga0068863_100075945 3300005841 Bacteria 3179
162 Ga0068863_100113825 3300005841 Bacteria 2577
163 Ga0068863_100143734 3300005841 Bacteria 2281
164 Ga0068863_100321341 3300005841 Unclassified 1503
165 Ga0068863_100823141 3300005841 Bacteria 926
166 Ga0068858_100000406 3300005842 Bacteria 44839
167 Ga0068858_100001307 3300005842 Bacteria 25727
168 Ga0068858_100016141 3300005842 Bacteria 7016
169 Ga0068858_100505115 3300005842 Bacteria 1168
170 Ga0068858_100659131 3300005842 Unclassified 1017
171 Ga0068858_100754022 3300005842 Bacteria 949
172 Ga0068860_100002651 3300005843 Bacteria 18622
173 Ga0068860_100022300 3300005843 Bacteria 6128
174 Ga0068860_100045049 3300005843 Bacteria 4205
175 Ga0068860_100994509 3300005843 Bacteria 856
176 Ga0068862_100003372 3300005844 Bacteria 13774
177 Ga0068862_100022799 3300005844 Bacteria 5239
178 Ga0068862_100810571 3300005844 Bacteria 915
179 Ga0081539_10000058 3300005985 Bacteria 256212
180 Ga0070717_10001908 3300006028 Bacteria 14579
181 Ga0070715_10000414 3300006163 Bacteria 10881
182 Ga0070715_10394414 3300006163 Bacteria 767
183 Ga0070716_100019605 3300006173 Bacteria 3537
184 Ga0070716_100096648 3300006173 Bacteria 1801
185 Ga0070716_100246634 3300006173 Bacteria 1214
186 Ga0070712_100000490 3300006175 Bacteria 22572
187 Ga0070712_100140730 3300006175 Bacteria 1841
188 Ga0070712_100300427 3300006175 Bacteria 1299
189 Ga0070712_100389398 3300006175 Bacteria 1149
190 Ga0097621_100067912 3300006237 Bacteria 2939
191 Ga0097621_100080082 3300006237 Bacteria 2716
192 Ga0097621_100171009 3300006237 Bacteria 1873
193 Ga0097621_100261434 3300006237 Bacteria 1518
194 Ga0068871_100021654 3300006358 Bacteria 4945
195 Ga0068871_100048552 3300006358 Bacteria 3427
196 Ga0068871_100063883 3300006358 Bacteria 3012
197 Ga0068871_100633829 3300006358 Bacteria 974
198 Ga0075434_101179514 3300006871 Bacteria 778
199 Ga0075429_100313229 3300006880 Bacteria 1374
200 Ga0068865_100066658 3300006881 Bacteria 2540
201 Ga0068865_100072830 3300006881 Bacteria 2441
202 Ga0097620_100000172 3300006931 Bacteria 62990
203 Ga0097620_100203825 3300006931 Bacteria 2063
204 Ga0097620_100207959 3300006931 Bacteria 2043
205 Ga0097620_100336050 3300006931 Bacteria 1605
206 Ga0097620_100485057 3300006931 Bacteria 1331
207 Ga0097620_100957579 3300006931 Bacteria 939
208 Ga0097620_101069837 3300006931 Bacteria 887
209 Ga0099794_10004535 3300007265 Bacteria 5471
210 Ga0099795_10000352 3300007788 Bacteria 8284
211 Ga0099795_10104838 3300007788 Bacteria 1114
212 Ga0105250_10049709 3300009092 Bacteria 1682
213 Ga0105240_10010673 3300009093 Bacteria 12889
214 Ga0105240_10024341 3300009093 Bacteria 7984
215 Ga0105240_10025637 3300009093 Bacteria 7743
216 Ga0105240_10029232 3300009093 Bacteria 7185
217 Ga0105240_10090321 3300009093 Bacteria 3744
218 Ga0105240_10111504 3300009093 Bacteria 3309
219 Ga0105240_10147787 3300009093 Bacteria 2802
220 Ga0105240_10226685 3300009093 Bacteria 2174
221 Ga0105240_10595805 3300009093 Unclassified 1217
222 Ga0105240_11146802 3300009093 Bacteria 825
223 Ga0111539_10849992 3300009094 Bacteria 1062
224 Ga0111539_11092132 3300009094 Bacteria 927
225 Ga0105247_10005156 3300009101 Bacteria 8265
226 Ga0105247_10015239 3300009101 Bacteria 4609
227 Ga0105247_10017608 3300009101 Bacteria 4286
228 Ga0105247_10255131 3300009101 Unclassified 1200
229 Ga0114129_10863414 3300009147 Bacteria 1149
230 Ga0105243_10125935 3300009148 Bacteria 2167
231 Ga0105241_10340546 3300009174 Bacteria 1299
232 Ga0105241_10768991 3300009174 Bacteria 885
233 Ga0105242_10003896 3300009176 Bacteria 11598
234 Ga0105242_10026316 3300009176 Bacteria 4610
235 Ga0105248_10115834 3300009177 Bacteria 3023
236 Ga0105237_10032781 3300009545 Bacteria 5260
237 Ga0105237_10033972 3300009545 Bacteria 5167
238 Ga0105237_10037539 3300009545 Bacteria 4896
239 Ga0105237_10054425 3300009545 Unclassified 4009
240 Ga0105237_10055849 3300009545 Bacteria 3954
241 Ga0105237_10065743 3300009545 Bacteria 3621
242 Ga0105237_10089652 3300009545 Bacteria 3064
243 Ga0105237_10282461 3300009545 Bacteria 1663
244 Ga0105237_10488779 3300009545 Unclassified 1237
245 Ga0105237_10580821 3300009545 Unclassified 1127
246 Ga0105237_10693016 3300009545 Unclassified 1025
247 Ga0105238_10007151 3300009551 Bacteria 11164
248 Ga0105238_10016966 3300009551 Bacteria 7390
249 Ga0105238_10025105 3300009551 Bacteria 6074
250 Ga0105238_10174622 3300009551 Unclassified 2125
251 Ga0105238_10295841 3300009551 Bacteria 1602
252 Ga0105238_11056969 3300009551 Bacteria 834
253 Ga0105249_10049355 3300009553 Bacteria 3838
254 Ga0105249_10121839 3300009553 Bacteria 2479
255 Ga0105249_11337076 3300009553 Bacteria 788
256 Ga0099796_10000247 3300010159 Bacteria 8556
257 Ga0099796_10010697 3300010159 Bacteria 2532
258 Ga0099796_10099020 3300010159 Unclassified 1094
259 Ga0105239_10150323 3300010375 Bacteria 2599
260 Ga0105239_10236529 3300010375 Bacteria 2050
261 Ga0105239_10826800 3300010375 Bacteria 1062
262 Ga0105246_10227017 3300011119 Bacteria 1468
263 Ga0105246_10283470 3300011119 Unclassified 1330
264 Ga0157370_10009143 3300013104 Bacteria 10624
265 Ga0157369_10012643 3300013105 Bacteria 9572
266 Ga0157369_10057623 3300013105 Bacteria 4191
267 Ga0157369_10152087 3300013105 Bacteria 2446
268 Ga0157369_10325394 3300013105 Bacteria 1598
269 Ga0157369_10523106 3300013105 Unclassified 1227
270 Ga0157369_11128342 3300013105 Bacteria 801
271 Ga0157374_10144527 3300013296 Bacteria 2310
272 Ga0157374_10183292 3300013296 Bacteria 2046
273 Ga0157374_10667178 3300013296 Unclassified 1052
274 Ga0157378_10234884 3300013297 Bacteria 1749
275 Ga0163162_10062920 3300013306 Bacteria 3752
276 Ga0163162_10139518 3300013306 Bacteria 2536
277 Ga0163162_10536683 3300013306 Bacteria 1299
278 Ga0163162_10877885 3300013306 Bacteria 1011
279 Ga0157372_10073483 3300013307 Bacteria 3855
280 Ga0157372_10283635 3300013307 Bacteria 1926
281 Ga0157372_10486637 3300013307 Unclassified 1438
282 Ga0157372_10582734 3300013307 Bacteria 1304
283 Ga0157375_10008249 3300013308 Bacteria 9117
284 Ga0157375_10101132 3300013308 Bacteria 2965
285 Ga0157375_10274571 3300013308 Bacteria 1848
286 Ga0163163_10106042 3300014325 Bacteria 2836
287 Ga0163163_10358883 3300014325 Bacteria 1514
288 Ga0163163_10583518 3300014325 Bacteria 1181
289 Ga0163163_11020649 3300014325 Bacteria 890
290 Ga0157380_10123531 3300014326 Bacteria 2197
291 Ga0157380_10140167 3300014326 Bacteria 2076
292 Ga0157380_10240638 3300014326 Bacteria 1631
293 Ga0157380_10673995 3300014326 Bacteria 1035
294 Ga0157380_11336917 3300014326 Bacteria 765
295 Ga0157379_10010578 3300014968 Bacteria 8043
296 Ga0157379_10048182 3300014968 Bacteria 3803
297 Ga0157379_10328725 3300014968 Bacteria 1397
298 Ga0157379_10386678 3300014968 Unclassified 1284
299 Ga0157379_10736444 3300014968 Unclassified 927
300 Ga0157376_10092787 3300014969 Bacteria 2619
301 Ga0157376_10217433 3300014969 Bacteria 1768
302 Ga0157376_10547112 3300014969 Unclassified 1145
303 Ga0163161_10039878 3300017792 Bacteria 3372
304 Ga0163161_10099853 3300017792 Bacteria 2159
305 Ga0213873_10023208 3300021358 Bacteria 1476
306 Ga0207682_10013838 3300025893 Bacteria 3142
307 Ga0207692_10326368 3300025898 Bacteria 940
308 Ga0207642_10064291 3300025899 Bacteria 1719
309 Ga0207710_10030821 3300025900 Bacteria 2342
310 Ga0207710_10030884 3300025900 Bacteria 2339
311 Ga0207710_10147925 3300025900 Bacteria 1138
312 Ga0207688_10129309 3300025901 Bacteria 1479
313 Ga0207688_10192628 3300025901 Bacteria 1220
314 Ga0207680_10169331 3300025903 Bacteria 1470
315 Ga0207685_10101183 3300025905 Bacteria 1232
316 Ga0207685_10127869 3300025905 Bacteria 1124
317 Ga0207699_10001270 3300025906 Bacteria 11982
318 Ga0207643_10006682 3300025908 Bacteria 6185
319 Ga0207643_10059532 3300025908 Bacteria 2179
320 Ga0207643_10236827 3300025908 Unclassified 1121
321 Ga0207707_10001951 3300025912 Bacteria 18779
322 Ga0207707_10003823 3300025912 Bacteria 13338
323 Ga0207707_10035340 3300025912 Bacteria 4370
324 Ga0207707_10065335 3300025912 Bacteria 3169
325 Ga0207707_10455562 3300025912 Unclassified 1094
326 Ga0207695_10007513 3300025913 Bacteria 13828
327 Ga0207695_10012511 3300025913 Bacteria 10178
328 Ga0207695_10014791 3300025913 Bacteria 9219
329 Ga0207695_10020486 3300025913 Bacteria 7572
330 Ga0207695_10020584 3300025913 Bacteria 7553
331 Ga0207695_10040379 3300025913 Bacteria 5004
332 Ga0207695_10453316 3300025913 Bacteria 1166
333 Ga0207695_10467723 3300025913 Unclassified 1143
334 Ga0207695_10848425 3300025913 Bacteria 793
335 Ga0207671_10022179 3300025914 Bacteria 4804
336 Ga0207671_10058040 3300025914 Bacteria 2869
337 Ga0207671_10827108 3300025914 Bacteria 734
338 Ga0207693_10000007 3300025915 Bacteria 173735
339 Ga0207693_10080259 3300025915 Bacteria 2554
340 Ga0207693_10086240 3300025915 Bacteria 2460
341 Ga0207663_10034385 3300025916 Bacteria 3030
342 Ga0207660_10007989 3300025917 Bacteria 6839
343 Ga0207660_10222453 3300025917 Unclassified 1482
344 Ga0207660_10738284 3300025917 Bacteria 803
345 Ga0207662_10019630 3300025918 Bacteria 3850
346 Ga0207657_10463204 3300025919 Bacteria 994
347 Ga0207652_10006327 3300025921 Bacteria 9564
348 Ga0207652_10019643 3300025921 Bacteria 5560
349 Ga0207652_10065680 3300025921 Bacteria 3143
350 Ga0207652_10339077 3300025921 Bacteria 1357
351 Ga0207652_10822742 3300025921 Unclassified 824
352 Ga0207681_10330813 3300025923 Bacteria 1214
353 Ga0207681_11096610 3300025923 Unclassified 668
354 Ga0207694_10014464 3300025924 Bacteria 5949
355 Ga0207694_10119958 3300025924 Unclassified 2099
356 Ga0207694_10136312 3300025924 Bacteria 1972
357 Ga0207694_10233255 3300025924 Unclassified 1503
358 Ga0207694_10741722 3300025924 Bacteria 829
359 Ga0207650_10044352 3300025925 Bacteria 3268
360 Ga0207650_10241428 3300025925 Bacteria 1460
361 Ga0207659_10277847 3300025926 Bacteria 1368
362 Ga0207659_10339416 3300025926 Bacteria 1244
363 Ga0207659_11052229 3300025926 Unclassified 700
364 Ga0207687_10137532 3300025927 Bacteria 1849
365 Ga0207687_10408933 3300025927 Bacteria 1118
366 Ga0207700_10380940 3300025928 Bacteria 1234
367 Ga0207700_10739229 3300025928 Unclassified 879
368 Ga0207700_10973293 3300025928 Bacteria 759
369 Ga0207664_10001839 3300025929 Bacteria 13993
370 Ga0207664_10026110 3300025929 Bacteria 4409
371 Ga0207644_10099045 3300025931 Bacteria 2186
372 Ga0207644_10308699 3300025931 Bacteria 1277
373 Ga0207644_10855523 3300025931 Bacteria 761
374 Ga0207690_10413656 3300025932 Bacteria 1078
375 Ga0207706_10311178 3300025933 Bacteria 1371
376 Ga0207686_10073237 3300025934 Bacteria 2209
377 Ga0207709_10287123 3300025935 Bacteria 1218
378 Ga0207670_10010653 3300025936 Bacteria 5305
379 Ga0207669_10016502 3300025937 Bacteria 3754
380 Ga0207669_10134229 3300025937 Bacteria 1706
381 Ga0207669_10739443 3300025937 Bacteria 811
382 Ga0207704_10048736 3300025938 Bacteria 2542
383 Ga0207704_10171196 3300025938 Bacteria 1558
384 Ga0207665_10004194 3300025939 Bacteria 9590
385 Ga0207665_10025385 3300025939 Bacteria 3909
386 Ga0207665_10123356 3300025939 Bacteria 1832
387 Ga0207691_10003602 3300025940 Bacteria 15049
388 Ga0207691_10009599 3300025940 Bacteria 9285
389 Ga0207691_10018744 3300025940 Bacteria 6556
390 Ga0207691_10212577 3300025940 Bacteria 1680
391 Ga0207691_10719882 3300025940 Bacteria 841
392 Ga0207711_10179112 3300025941 Bacteria 1926
393 Ga0207711_10336624 3300025941 Bacteria 1396
394 Ga0207711_10402131 3300025941 Bacteria 1272
395 Ga0207689_10042909 3300025942 Bacteria 3739
396 Ga0207689_10061608 3300025942 Bacteria 3086
397 Ga0207689_10207398 3300025942 Bacteria 1619
398 Ga0207661_10009761 3300025944 Bacteria 6894
399 Ga0207661_10086699 3300025944 Bacteria 2599
400 Ga0207661_10376207 3300025944 Bacteria 1285
401 Ga0207679_10033308 3300025945 Bacteria 3624
402 Ga0207679_10207721 3300025945 Bacteria 1640
403 Ga0207679_10549518 3300025945 Bacteria 1036
404 Ga0207667_10029498 3300025949 Bacteria 5949
405 Ga0207667_10084764 3300025949 Bacteria 3280
406 Ga0207667_10238553 3300025949 Bacteria 1861
407 Ga0207667_10350463 3300025949 Unclassified 1506
408 Ga0207651_10038985 3300025960 Bacteria 3128
409 Ga0207651_10091071 3300025960 Bacteria 2232
410 Ga0207712_10123150 3300025961 Bacteria 1965
411 Ga0207712_10754659 3300025961 Bacteria 853
412 Ga0207658_10026719 3300025986 Bacteria 4049
413 Ga0207658_10047099 3300025986 Bacteria 3153
414 Ga0207658_10155927 3300025986 Bacteria 1866
415 Ga0207658_10170836 3300025986 Bacteria 1791
416 Ga0207658_10398020 3300025986 Bacteria 1210
417 Ga0207677_10166772 3300026023 Bacteria 1717
418 Ga0207703_10000370 3300026035 Bacteria 47999
419 Ga0207703_10081091 3300026035 Bacteria 2704
420 Ga0207703_10396107 3300026035 Bacteria 1280
421 Ga0207703_11111593 3300026035 Bacteria 759
422 Ga0207639_10123698 3300026041 Bacteria 2130
423 Ga0207639_10181324 3300026041 Bacteria 1791
424 Ga0207678_10550672 3300026067 Bacteria 1009
425 Ga0207708_10030919 3300026075 Bacteria 4063
426 Ga0207708_10063955 3300026075 Bacteria 2811
427 Ga0207708_10134850 3300026075 Bacteria 1933
428 Ga0207708_10145679 3300026075 Bacteria 1861
429 Ga0207708_10668665 3300026075 Bacteria 885
430 Ga0207702_10052542 3300026078 Bacteria 3448
431 Ga0207702_10312319 3300026078 Bacteria 1495
432 Ga0207641_10001332 3300026088 Bacteria 24445
433 Ga0207641_10056869 3300026088 Bacteria 3325
434 Ga0207641_10089158 3300026088 Bacteria 2695
435 Ga0207641_10095880 3300026088 Bacteria 2605
436 Ga0207641_10227729 3300026088 Bacteria 1731
437 Ga0207641_10236985 3300026088 Bacteria 1698
438 Ga0207641_10404566 3300026088 Bacteria 1311
439 Ga0207641_10443056 3300026088 Bacteria 1254
440 Ga0207641_11515755 3300026088 Unclassified 672
441 Ga0207648_10071710 3300026089 Bacteria 3019
442 Ga0207648_10136475 3300026089 Bacteria 2161
443 Ga0207676_10031694 3300026095 Bacteria 3977
444 Ga0207676_10166653 3300026095 Bacteria 1915
445 Ga0207676_10607804 3300026095 Bacteria 1051
446 Ga0207674_10177128 3300026116 Bacteria 2085
447 Ga0207674_10200865 3300026116 Bacteria 1943
448 Ga0207675_100002626 3300026118 Bacteria 17775
449 Ga0207675_100031652 3300026118 Bacteria 4928
450 Ga0207675_100049995 3300026118 Bacteria 3901
451 Ga0207675_100186158 3300026118 Bacteria 1990
452 Ga0207675_100571607 3300026118 Bacteria 1131
453 Ga0207675_100654143 3300026118 Bacteria 1057
454 Ga0207675_100782314 3300026118 Bacteria 967
455 Ga0207683_10013492 3300026121 Bacteria 6971
456 Ga0207683_10027368 3300026121 Bacteria 4927
457 Ga0207698_10149666 3300026142 Bacteria 2024
458 Ga0207698_10316858 3300026142 Bacteria 1459
459 Ga0209179_1003432 3300027512 Bacteria 2282
460 Ga0268266_10000434 3300028379 Bacteria 62882
461 Ga0268266_10003135 3300028379 Bacteria 16801
462 Ga0268266_10027345 3300028379 Bacteria 4851
463 Ga0268266_10056077 3300028379 Bacteria 3389
464 Ga0268266_10162011 3300028379 Bacteria 2024
465 Ga0268266_10212867 3300028379 Bacteria 1773
466 Ga0268266_10277794 3300028379 Bacteria 1556
467 Ga0268265_10006517 3300028380 Bacteria 7911
468 Ga0268265_10122001 3300028380 Bacteria 2149
469 Ga0268265_10179705 3300028380 Bacteria 1817
470 Ga0268265_10201330 3300028380 Bacteria 1728
471 Ga0268264_10000034 3300028381 Bacteria 401894
472 Ga0268264_10053056 3300028381 Bacteria 3382
473 Ga0268264_10155857 3300028381 Bacteria 2052
474 Ga0268264_10317267 3300028381 Bacteria 1472
475 Ga0268264_11380515 3300028381 Bacteria 715
476 Ga0265326_10009509 3300028558 Bacteria 2907
477 Ga0265334_10011218 3300028573 Bacteria 3778
478 Ga0265334_10032670 3300028573 Bacteria 2074
479 Ga0265318_10010309 3300028577 Bacteria 4074
480 Ga0307515_10380630 3300028794 Bacteria 1044
481 Ga0265338_10075258 3300028800 Bacteria 2866
482 Ga0307511_10020220 3300030521 Bacteria 6309
483 Ga0265332_10088994 3300031238 Bacteria 1306
484 Ga0265325_10005134 3300031241 Bacteria 8143
485 Ga0265340_10078325 3300031247 Bacteria 1559
486 Ga0265339_10018001 3300031249 Bacteria 4174
487 Ga0265339_10243625 3300031249 Bacteria 872
488 Ga0265331_10012889 3300031250 Bacteria 4509
489 Ga0265316_10026675 3300031344 Bacteria 4799
490 Ga0307513_10001633 3300031456 Bacteria 32113
491 Ga0307513_10006396 3300031456 Bacteria 15393
492 Ga0307513_10015429 3300031456 Bacteria 9260
493 Ga0307513_10033769 3300031456 Bacteria 5747
494 Ga0307513_10093651 3300031456 Bacteria 3053
495 Ga0307509_10000106 3300031507 Bacteria 118906
496 Ga0307509_10043476 3300031507 Bacteria 4862
497 Ga0307509_10269351 3300031507 Bacteria 1472
498 Ga0307408_100241056 3300031548 Bacteria 1486
499 Ga0307408_100615173 3300031548 Bacteria 967
500 Ga0307508_10331747 3300031616 Bacteria 1113
501 Ga0265314_10028392 3300031711 Bacteria 4172
502 Ga0265314_10107197 3300031711 Bacteria 1783
503 Ga0265342_10021754 3300031712 Bacteria 4088
504 Ga0265342_10257340 3300031712 Bacteria 930
505 Ga0307516_10028635 3300031730 Bacteria 5635
506 Ga0307405_10079474 3300031731 Bacteria 2138
507 Ga0307413_10004456 3300031824 Bacteria 6099
508 Ga0307413_10015182 3300031824 Bacteria 3939
509 Ga0307518_10180961 3300031838 Bacteria 1425
510 Ga0307410_10032176 3300031852 Bacteria 3373
511 Ga0307409_100103184 3300031995 Bacteria 2371
512 Ga0307409_100248328 3300031995 Bacteria 1625
513 Ga0307416_100101310 3300032002 Bacteria 2508
514 Ga0307416_101802610 3300032002 Unclassified 716
515 Ga0307411_10062533 3300032005 Bacteria 2483
516 Ga0307415_100130514 3300032126 Bacteria 1901
517 Ga0307510_10000005 3300033180 Bacteria 633068
518 Ga0373936_0183154 3300035113 Unclassified 919
519 Ga0373956_0246487 3300035119 Bacteria 849
520 Ga0373955_0093873 3300035172 Bacteria 1714
521 Ga0373927_0148783 3300035695 Bacteria 1533
522 Ga0373933_0285201 3300035724 Bacteria 1067
523 Ga0373947_0577897 3300035725 Bacteria 765
524 Ga0373937_0011501 3300036401 Bacteria 7769
525 Ga0373937_0182421 3300036401 Bacteria 1971
526 Ga0373925_0109706 3300037068 Bacteria 2130
527 Ga0395900_0176368 3300037418 Bacteria 2174
528 Ga0395900_0178298 3300037418 Bacteria 2161
529 Ga0395898_0009376 3300037466 Bacteria 10282
530 Ga0395898_0212679 3300037466 Bacteria 1844
531 Ga0436364_0885640 3300037853 Bacteria 2775
532 Ga0395901_0195722 3300038443 Bacteria 2120
533 Ga0395901_0319841 3300038443 Bacteria 1606
534 Ga0395901_0959881 3300038443 Bacteria 833
535 Ga0436365_1132967 3300039437 Bacteria 7496
536 Ga0436363_0484021 3300039450 Bacteria 11349
537 Ga0436363_1088992 3300039450 Bacteria 5961
538 Ga0436363_1332741 3300039450 Unclassified 756
539 Ga0436362_0300110 3300039453 Bacteria 3970
540 Ga0436362_1217740 3300039453 Bacteria 2062
541 Ga0451791_1411683 3300041451 Bacteria 1807
542 Ga0451797_0601489 3300041453 Bacteria 789
543 Ga0451800_1114349 3300041459 Bacteria 837
544 Ga0451802_1704954 3300041460 Bacteria 1398
545 Ga0451802_1882632 3300041460 Bacteria 750
546 Ga0451833_0457413 3300041491 Bacteria 849
547 Ga0451853_1847721 3300041512 Bacteria 683
548 Ga0451853_2151606 3300041512 Bacteria 893
549 Ga0450896_031050 3300042133 Bacteria 809
550 Ga0466969_0027344 3300044656 Bacteria 2921
551 Ga0466969_0028616 3300044656 Bacteria 2848
552 Ga0466966_0141153 3300044684 Bacteria 1472
553 Ga0466966_0212463 3300044684 Unclassified 1169
554 Ga0466964_0524251 3300044706 Bacteria 639
555 Ga0466971_0008899 3300044719 Bacteria 4387
556 Ga0466957_0041890 3300044842 Bacteria 2769
557 Ga0466959_0049771 3300045049 Bacteria 3078
558 Ga0466959_0107755 3300045049 Bacteria 1991
559 Ga0495590_0003699 3300046457 Bacteria 6222
560 Ga0495638_0000406 3300046460 Bacteria 52627
561 Ga0495650_0000466 3300046471 Bacteria 62626
562 Ga0495650_0127023 3300046471 Unclassified 933
563 Ga0495580_0008428 3300046472 Bacteria 8201
564 Ga0495580_0012880 3300046472 Bacteria 6408
565 Ga0495580_0105214 3300046472 Bacteria 1961
566 Ga0495584_0072661 3300046491 Bacteria 1729
567 Ga0495583_0037691 3300046506 Bacteria 2290
568 Ga0495608_0159125 3300046511 Bacteria 1437
569 Ga0495616_0010106 3300046513 Bacteria 5476
570 Ga0495618_0024939 3300046514 Bacteria 3709
571 Ga0495632_0090683 3300046519 Bacteria 1449
572 Ga0495632_0192197 3300046519 Unclassified 932
573 Ga0495632_0249733 3300046519 Bacteria 796
574 Ga0495665_0148270 3300046531 Bacteria 1225
575 Ga0495668_0047411 3300046616 Bacteria 2386
576 Ga0495625_0027368 3300046660 Bacteria 4294
577 Ga0495625_0027714 3300046660 Bacteria 4258
578 Ga0495625_0244081 3300046660 Unclassified 1168
579 Ga0495657_0162883 3300046675 Bacteria 1379
580 Ga0495657_0405464 3300046675 Bacteria 802
581 Ga0495599_0432091 3300046678 Bacteria 781
582 Ga0495649_0006626 3300046694 Bacteria 7198
583 Ga0495649_0192875 3300046694 Unclassified 1060
584 Ga0495649_0250019 3300046694 Bacteria 911
585 Ga0495672_0073546 3300047320 Bacteria 1927
586 Ga0495687_032786 3300047443 Bacteria 2366
587 Ga0495687_037958 3300047443 Unclassified 2142
588 Ga0495684_0327188 3300047471 Bacteria 1094
589 Ga0495686_0045890 3300047472 Bacteria 2764
590 Ga0495602_0617887 3300048088 Bacteria 743
591 Ga0496100_0002192 3300048903 Bacteria 9853
592 Ga0496101_0003043 3300048904 Bacteria 10343
593 Ga0496102_0024478 3300048905 Bacteria 5368
594 Ga0496102_0026505 3300048905 Bacteria 5171
595 Ga0496102_0063591 3300048905 Bacteria 3379
596 Ga0496103_0167973 3300048906 Bacteria 1408
597 Ga0496104_0001435 3300048907 Bacteria 20597
598 Ga0496104_0067342 3300048907 Bacteria 3401
599 Ga0496104_0813914 3300048907 Bacteria 840
600 Ga0496105_0004358 3300048908 Bacteria 10652
601 Ga0496105_0025668 3300048908 Bacteria 4798
602 Ga0496107_0097163 3300048910 Bacteria 2156
603 Ga0496107_0376537 3300048910 Unclassified 1056
604 Ga0496108_0029860 3300048911 Bacteria 4518
605 Ga0496108_0112646 3300048911 Bacteria 2328
606 Ga0496109_0208107 3300048912 Bacteria 1839
607 Ga0496110_0007866 3300048913 Bacteria 8538
608 Ga0496111_0007717 3300048914 Bacteria 7076
609 Ga0496112_0470745 3300048915 Bacteria 1194
610 Ga0496113_0061948 3300048916 Bacteria 2824
611 Ga0496114_0012886 3300048917 Bacteria 6697
612 Ga0496114_0036939 3300048917 Bacteria 4038
613 Ga0496114_0469979 3300048917 Bacteria 1113
614 Ga0496114_0628195 3300048917 Bacteria 946
615 Ga0496115_0037675 3300048918 Bacteria 3832
616 Ga0496115_0064890 3300048918 Bacteria 2948
617 Ga0496117_0077671 3300048920 Bacteria 2196
618 Ga0496118_0052929 3300048921 Bacteria 3091
619 Ga0496118_0070719 3300048921 Bacteria 2517
620 Ga0496119_0001966 3300048922 Bacteria 23376
621 Ga0496120_0001017 3300048923 Bacteria 37512
622 Ga0496121_0000549 3300048924 Bacteria 70869
623 Ga0496123_0226493 3300048926 Bacteria 939
624 Ga0496125_0000194 3300048928 Bacteria 130058
625 Ga0496125_0010619 3300048928 Bacteria 9299
626 Ga0496125_0297237 3300048928 Unclassified 991
627 Ga0496126_0002124 3300048929 Bacteria 27678
628 Ga0496126_0023117 3300048929 Bacteria 6026
629 Ga0496126_0374614 3300048929 Bacteria 1160
630 Ga0501034_0002749 3300049571 Bacteria 20687
631 Ga0501034_0086088 3300049571 Bacteria 3144
632 Ga0501034_0999346 3300049571 Bacteria 721
633 Ga0501036_0451643 3300049572 Bacteria 1071
634 Ga0501039_0128308 3300049575 Bacteria 1990
635 Ga0501042_0211284 3300049578 Bacteria 1400
636 Ga0501042_0236256 3300049578 Bacteria 1319
637 Ga0501042_0353601 3300049578 Bacteria 1063
638 Ga0501043_0290121 3300049579 Bacteria 1253
639 Ga0501047_0331071 3300049581 Bacteria 1361
640 Ga0501047_0380353 3300049581 Bacteria 1246
641 Ga0501067_0013623 3300049583 Bacteria 4503
642 Ga0501068_0002704 3300049584 Bacteria 9401
643 Ga0501068_0203841 3300049584 Bacteria 1255
644 Ga0501069_0142184 3300049585 Bacteria 1377
645 Ga0501070_0020980 3300049586 Bacteria 5481
646 Ga0501070_0050215 3300049586 Bacteria 3463
647 Ga0501070_0111572 3300049586 Bacteria 2260
648 Ga0501070_0231274 3300049586 Bacteria 1515
649 Ga0501071_0017481 3300049587 Bacteria 4946
650 Ga0501073_0015321 3300049589 Bacteria 5559
651 Ga0501073_0071895 3300049589 Bacteria 2410
652 Ga0501074_0008683 3300049590 Bacteria 7361
653 Ga0501074_0015574 3300049590 Bacteria 5526
654 Ga0501075_0017611 3300049591 Bacteria 5160
655 Ga0501076_0022228 3300049592 Bacteria 4873
656 Ga0501077_0002211 3300049593 Bacteria 11731
657 Ga0501079_0000163 3300049741 Bacteria 36976
658 Ga0501080_0171797 3300049742 Bacteria 1999
659 Ga0501080_0817496 3300049742 Bacteria 816
660 Ga0501081_0123778 3300049743 Bacteria 1844
661 Ga0501083_0036746 3300049744 Bacteria 3339
662 Ga0501035_0637358 3300049822 Bacteria 865
663 Ga0501044_0657311 3300049823 Bacteria 937
664 nmdc:mga09592_410932_c1 3300050508 Bacteria 1169
665 Ga0495612_0041948 3300053078 Bacteria 1867
666 Ga0495619_0197953 3300053085 Bacteria 1391
667 Ga0500583_0019436 3300053092 Unclassified 2784
668 Ga0500641_0055510 3300053096 Bacteria 1640
669 Ga0500622_0023621 3300053156 Bacteria 3255
670 Ga0500630_136074 3300053159 Archaea 1065
671 Ga0500637_0065384 3300053178 Unclassified 2086
672 Ga0501084_0005157 3300054114 Bacteria 10685
673 Ga0501082_0419835 3300060353 Bacteria 1168
674 Ga0466962_0009145 3300061719 Bacteria 4745
675 Ga0213874_10004061
676 JGI25406J46586_10010232
677 rootL2_10093429
678 rootL2_10117227
679 rootH1_10143352
680 rootH1_10152696
681 Ga0070676_10218496
682 Ga0070683_100018632
683 Ga0070683_100111258
684 Ga0070690_100001646
685 Ga0070690_100010352
686 Ga0070690_100158084
687 Ga0070677_10006099
688 Ga0068869_100056472
689 Ga0068869_100869647
690 Ga0070666_10003170
691 Ga0070666_10067333
692 Ga0070666_10195265
693 Ga0070680_100005445
694 Ga0070680_100016414
695 Ga0070680_100120282
696 Ga0070680_100183356
697 Ga0070680_100703821
698 Ga0070682_100014192
699 Ga0070682_100016525
700 Ga0070682_100075178
701 Ga0070682_100098155
702 Ga0070682_100161506
703 Ga0068868_100005559
704 Ga0070660_100428152
705 Ga0070689_100012028
706 Ga0070689_100475274
707 Ga0070691_10028848
708 Ga0070691_10292894
709 Ga0070687_100014699
710 Ga0070687_100052163
711 Ga0070661_100392602
712 Ga0070692_10226659
713 Ga0070668_100763552
714 Ga0070669_100026977
715 Ga0070669_100073452
716 Ga0070669_100241728
717 Ga0070675_100022988
718 Ga0070675_100031891
719 Ga0070675_100473246
720 Ga0070671_100000873
721 Ga0070671_100291011
722 Ga0070671_100870989
723 Ga0070674_100142274
724 Ga0070674_100432383
725 Ga0070673_100036914
726 Ga0070688_100627045
727 Ga0070667_100022817
728 Ga0070667_100144494
729 Ga0070667_100298351
730 Ga0070667_100656944
731 Ga0070667_100983061
732 Ga0070709_10000870
733 Ga0070709_10003561
734 Ga0070709_10142781
735 Ga0070714_100000478
736 Ga0070714_100040546
737 Ga0070714_100053243
738 Ga0070714_100113171
739 Ga0070713_100001001
740 Ga0070713_100042941
741 Ga0070713_100505071
742 Ga0070713_100737098
743 Ga0070713_100797817
744 Ga0070710_10002459
745 Ga0070710_10347238
746 Ga0070701_10000698
747 Ga0070711_100039447
748 Ga0070711_100086562
749 Ga0070705_100028109
750 Ga0070705_100103329
751 Ga0070700_100044257
752 Ga0070700_100313145
753 Ga0070694_100149944
754 Ga0070694_100332229
755 Ga0070694_100664513
756 Ga0070663_100217908
757 Ga0070678_100004992
758 Ga0070678_100081036
759 Ga0070662_100309368
760 Ga0070681_10001671
761 Ga0070681_10006781
762 Ga0070681_10016465
763 Ga0070681_10065613
764 Ga0070681_10472275
765 Ga0068867_100183561
766 Ga0068867_100190015
767 Ga0070685_10247688
768 Ga0070685_10306079
769 Ga0070685_10396260
770 Ga0070707_100197944
771 Ga0070698_100116942
772 Ga0070699_100172336
773 Ga0070679_100012984
774 Ga0070679_100038855
775 Ga0070679_100067660
776 Ga0070679_100125756
777 Ga0070679_100531434
778 Ga0070684_100029288
779 Ga0070684_100111609
780 Ga0068853_100324807
781 Ga0068853_100731634
782 Ga0070672_100022182
783 Ga0070672_100054080
784 Ga0070672_100296362
785 Ga0070686_100037446
786 Ga0070686_100092935
787 Ga0070686_100204584
788 Ga0070695_100001482
789 Ga0070695_100148836
790 Ga0070695_100432852
791 Ga0070695_100784411
792 Ga0070693_100048794
793 Ga0070665_100000547
794 Ga0070665_100000769
795 Ga0070665_100009866
796 Ga0070665_100022514
797 Ga0070665_100023013
798 Ga0070665_100029181
799 Ga0070665_100289769
800 Ga0070665_100440966
801 Ga0070665_100954540
802 Ga0070704_100366250
803 Ga0068855_100003826
804 Ga0068855_100015568
805 Ga0068855_100283698
806 Ga0068855_100988642
807 Ga0070664_100047554
808 Ga0070664_100125105
809 Ga0070664_100278778
810 Ga0070664_100593110
811 Ga0068857_100235927
812 Ga0068856_100128983
813 Ga0068856_100360839
814 Ga0068856_100439773
815 Ga0070702_100028497
816 Ga0068852_100183688
817 Ga0068852_101118146
818 Ga0068859_100000172
819 Ga0068859_100203834
820 Ga0068859_100207967
821 Ga0068859_100336017
822 Ga0068859_100485050
823 Ga0068859_100957477
824 Ga0068859_101069765
825 Ga0068864_100150218
826 Ga0068866_10050134
827 Ga0068861_100000511
828 Ga0068861_100019498
829 Ga0068861_100088841
830 Ga0068861_100831849
831 Ga0068870_10020676
832 Ga0068863_100006736
833 Ga0068863_100020143
834 Ga0068863_100075414
835 Ga0068863_100075945
836 Ga0068863_100113825
837 Ga0068863_100143734
838 Ga0068863_100321341
839 Ga0068863_100823141
840 Ga0068858_100000406
841 Ga0068858_100001307
842 Ga0068858_100016141
843 Ga0068858_100505115
844 Ga0068858_100659131
845 Ga0068858_100754022
846 Ga0068860_100002651
847 Ga0068860_100022300
848 Ga0068860_100045049
849 Ga0068860_100994509
850 Ga0068862_100003372
851 Ga0068862_100022799
852 Ga0068862_100810571
853 Ga0081539_10000058
854 Ga0070717_10001908
855 Ga0070715_10000414
856 Ga0070715_10394414
857 Ga0070716_100019605
858 Ga0070716_100096648
859 Ga0070716_100246634
860 Ga0070712_100000490
861 Ga0070712_100140730
862 Ga0070712_100300427
863 Ga0070712_100389398
864 Ga0097621_100067912
865 Ga0097621_100080082
866 Ga0097621_100171009
867 Ga0097621_100261434
868 Ga0068871_100021654
869 Ga0068871_100048552
870 Ga0068871_100063883
871 Ga0068871_100633829
872 Ga0075434_101179514
873 Ga0075429_100313229
874 Ga0068865_100066658
875 Ga0068865_100072830
876 Ga0097620_100000172
877 Ga0097620_100203825
878 Ga0097620_100207959
879 Ga0097620_100336050
880 Ga0097620_100485057
881 Ga0097620_100957579
882 Ga0097620_101069837
883 Ga0099794_10004535
884 Ga0099795_10000352
885 Ga0099795_10104838
886 Ga0105250_10049709
887 Ga0105240_10010673
888 Ga0105240_10024341
889 Ga0105240_10025637
890 Ga0105240_10029232
891 Ga0105240_10090321
892 Ga0105240_10111504
893 Ga0105240_10147787
894 Ga0105240_10226685
895 Ga0105240_10595805
896 Ga0105240_11146802
897 Ga0111539_10849992
898 Ga0111539_11092132
899 Ga0105247_10005156
900 Ga0105247_10015239
901 Ga0105247_10017608
902 Ga0105247_10255131
903 Ga0114129_10863414
904 Ga0105243_10125935
905 Ga0105241_10340546
906 Ga0105241_10768991
907 Ga0105242_10003896
908 Ga0105242_10026316
909 Ga0105248_10115834
910 Ga0105237_10032781
911 Ga0105237_10033972
912 Ga0105237_10037539
913 Ga0105237_10054425
914 Ga0105237_10055849
915 Ga0105237_10065743
916 Ga0105237_10089652
917 Ga0105237_10282461
918 Ga0105237_10488779
919 Ga0105237_10580821
920 Ga0105237_10693016
921 Ga0105238_10007151
922 Ga0105238_10016966
923 Ga0105238_10025105
924 Ga0105238_10174622
925 Ga0105238_10295841
926 Ga0105238_11056969
927 Ga0105249_10049355
928 Ga0105249_10121839
929 Ga0105249_11337076
930 Ga0099796_10000247
931 Ga0099796_10010697
932 Ga0099796_10099020
933 Ga0105239_10150323
934 Ga0105239_10236529
935 Ga0105239_10826800
936 Ga0105246_10227017
937 Ga0105246_10283470
938 Ga0157370_10009143
939 Ga0157369_10012643
940 Ga0157369_10057623
941 Ga0157369_10152087
942 Ga0157369_10325394
943 Ga0157369_10523106
944 Ga0157369_11128342
945 Ga0157374_10144527
946 Ga0157374_10183292
947 Ga0157374_10667178
948 Ga0157378_10234884
949 Ga0163162_10062920
950 Ga0163162_10139518
951 Ga0163162_10536683
952 Ga0163162_10877885
953 Ga0157372_10073483
954 Ga0157372_10283635
955 Ga0157372_10486637
956 Ga0157372_10582734
957 Ga0157375_10008249
958 Ga0157375_10101132
959 Ga0157375_10274571
960 Ga0163163_10106042
961 Ga0163163_10358883
962 Ga0163163_10583518
963 Ga0163163_11020649
964 Ga0157380_10123531
965 Ga0157380_10140167
966 Ga0157380_10240638
967 Ga0157380_10673995
968 Ga0157380_11336917
969 Ga0157379_10010578
970 Ga0157379_10048182
971 Ga0157379_10328725
972 Ga0157379_10386678
973 Ga0157379_10736444
974 Ga0157376_10092787
975 Ga0157376_10217433
976 Ga0157376_10547112
977 Ga0163161_10039878
978 Ga0163161_10099853
979 Ga0213873_10023208
980 Ga0207682_10013838
981 Ga0207692_10326368
982 Ga0207642_10064291
983 Ga0207710_10030821
984 Ga0207710_10030884
985 Ga0207710_10147925
986 Ga0207688_10129309
987 Ga0207688_10192628
988 Ga0207680_10169331
989 Ga0207685_10101183
990 Ga0207685_10127869
991 Ga0207699_10001270
992 Ga0207643_10006682
993 Ga0207643_10059532
994 Ga0207643_10236827
995 Ga0207707_10001951
996 Ga0207707_10003823
997 Ga0207707_10035340
998 Ga0207707_10065335
999 Ga0207707_10455562
1000 Ga0207695_10007513
1001 Ga0207695_10012511
1002 Ga0207695_10014791
1003 Ga0207695_10020486
1004 Ga0207695_10020584
1005 Ga0207695_10040379
1006 Ga0207695_10453316
1007 Ga0207695_10467723
1008 Ga0207695_10848425
1009 Ga0207671_10022179
1010 Ga0207671_10058040
1011 Ga0207671_10827108
1012 Ga0207693_10000007
1013 Ga0207693_10080259
1014 Ga0207693_10086240
1015 Ga0207663_10034385
1016 Ga0207660_10007989
1017 Ga0207660_10222453
1018 Ga0207660_10738284
1019 Ga0207662_10019630
1020 Ga0207657_10463204
1021 Ga0207652_10006327
1022 Ga0207652_10019643
1023 Ga0207652_10065680
1024 Ga0207652_10339077
1025 Ga0207652_10822742
1026 Ga0207681_10330813
1027 Ga0207681_11096610
1028 Ga0207694_10014464
1029 Ga0207694_10119958
1030 Ga0207694_10136312
1031 Ga0207694_10233255
1032 Ga0207694_10741722
1033 Ga0207650_10044352
1034 Ga0207650_10241428
1035 Ga0207659_10277847
1036 Ga0207659_10339416
1037 Ga0207659_11052229
1038 Ga0207687_10137532
1039 Ga0207687_10408933
1040 Ga0207700_10380940
1041 Ga0207700_10739229
1042 Ga0207700_10973293
1043 Ga0207664_10001839
1044 Ga0207664_10026110
1045 Ga0207644_10099045
1046 Ga0207644_10308699
1047 Ga0207644_10855523
1048 Ga0207690_10413656
1049 Ga0207706_10311178
1050 Ga0207686_10073237
1051 Ga0207709_10287123
1052 Ga0207670_10010653
1053 Ga0207669_10016502
1054 Ga0207669_10134229
1055 Ga0207669_10739443
1056 Ga0207704_10048736
1057 Ga0207704_10171196
1058 Ga0207665_10004194
1059 Ga0207665_10025385
1060 Ga0207665_10123356
1061 Ga0207691_10003602
1062 Ga0207691_10009599
1063 Ga0207691_10018744
1064 Ga0207691_10212577
1065 Ga0207691_10719882
1066 Ga0207711_10179112
1067 Ga0207711_10336624
1068 Ga0207711_10402131
1069 Ga0207689_10042909
1070 Ga0207689_10061608
1071 Ga0207689_10207398
1072 Ga0207661_10009761
1073 Ga0207661_10086699
1074 Ga0207661_10376207
1075 Ga0207679_10033308
1076 Ga0207679_10207721
1077 Ga0207679_10549518
1078 Ga0207667_10029498
1079 Ga0207667_10084764
1080 Ga0207667_10238553
1081 Ga0207667_10350463
1082 Ga0207651_10038985
1083 Ga0207651_10091071
1084 Ga0207712_10123150
1085 Ga0207712_10754659
1086 Ga0207658_10026719
1087 Ga0207658_10047099
1088 Ga0207658_10155927
1089 Ga0207658_10170836
1090 Ga0207658_10398020
1091 Ga0207677_10166772
1092 Ga0207703_10000370
1093 Ga0207703_10081091
1094 Ga0207703_10396107
1095 Ga0207703_11111593
1096 Ga0207639_10123698
1097 Ga0207639_10181324
1098 Ga0207678_10550672
1099 Ga0207708_10030919
1100 Ga0207708_10063955
1101 Ga0207708_10134850
1102 Ga0207708_10145679
1103 Ga0207708_10668665
1104 Ga0207702_10052542
1105 Ga0207702_10312319
1106 Ga0207641_10001332
1107 Ga0207641_10056869
1108 Ga0207641_10089158
1109 Ga0207641_10095880
1110 Ga0207641_10227729
1111 Ga0207641_10236985
1112 Ga0207641_10404566
1113 Ga0207641_10443056
1114 Ga0207641_11515755
1115 Ga0207648_10071710
1116 Ga0207648_10136475
1117 Ga0207676_10031694
1118 Ga0207676_10166653
1119 Ga0207676_10607804
1120 Ga0207674_10177128
1121 Ga0207674_10200865
1122 Ga0207675_100002626
1123 Ga0207675_100031652
1124 Ga0207675_100049995
1125 Ga0207675_100186158
1126 Ga0207675_100571607
1127 Ga0207675_100654143
1128 Ga0207675_100782314
1129 Ga0207683_10013492
1130 Ga0207683_10027368
1131 Ga0207698_10149666
1132 Ga0207698_10316858
1133 Ga0209179_1003432
1134 Ga0268266_10000434
1135 Ga0268266_10003135
1136 Ga0268266_10027345
1137 Ga0268266_10056077
1138 Ga0268266_10162011
1139 Ga0268266_10212867
1140 Ga0268266_10277794
1141 Ga0268265_10006517
1142 Ga0268265_10122001
1143 Ga0268265_10179705
1144 Ga0268265_10201330
1145 Ga0268264_10000034
1146 Ga0268264_10053056
1147 Ga0268264_10155857
1148 Ga0268264_10317267
1149 Ga0268264_11380515
1150 Ga0265326_10009509
1151 Ga0265334_10011218
1152 Ga0265334_10032670
1153 Ga0265318_10010309
1154 Ga0307515_10380630
1155 Ga0265338_10075258
1156 Ga0307511_10020220
1157 Ga0265332_10088994
1158 Ga0265325_10005134
1159 Ga0265340_10078325
1160 Ga0265339_10018001
1161 Ga0265339_10243625
1162 Ga0265331_10012889
1163 Ga0265316_10026675
1164 Ga0307513_10001633
1165 Ga0307513_10006396
1166 Ga0307513_10015429
1167 Ga0307513_10033769
1168 Ga0307513_10093651
1169 Ga0307509_10000106
1170 Ga0307509_10043476
1171 Ga0307509_10269351
1172 Ga0307408_100241056
1173 Ga0307408_100615173
1174 Ga0307508_10331747
1175 Ga0265314_10028392
1176 Ga0265314_10107197
1177 Ga0265342_10021754
1178 Ga0265342_10257340
1179 Ga0307516_10028635
1180 Ga0307405_10079474
1181 Ga0307413_10004456
1182 Ga0307413_10015182
1183 Ga0307518_10180961
1184 Ga0307410_10032176
1185 Ga0307409_100103184
1186 Ga0307409_100248328
1187 Ga0307416_100101310
1188 Ga0307416_101802610
1189 Ga0307411_10062533
1190 Ga0307415_100130514
1191 Ga0307510_10000005
1192 Ga0373936_0183154
1193 Ga0373956_0246487
1194 Ga0373955_0093873
1195 Ga0373927_0148783
1196 Ga0373933_0285201
1197 Ga0373947_0577897
1198 Ga0373937_0011501
1199 Ga0373937_0182421
1200 Ga0373925_0109706
1201 Ga0395900_0176368
1202 Ga0395900_0178298
1203 Ga0395898_0009376
1204 Ga0395898_0212679
1205 Ga0436364_0885640
1206 Ga0395901_0195722
1207 Ga0395901_0319841
1208 Ga0395901_0959881
1209 Ga0436365_1132967
1210 Ga0436363_0484021
1211 Ga0436363_1088992
1212 Ga0436363_1332741
1213 Ga0436362_0300110
1214 Ga0436362_1217740
1215 Ga0451791_1411683
1216 Ga0451797_0601489
1217 Ga0451800_1114349
1218 Ga0451802_1704954
1219 Ga0451802_1882632
1220 Ga0451833_0457413
1221 Ga0451853_1847721
1222 Ga0451853_2151606
1223 Ga0450896_031050
1224 Ga0466969_0027344
1225 Ga0466969_0028616
1226 Ga0466966_0141153
1227 Ga0466966_0212463
1228 Ga0466964_0524251
1229 Ga0466971_0008899
1230 Ga0466957_0041890
1231 Ga0466959_0049771
1232 Ga0466959_0107755
1233 Ga0495590_0003699
1234 Ga0495638_0000406
1235 Ga0495650_0000466
1236 Ga0495650_0127023
1237 Ga0495580_0008428
1238 Ga0495580_0012880
1239 Ga0495580_0105214
1240 Ga0495584_0072661
1241 Ga0495583_0037691
1242 Ga0495608_0159125
1243 Ga0495616_0010106
1244 Ga0495618_0024939
1245 Ga0495632_0090683
1246 Ga0495632_0192197
1247 Ga0495632_0249733
1248 Ga0495665_0148270
1249 Ga0495668_0047411
1250 Ga0495625_0027368
1251 Ga0495625_0027714
1252 Ga0495625_0244081
1253 Ga0495657_0162883
1254 Ga0495657_0405464
1255 Ga0495599_0432091
1256 Ga0495649_0006626
1257 Ga0495649_0192875
1258 Ga0495649_0250019
1259 Ga0495672_0073546
1260 Ga0495687_032786
1261 Ga0495687_037958
1262 Ga0495684_0327188
1263 Ga0495686_0045890
1264 Ga0495602_0617887
1265 Ga0496100_0002192
1266 Ga0496101_0003043
1267 Ga0496102_0024478
1268 Ga0496102_0026505
1269 Ga0496102_0063591
1270 Ga0496103_0167973
1271 Ga0496104_0001435
1272 Ga0496104_0067342
1273 Ga0496104_0813914
1274 Ga0496105_0004358
1275 Ga0496105_0025668
1276 Ga0496107_0097163
1277 Ga0496107_0376537
1278 Ga0496108_0029860
1279 Ga0496108_0112646
1280 Ga0496109_0208107
1281 Ga0496110_0007866
1282 Ga0496111_0007717
1283 Ga0496112_0470745
1284 Ga0496113_0061948
1285 Ga0496114_0012886
1286 Ga0496114_0036939
1287 Ga0496114_0469979
1288 Ga0496114_0628195
1289 Ga0496115_0037675
1290 Ga0496115_0064890
1291 Ga0496117_0077671
1292 Ga0496118_0052929
1293 Ga0496118_0070719
1294 Ga0496119_0001966
1295 Ga0496120_0001017
1296 Ga0496121_0000549
1297 Ga0496123_0226493
1298 Ga0496125_0000194
1299 Ga0496125_0010619
1300 Ga0496125_0297237
1301 Ga0496126_0002124
1302 Ga0496126_0023117
1303 Ga0496126_0374614
1304 Ga0501034_0002749
1305 Ga0501034_0086088
1306 Ga0501034_0999346
1307 Ga0501036_0451643
1308 Ga0501039_0128308
1309 Ga0501042_0211284
1310 Ga0501042_0236256
1311 Ga0501042_0353601
1312 Ga0501043_0290121
1313 Ga0501047_0331071
1314 Ga0501047_0380353
1315 Ga0501067_0013623
1316 Ga0501068_0002704
1317 Ga0501068_0203841
1318 Ga0501069_0142184
1319 Ga0501070_0020980
1320 Ga0501070_0050215
1321 Ga0501070_0111572
1322 Ga0501070_0231274
1323 Ga0501071_0017481
1324 Ga0501073_0015321
1325 Ga0501073_0071895
1326 Ga0501074_0008683
1327 Ga0501074_0015574
1328 Ga0501075_0017611
1329 Ga0501076_0022228
1330 Ga0501077_0002211
1331 Ga0501079_0000163
1332 Ga0501080_0171797
1333 Ga0501080_0817496
1334 Ga0501081_0123778
1335 Ga0501083_0036746
1336 Ga0501035_0637358
1337 Ga0501044_0657311
1338 nmdc:mga09592_410932_c1
1339 Ga0495612_0041948
1340 Ga0495619_0197953
1341 Ga0500583_0019436
1342 Ga0500641_0055510
1343 Ga0500622_0023621
1344 Ga0500630_136074
1345 Ga0500637_0065384
1346 Ga0501084_0005157
1347 Ga0501082_0419835
1348 Ga0466962_0009145

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

121

205

0.98

PF00677

Lum_binding

Lumazine binding domain

24

108

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.973 1 195
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.9727 1 196
4gqn-assembly1.cif.gz_C crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with 5-nitro-6-(d-ribitylamino)-2,4(1h,3h) pyrimidinedione 0.9661 1 195
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9651 1 87
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9632 1 195
ID Description Score Start End Superfamily
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9806 102 192 2.40.30.20
af_B7FAH8_195_301_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9697 102 199 2.40.30.20
af_Q2FXG0_101_204_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9675 102 200 2.40.30.20
af_P0AFU8_1_89_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9674 1 89 2.40.30.20
4fxuA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9635 1 89 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A829Y8S0-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9933 25 193 GO:0004746
GO:0009231
AF-A0A382GLW1-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9924 1 186 GO:0004746
GO:0009231
AF-A0A1J5PJ42-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9917 1 195 GO:0004746
GO:0009231
AF-A0A7C7T4H1-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9914 1 194 GO:0004746
GO:0009231
AF-A0A2E9ZH27-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9911 1 193 GO:0004746
GO:0009231

Map