F474368

General Info

Members Datasets Scaffolds Average Seq Length
674 408 1347 142

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10396322|Ga0213876_103963222
Length 148
Sequence MAARHRSRKRALQVLFEWDMRHESIDRAISHYYDSLYSEESETRPKPDKFMEELARGTVANAPDIDKRIEATAENWRLDRMPVVDRNILRLAIYELSQQSVPAPVIIDEALELARRFSNDESLPFINGILDAVNRRIAEPSRDAVAGE

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
59 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
85 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
86 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
87 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
106 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
107 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
108 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
109 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
110 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
111 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
112 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
115 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
118 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
119 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
120 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
121 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
122 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
123 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
124 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
125 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
126 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
127 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
128 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
129 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
130 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
210 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
214 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
221 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
231 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
281 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
282 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
283 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
284 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
285 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
286 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
287 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
288 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
289 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
290 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
291 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
292 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
293 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
294 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
295 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
296 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
297 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
298 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
299 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
300 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
301 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
302 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
303 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
304 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
305 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
313 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
314 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
315 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
316 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
317 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
318 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
319 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
320 2643221548 Streptomyces sp. Root55 Isolate Unclassified
321 2643221578 Streptomyces sp. Root63 Isolate Unclassified
322 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
323 2643221647 Streptomyces sp. Root369 Isolate Unclassified
324 2643221670 Streptomyces sp. Root431 Isolate Unclassified
325 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
326 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
327 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
328 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
329 2643221714 Streptomyces sp. Root264 Isolate Unclassified
330 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
331 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
332 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
333 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
334 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
335 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
336 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
337 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
338 2808606448 Streptomyces sp. 193411 Isolate Unclassified
339 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
340 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
341 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
342 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
343 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
344 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
345 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
346 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
347 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
348 2862574272 Streptomyces sp. AcE210 Isolate Nodule
349 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
350 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
351 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
352 2867369537 Streptomyces sp. Z26 Isolate Unclassified
353 2867428634 Streptomyces sp. RP5T Isolate Unclassified
354 2867475112 Streptomyces sp. TM32 Isolate Unclassified
355 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
356 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
357 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
358 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
359 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
360 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
361 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
362 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
363 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
364 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
365 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
366 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
367 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
368 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
369 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
370 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
371 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
372 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
373 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
374 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
375 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
376 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
377 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
378 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
379 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
380 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
381 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
382 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
383 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
384 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
385 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
386 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
387 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
388 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
389 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
390 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
391 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
392 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
393 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
394 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
395 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
396 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
397 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
398 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
399 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
400 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
401 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
402 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
403 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
404 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
405 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
406 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
407 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
408 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.04
Metatranscriptomes 7.72
Isolates 14.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.68
Nodule 0.45
Rhizoplane 0.74
Rhizosphere 76.11
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10396322 3300021384 Bacteria 734
2 JGI24739J22299_10055804 3300001989 Bacteria 1262
3 JGI24737J22298_10116431 3300001990 Bacteria 790
4 JGI24735J21928_10032874 3300002067 Bacteria 1534
5 JGI24738J21930_10025858 3300002075 Bacteria 1206
6 Ga0006759J45824_1032939 3300003163 Bacteria 1242
7 Ga0006777J48905_1036155 3300003308 Bacteria 1238
8 rootH1_10031237 3300003316 Bacteria 2187
9 rootH1_10031237 3300003323 Bacteria 3042
10 rootH2_10034114 3300003320 Bacteria 1998
11 rootH1_10040758 3300003323 Bacteria 2038
12 JGI25160J50197_1065056 3300003354 Bacteria 714
13 Ga0007429J51699_1015681 3300003579 Bacteria 1262
14 Ga0032354_1035482 3300003693 Bacteria 1250
15 Ga0058860_12012580 3300004801 Bacteria 1150
16 Ga0070668_100962204 3300005347 Bacteria 766
17 Ga0070713_100892576 3300005436 Bacteria 855
18 Ga0070700_100621755 3300005441 Bacteria 849
19 Ga0070663_100024046 3300005455 Bacteria 4093
20 Ga0070663_100402752 3300005455 Bacteria 1119
21 Ga0070678_100623914 3300005456 Bacteria 965
22 Ga0070685_10858566 3300005466 Bacteria 673
23 Ga0068853_100286515 3300005539 Bacteria 1519
24 Ga0070665_100026333 3300005548 Bacteria 5857
25 Ga0070665_100255573 3300005548 Bacteria 1753
26 Ga0068855_100157186 3300005563 Bacteria 2582
27 Ga0068854_100104955 3300005578 Bacteria 2124
28 Ga0068856_100019950 3300005614 Bacteria 6507
29 Ga0068856_100155350 3300005614 Bacteria 2298
30 Ga0081455_10008729 3300005937 Bacteria 10497
31 Ga0070717_10824194 3300006028 Unclassified 844
32 Ga0075365_10290836 3300006038 Bacteria 1149
33 Ga0075368_10014916 3300006042 Bacteria 2876
34 Ga0075363_100119550 3300006048 Bacteria 1470
35 Ga0075367_10026522 3300006178 Bacteria 3287
36 Ga0075370_10211348 3300006353 Bacteria 1145
37 Ga0068871_100934239 3300006358 Unclassified 805
38 Ga0105251_10010987 3300009011 Bacteria 5204
39 Ga0105251_10163052 3300009011 Bacteria 1005
40 Ga0105250_10041818 3300009092 Bacteria 1837
41 Ga0105240_10105251 3300009093 Bacteria 3425
42 Ga0105240_10185075 3300009093 Bacteria 2454
43 Ga0105240_10568995 3300009093 Unclassified 1251
44 Ga0105245_10950677 3300009098 Bacteria 902
45 Ga0105243_10068550 3300009148 Bacteria 2859
46 Ga0105243_10250429 3300009148 Bacteria 1581
47 Ga0105241_11598753 3300009174 Unclassified 630
48 Ga0105242_10965277 3300009176 Bacteria 857
49 Ga0105237_10092682 3300009545 Bacteria 3010
50 Ga0105238_10101763 3300009551 Bacteria 2855
51 Ga0105238_10172196 3300009551 Bacteria 2141
52 Ga0105238_11850257 3300009551 Unclassified 636
53 Ga0105249_10577177 3300009553 Bacteria 1177
54 Ga0105239_10216162 3300010375 Bacteria 2149
55 Ga0105239_12541863 3300010375 Unclassified 597
56 Ga0105246_10048719 3300011119 Bacteria 2898
57 Ga0105246_10237725 3300011119 Bacteria 1438
58 Ga0157373_10430037 3300013100 Unclassified 948
59 Ga0157370_10077839 3300013104 Bacteria 3123
60 Ga0157369_10149368 3300013105 Bacteria 2470
61 Ga0157378_11770451 3300013297 Bacteria 665
62 Ga0157372_10354375 3300013307 Bacteria 1710
63 Ga0157372_13053094 3300013307 Bacteria 535
64 Ga0163163_11743996 3300014325 Bacteria 683
65 Ga0182008_10000988 3300014497 Bacteria 19736
66 Ga0157376_10813856 3300014969 Bacteria 947
67 Ga0182007_10003459 3300015262 Bacteria 7435
68 Ga0183367_1017 3300015688 Bacteria 126691
69 Ga0197907_11334973 3300020069 Bacteria 884
70 Ga0206356_11574620 3300020070 Bacteria 560
71 Ga0206355_1211322 3300020076 Bacteria 1006
72 Ga0206352_10491978 3300020078 Bacteria 1005
73 Ga0213873_10022928 3300021358 Bacteria 1483
74 Ga0213874_10024878 3300021377 Bacteria 1683
75 Ga0213874_10054339 3300021377 Unclassified 1238
76 Ga0213876_10007819 3300021384 Bacteria 5799
77 Ga0213875_10000006 3300021388 Bacteria 579005
78 Ga0213875_10000864 3300021388 Bacteria 22378
79 Ga0213875_10000915 3300021388 Bacteria 21352
80 Ga0213875_10001927 3300021388 Bacteria 12850
81 Ga0213875_10166490 3300021388 Unclassified 1035
82 Ga0213875_10317748 3300021388 Bacteria 738
83 Ga0224712_10456910 3300022467 Bacteria 614
84 Ga0256744_126621 3300023309 Bacteria 1334
85 Ga0209758_1013065 3300025297 Bacteria 4568
86 Ga0207426_1002709 3300025302 Bacteria 10787
87 Ga0207426_1030467 3300025302 Bacteria 1768
88 Ga0207713_1025206 3300025735 Bacteria 2752
89 Ga0207647_10032063 3300025904 Bacteria 3379
90 Ga0207695_10099559 3300025913 Unclassified 2904
91 Ga0207695_10451202 3300025913 Bacteria 1169
92 Ga0207694_10361151 3300025924 Unclassified 1204
93 Ga0207694_11224802 3300025924 Unclassified 635
94 Ga0207687_10501973 3300025927 Bacteria 1013
95 Ga0207709_10511310 3300025935 Bacteria 939
96 Ga0207709_10875260 3300025935 Bacteria 729
97 Ga0207691_10867973 3300025940 Bacteria 756
98 Ga0207667_10323303 3300025949 Unclassified 1575
99 Ga0207668_11148783 3300025972 Bacteria 697
100 Ga0207678_10964334 3300026067 Bacteria 754
101 Ga0207702_10032363 3300026078 Bacteria 4364
102 Ga0207702_10288721 3300026078 Bacteria 1553
103 Ga0207676_11377523 3300026095 Bacteria 701
104 Ga0209371_1034607 3300027312 Bacteria 1069
105 Ga0209813_10017281 3300027866 Bacteria 1979
106 Ga0268266_10071701 3300028379 Bacteria 3003
107 Ga0268266_10075196 3300028379 Bacteria 2934
108 Ga0268266_11092176 3300028379 Bacteria 772
109 Ga0307517_10006575 3300028786 Bacteria 17165
110 Ga0307517_10006948 3300028786 Bacteria 16631
111 Ga0307515_10002608 3300028794 Bacteria 38833
112 Ga0307515_10160601 3300028794 Bacteria 2294
113 Ga0307515_10656761 3300028794 Bacteria 661
114 Ga0310981_1040932 3300029285 Bacteria 701
115 Ga0268256_1036724 3300030500 Bacteria 1128
116 Ga0307511_10004244 3300030521 Bacteria 14631
117 Ga0307511_10373286 3300030521 Bacteria 600
118 Ga0307512_10236493 3300030522 Bacteria 930
119 Ga0307512_10343552 3300030522 Bacteria 662
120 Ga0307513_10023135 3300031456 Bacteria 7271
121 Ga0307513_10080246 3300031456 Bacteria 3366
122 Ga0307513_10460710 3300031456 Bacteria 994
123 Ga0307509_10178836 3300031507 Bacteria 1990
124 Ga0307508_10001597 3300031616 Bacteria 25266
125 Ga0307508_10117503 3300031616 Bacteria 2260
126 Ga0307508_10451782 3300031616 Bacteria 877
127 Ga0307514_10003022 3300031649 Bacteria 16626
128 Ga0307514_10252073 3300031649 Bacteria 1043
129 Ga0307514_10435850 3300031649 Bacteria 651
130 Ga0307516_10017360 3300031730 Bacteria 7506
131 Ga0307516_10450024 3300031730 Bacteria 944
132 Ga0307516_10557730 3300031730 Bacteria 799
133 Ga0307518_10514525 3300031838 Bacteria 609
134 Ga0307409_100395735 3300031995 Bacteria 1318
135 Ga0307416_100475213 3300032002 Bacteria 1309
136 Ga0307507_10272018 3300033179 Bacteria 1069
137 Ga0307510_10092342 3300033180 Bacteria 2863
138 Ga0307510_10108802 3300033180 Bacteria 2523
139 Ga0307510_10121579 3300033180 Bacteria 2314
140 Ga0307510_10484548 3300033180 Bacteria 678
141 Ga0395898_1042758 3300037466 Bacteria 753
142 Ga0436364_0056406 3300037853 Bacteria 12221
143 Ga0436364_0244345 3300037853 Bacteria 3299
144 Ga0436364_0270098 3300037853 Bacteria 68489
145 Ga0436364_0478514 3300037853 Bacteria 578677
146 Ga0436364_0510827 3300037853 Bacteria 1203
147 Ga0436364_0556898 3300037853 Bacteria 847
148 Ga0436364_0846682 3300037853 Bacteria 27024
149 Ga0436364_0883683 3300037853 Bacteria 14743
150 Ga0436364_1382991 3300037853 Bacteria 508
151 Ga0436364_1494813 3300037853 Bacteria 8329
152 Ga0395901_0157962 3300038443 Bacteria 2381
153 Ga0436365_0674457 3300039437 Unclassified 792
154 Ga0436365_0965826 3300039437 Unclassified 1075
155 Ga0436365_1169743 3300039437 Bacteria 1346
156 Ga0436365_1859987 3300039437 Unclassified 716
157 Ga0436360_0895846 3300039438 Bacteria 914
158 Ga0436363_0075268 3300039450 Unclassified 893
159 Ga0436363_0723725 3300039450 Bacteria 7798
160 Ga0436363_0782860 3300039450 Unclassified 750
161 Ga0436363_0831071 3300039450 Bacteria 3124
162 Ga0436362_0161559 3300039453 Unclassified 1044
163 Ga0436362_0460211 3300039453 Bacteria 922
164 Ga0436362_0905448 3300039453 Bacteria 3499
165 Ga0439436_0031145 3300041404 Bacteria 1548
166 Ga0439438_153303 3300041405 Bacteria 549
167 Ga0439439_0004399 3300041406 Bacteria 3172
168 Ga0439439_0042543 3300041406 Bacteria 1180
169 Ga0439439_0047432 3300041406 Bacteria 1122
170 Ga0439466_0164429 3300041411 Bacteria 678
171 Ga0451789_1319408 3300041443 Bacteria 1019
172 Ga0451837_0603095 3300041494 Bacteria 1438
173 Ga0451837_1301561 3300041494 Bacteria 955
174 Ga0451841_0092612 3300041498 Bacteria 725
175 Ga0451843_0953098 3300041509 Bacteria 889
176 Ga0451853_0211892 3300041512 Bacteria 1254
177 Ga0451853_0490855 3300041512 Bacteria 6155
178 Ga0451853_1580339 3300041512 Bacteria 2081
179 Ga0439433_0008791 3300041999 Bacteria 2195
180 Ga0439442_041904 3300042002 Bacteria 962
181 Ga0439448_0011854 3300042005 Bacteria 2600
182 Ga0439432_183324 3300042006 Bacteria 609
183 Ga0439449_0032393 3300042007 Bacteria 1948
184 Ga0439449_0099150 3300042007 Bacteria 1076
185 Ga0439450_038977 3300042008 Bacteria 1097
186 Ga0439457_000613 3300042014 Bacteria 10525
187 Ga0439457_001721 3300042014 Bacteria 6485
188 Ga0450894_000807 3300042131 Bacteria 5049
189 Ga0450896_000627 3300042133 Bacteria 3842
190 Ga0450898_008769 3300042134 Bacteria 1604
191 Ga0450899_000169 3300042135 Bacteria 6496
192 Ga0450902_054662 3300042137 Bacteria 687
193 Ga0450903_000046 3300042138 Bacteria 24085
194 Ga0450906_000464 3300042145 Bacteria 8490
195 Ga0439458_0004062 3300042157 Bacteria 3377
196 Ga0450908_038407 3300042184 Bacteria 830
197 Ga0450893_0103765 3300042532 Bacteria 581
198 Ga0466969_0003467 3300044656 Bacteria 8385
199 Ga0466969_0144300 3300044656 Bacteria 1099
200 Ga0466969_0168029 3300044656 Bacteria 1006
201 Ga0466972_0000856 3300044658 Bacteria 14601
202 Ga0466972_0012638 3300044658 Bacteria 4240
203 Ga0466965_0150425 3300044683 Bacteria 1216
204 Ga0466965_0516090 3300044683 Bacteria 671
205 Ga0466965_0608954 3300044683 Bacteria 621
206 Ga0466966_0003382 3300044684 Bacteria 10518
207 Ga0466966_0007385 3300044684 Bacteria 7289
208 Ga0466966_0173309 3300044684 Bacteria 1310
209 Ga0466961_0009126 3300044693 Bacteria 6316
210 Ga0466961_0041940 3300044693 Bacteria 2934
211 Ga0466961_0047806 3300044693 Bacteria 2735
212 Ga0466961_0165756 3300044693 Bacteria 1375
213 Ga0466963_0002539 3300044694 Bacteria 10223
214 Ga0466963_0004501 3300044694 Bacteria 8108
215 Ga0466971_0023115 3300044719 Bacteria 2770
216 Ga0466971_0141063 3300044719 Bacteria 1122
217 Ga0466971_0181142 3300044719 Bacteria 990
218 Ga0466968_0236056 3300044735 Bacteria 865
219 Ga0466970_0042533 3300044765 Bacteria 2416
220 Ga0466970_0212431 3300044765 Bacteria 1078
221 Ga0466970_0273866 3300044765 Bacteria 948
222 Ga0466970_0493555 3300044765 Bacteria 704
223 Ga0466957_0250516 3300044842 Bacteria 1177
224 Ga0466957_0496629 3300044842 Bacteria 845
225 Ga0466960_0022863 3300044901 Bacteria 2799
226 Ga0466959_0021880 3300045049 Bacteria 4722
227 Ga0466959_0226088 3300045049 Bacteria 1296
228 Ga0466959_0243481 3300045049 Bacteria 1241
229 Ga0466958_0019276 3300045836 Bacteria 3969
230 Ga0466967_0007504 3300045976 Bacteria 7875
231 Ga0466967_0254921 3300045976 Bacteria 1677
232 Ga0466967_0920919 3300045976 Bacteria 869
233 Ga0495627_028646 3300046453 Bacteria 1778
234 Ga0495592_0033363 3300046454 Bacteria 3883
235 Ga0495592_0036940 3300046454 Bacteria 3677
236 Ga0495603_0006352 3300046455 Bacteria 7071
237 Ga0495603_0038202 3300046455 Bacteria 2880
238 Ga0495603_0095012 3300046455 Bacteria 1741
239 Ga0495603_0195704 3300046455 Bacteria 1168
240 Ga0495590_0046480 3300046457 Bacteria 1514
241 Ga0495629_0029219 3300046459 Bacteria 3911
242 Ga0495629_0065494 3300046459 Bacteria 2536
243 Ga0495629_0162811 3300046459 Bacteria 1549
244 Ga0495629_0317896 3300046459 Bacteria 1064
245 Ga0495629_0825641 3300046459 Bacteria 610
246 Ga0495638_0009750 3300046460 Bacteria 6708
247 Ga0495638_0044492 3300046460 Bacteria 2796
248 Ga0495638_0291622 3300046460 Bacteria 882
249 Ga0495638_0394629 3300046460 Bacteria 719
250 Ga0495651_0030718 3300046462 Bacteria 4189
251 Ga0495651_0048941 3300046462 Bacteria 3263
252 Ga0495580_0138645 3300046472 Bacteria 1686
253 Ga0495605_0104447 3300046474 Bacteria 1298
254 Ga0495639_0086195 3300046475 Bacteria 1468
255 Ga0495662_0124218 3300046476 Bacteria 1267
256 Ga0495662_0348912 3300046476 Bacteria 727
257 Ga0495662_0381662 3300046476 Bacteria 692
258 Ga0495662_0650704 3300046476 Bacteria 514
259 Ga0495664_0149545 3300046477 Bacteria 1416
260 Ga0495584_0125757 3300046491 Bacteria 1299
261 Ga0495594_0022258 3300046499 Bacteria 3389
262 Ga0495594_0084940 3300046499 Bacteria 1770
263 Ga0495594_0115316 3300046499 Bacteria 1516
264 Ga0495594_0257265 3300046499 Bacteria 994
265 Ga0495596_0036541 3300046500 Bacteria 1945
266 Ga0495607_0040941 3300046501 Bacteria 2754
267 Ga0495606_0041254 3300046507 Bacteria 3095
268 Ga0495616_0030172 3300046513 Bacteria 2852
269 Ga0495618_0072653 3300046514 Bacteria 2189
270 Ga0495618_0245294 3300046514 Bacteria 1125
271 Ga0495620_0206742 3300046515 Bacteria 754
272 Ga0495628_0019731 3300046516 Bacteria 5570
273 Ga0495628_0751467 3300046516 Bacteria 685
274 Ga0495628_0901379 3300046516 Bacteria 613
275 Ga0495630_0088688 3300046517 Bacteria 2336
276 Ga0495631_0052433 3300046518 Bacteria 1781
277 Ga0495632_0328201 3300046519 Bacteria 675
278 Ga0495637_0039914 3300046520 Bacteria 2023
279 Ga0495643_0005160 3300046522 Bacteria 8920
280 Ga0495643_0107561 3300046522 Bacteria 1421
281 Ga0495648_0474817 3300046524 Bacteria 541
282 Ga0495642_0417812 3300046528 Bacteria 592
283 Ga0495652_0066063 3300046529 Bacteria 3037
284 Ga0495652_0073097 3300046529 Bacteria 2856
285 Ga0495654_0052156 3300046530 Bacteria 1993
286 Ga0495640_0010859 3300046533 Bacteria 7024
287 Ga0495640_0074440 3300046533 Bacteria 2271
288 Ga0495640_0177362 3300046533 Bacteria 1360
289 Ga0495587_0003878 3300046536 Bacteria 9922
290 Ga0495609_0026656 3300046538 Bacteria 2645
291 Ga0495597_0029329 3300046542 Bacteria 2512
292 Ga0495622_0032353 3300046557 Bacteria 2442
293 Ga0495622_0092576 3300046557 Bacteria 1388
294 Ga0495633_0028713 3300046558 Bacteria 2708
295 Ga0495667_0152104 3300046559 Bacteria 1490
296 Ga0495668_0376498 3300046616 Bacteria 779
297 Ga0495634_0025545 3300046642 Bacteria 4131
298 Ga0495611_0003810 3300046648 Bacteria 6578
299 Ga0495611_0087266 3300046648 Bacteria 1440
300 Ga0495625_0138882 3300046660 Bacteria 1640
301 Ga0495635_0032901 3300046663 Bacteria 3596
302 Ga0495635_0285726 3300046663 Bacteria 1108
303 Ga0495659_0251362 3300046664 Bacteria 737
304 Ga0495661_0468870 3300046665 Bacteria 604
305 Ga0495588_0014001 3300046674 Bacteria 3832
306 Ga0495588_0093011 3300046674 Bacteria 1580
307 Ga0495588_0272043 3300046674 Bacteria 892
308 Ga0495657_0002935 3300046675 Bacteria 14138
309 Ga0495657_0043952 3300046675 Bacteria 3042
310 Ga0495599_0862752 3300046678 Bacteria 514
311 Ga0495623_0667768 3300046679 Bacteria 535
312 Ga0495646_0001643 3300046680 Bacteria 13336
313 Ga0495658_0007199 3300046683 Bacteria 5496
314 Ga0495613_0014244 3300046689 Bacteria 5901
315 Ga0495613_0053918 3300046689 Bacteria 2956
316 Ga0495613_0282576 3300046689 Bacteria 1152
317 Ga0495613_0287042 3300046689 Bacteria 1141
318 Ga0495613_0442453 3300046689 Bacteria 881
319 Ga0495624_0163850 3300046690 Bacteria 1357
320 Ga0495624_0333191 3300046690 Bacteria 913
321 Ga0495624_0722654 3300046690 Bacteria 590
322 Ga0495670_0024416 3300046691 Bacteria 2987
323 Ga0495670_0085986 3300046691 Bacteria 1605
324 Ga0495671_0070870 3300046692 Bacteria 1712
325 Ga0495649_0123737 3300046694 Bacteria 1366
326 Ga0495649_0193527 3300046694 Bacteria 1058
327 Ga0495589_0058900 3300046794 Bacteria 1888
328 Ga0495589_0184953 3300046794 Bacteria 987
329 Ga0495589_0200681 3300046794 Bacteria 941
330 Ga0495589_0323393 3300046794 Bacteria 712
331 Ga0495600_0002980 3300046809 Bacteria 9880
332 Ga0495600_0010512 3300046809 Bacteria 5748
333 Ga0495600_0587765 3300046809 Bacteria 677
334 Ga0495660_0085225 3300046810 Bacteria 1651
335 Ga0495660_0139744 3300046810 Bacteria 1206
336 Ga0495581_0048759 3300047315 Bacteria 2445
337 Ga0495581_0088443 3300047315 Bacteria 1796
338 Ga0495581_0212672 3300047315 Bacteria 1130
339 Ga0495581_0322925 3300047315 Bacteria 902
340 Ga0495604_0002330 3300047317 Bacteria 15212
341 Ga0495636_0229125 3300047318 Bacteria 854
342 Ga0495674_0163005 3300047319 Bacteria 1864
343 Ga0495672_0081248 3300047320 Bacteria 1805
344 Ga0495676_0004289 3300047321 Bacteria 13019
345 Ga0495676_0004409 3300047321 Bacteria 12868
346 Ga0495676_0029226 3300047321 Bacteria 4695
347 Ga0495676_0049427 3300047321 Bacteria 3381
348 Ga0495676_0084656 3300047321 Bacteria 2392
349 Ga0495676_0283752 3300047321 Bacteria 1120
350 Ga0495676_0289283 3300047321 Bacteria 1107
351 Ga0495683_0038000 3300047323 Bacteria 2438
352 Ga0495687_002181 3300047443 Bacteria 16294
353 Ga0495687_009612 3300047443 Bacteria 5385
354 Ga0495687_045737 3300047443 Bacteria 1893
355 Ga0495687_140747 3300047443 Bacteria 839
356 Ga0495675_0051898 3300047444 Bacteria 2604
357 Ga0495675_0222769 3300047444 Bacteria 1141
358 Ga0495677_0035866 3300047445 Bacteria 1810
359 Ga0495679_109172 3300047446 Bacteria 762
360 Ga0495685_000258 3300047447 Bacteria 18267
361 Ga0495685_006768 3300047447 Bacteria 3765
362 Ga0495685_049117 3300047447 Bacteria 1433
363 Ga0495685_172357 3300047447 Bacteria 698
364 Ga0495681_0001206 3300047470 Bacteria 19657
365 Ga0495684_0514041 3300047471 Bacteria 821
366 Ga0495686_0098686 3300047472 Bacteria 1764
367 Ga0495686_0328566 3300047472 Bacteria 836
368 Ga0495686_0452791 3300047472 Bacteria 682
369 Ga0495593_0033838 3300047673 Bacteria 2781
370 Ga0495593_0245963 3300047673 Bacteria 896
371 Ga0495593_0420379 3300047673 Bacteria 669
372 Ga0495614_0065220 3300048089 Bacteria 1566
373 Ga0495614_0093641 3300048089 Bacteria 1308
374 Ga0495614_0469582 3300048089 Bacteria 596
375 Ga0495614_0663271 3300048089 Bacteria 503
376 Ga0495615_0314131 3300048090 Bacteria 510
377 Ga0495626_0025863 3300048091 Bacteria 2866
378 Ga0496102_0865084 3300048905 Bacteria 826
379 Ga0496106_0186212 3300048909 Bacteria 1649
380 Ga0496110_1847591 3300048913 Bacteria 514
381 Ga0496126_1209159 3300048929 Unclassified 555
382 Ga0501306_003717 3300049127 Bacteria 1662
383 Ga0501306_015608 3300049127 Bacteria 1013
384 Ga0501306_017192 3300049127 Bacteria 979
385 Ga0501308_022690 3300049128 Bacteria 796
386 Ga0501309_015852 3300049129 Bacteria 1023
387 Ga0501309_089010 3300049129 Bacteria 525
388 Ga0501310_011967 3300049130 Bacteria 989
389 Ga0501310_029261 3300049130 Bacteria 725
390 Ga0495678_028156 3300049459 Bacteria 2375
391 Ga0501311_007147 3300049527 Bacteria 1280
392 Ga0501311_014213 3300049527 Bacteria 1014
393 Ga0501312_019319 3300049528 Bacteria 1000
394 Ga0501312_021894 3300049528 Bacteria 955
395 Ga0501313_029467 3300049529 Bacteria 707
396 Ga0501315_013840 3300049531 Bacteria 1015
397 Ga0501315_027060 3300049531 Bacteria 807
398 Ga0501316_066473 3300049532 Bacteria 540
399 Ga0501317_005396 3300049533 Bacteria 1368
400 Ga0501317_008083 3300049533 Bacteria 1204
401 Ga0501318_004481 3300049534 Bacteria 1341
402 Ga0501318_005240 3300049534 Bacteria 1277
403 Ga0501318_018940 3300049534 Bacteria 855
404 Ga0501319_002258 3300049535 Bacteria 1207
405 Ga0501320_005888 3300049536 Bacteria 1132
406 Ga0501320_008684 3300049536 Bacteria 1004
407 Ga0501320_011503 3300049536 Bacteria 918
408 Ga0501321_006255 3300049537 Bacteria 1205
409 Ga0501322_017773 3300049538 Bacteria 605
410 Ga0501323_007984 3300049539 Bacteria 1220
411 Ga0501323_013342 3300049539 Bacteria 1015
412 Ga0501323_024234 3300049539 Bacteria 819
413 Ga0501323_025022 3300049539 Bacteria 810
414 Ga0501323_065089 3300049539 Bacteria 575
415 Ga0501324_007747 3300049540 Bacteria 933
416 Ga0501324_009205 3300049540 Bacteria 882
417 Ga0501324_034136 3300049540 Bacteria 564
418 Ga0501325_002795 3300049541 Bacteria 1224
419 Ga0501031_0001063 3300049568 Bacteria 16659
420 Ga0501031_0036778 3300049568 Bacteria 3194
421 Ga0501031_0150345 3300049568 Bacteria 1521
422 Ga0501031_0174982 3300049568 Bacteria 1402
423 Ga0501031_0249599 3300049568 Bacteria 1153
424 Ga0501031_0508101 3300049568 Bacteria 777
425 Ga0501032_0006508 3300049569 Bacteria 8585
426 Ga0501032_0011853 3300049569 Bacteria 6245
427 Ga0501032_0137594 3300049569 Bacteria 1609
428 Ga0501032_0622955 3300049569 Bacteria 686
429 Ga0501032_0715263 3300049569 Bacteria 634
430 Ga0501033_0004692 3300049570 Bacteria 10937
431 Ga0501033_0045310 3300049570 Bacteria 3273
432 Ga0501033_0356771 3300049570 Bacteria 1023
433 Ga0501033_0673618 3300049570 Bacteria 705
434 Ga0501033_0835326 3300049570 Bacteria 621
435 Ga0501034_0002413 3300049571 Bacteria 22626
436 Ga0501034_0004049 3300049571 Bacteria 16445
437 Ga0501034_0021980 3300049571 Bacteria 6499
438 Ga0501034_0050260 3300049571 Bacteria 4205
439 Ga0501034_0061146 3300049571 Bacteria 3783
440 Ga0501034_0232847 3300049571 Bacteria 1790
441 Ga0501034_0795472 3300049571 Bacteria 839
442 Ga0501036_0002141 3300049572 Bacteria 15410
443 Ga0501036_0002186 3300049572 Bacteria 15263
444 Ga0501036_0013951 3300049572 Bacteria 6681
445 Ga0501036_0060745 3300049572 Bacteria 3201
446 Ga0501036_0097141 3300049572 Bacteria 2490
447 Ga0501036_0135291 3300049572 Bacteria 2080
448 Ga0501036_1166549 3300049572 Bacteria 628
449 Ga0501037_0002849 3300049573 Bacteria 12534
450 Ga0501037_0009060 3300049573 Bacteria 7294
451 Ga0501037_0031541 3300049573 Bacteria 3912
452 Ga0501037_0085798 3300049573 Bacteria 2279
453 Ga0501037_0252346 3300049573 Bacteria 1234
454 Ga0501037_0318079 3300049573 Bacteria 1078
455 Ga0501037_0511632 3300049573 Bacteria 813
456 Ga0501038_0008847 3300049574 Bacteria 9238
457 Ga0501038_0015266 3300049574 Bacteria 6983
458 Ga0501038_0023267 3300049574 Bacteria 5541
459 Ga0501038_0232812 3300049574 Bacteria 1465
460 Ga0501038_0529590 3300049574 Bacteria 898
461 Ga0501038_0680283 3300049574 Bacteria 772
462 Ga0501039_0002709 3300049575 Bacteria 13220
463 Ga0501039_0040935 3300049575 Bacteria 3577
464 Ga0501040_0016468 3300049576 Bacteria 4894
465 Ga0501041_0014510 3300049577 Bacteria 4679
466 Ga0501042_0002745 3300049578 Bacteria 10860
467 Ga0501042_0042276 3300049578 Bacteria 3243
468 Ga0501043_0000622 3300049579 Bacteria 31276
469 Ga0501043_0002135 3300049579 Bacteria 16882
470 Ga0501043_0014191 3300049579 Bacteria 6234
471 Ga0501043_0060149 3300049579 Bacteria 2981
472 Ga0501046_0001707 3300049580 Bacteria 20974
473 Ga0501046_0008676 3300049580 Bacteria 8834
474 Ga0501046_0101912 3300049580 Bacteria 2201
475 Ga0501046_0325413 3300049580 Bacteria 1119
476 Ga0501046_0716152 3300049580 Bacteria 704
477 Ga0501047_0000182 3300049581 Bacteria 76846
478 Ga0501047_0000248 3300049581 Bacteria 63961
479 Ga0501047_0018108 3300049581 Bacteria 6750
480 Ga0501047_0031371 3300049581 Bacteria 5125
481 Ga0501047_0050702 3300049581 Bacteria 4008
482 Ga0501047_0062942 3300049581 Bacteria 3578
483 Ga0501047_0423784 3300049581 Bacteria 1162
484 Ga0501047_0676120 3300049581 Bacteria 850
485 Ga0501048_0003271 3300049582 Bacteria 12342
486 Ga0501048_0052749 3300049582 Bacteria 2894
487 Ga0501048_1316060 3300049582 Bacteria 519
488 Ga0501067_0003554 3300049583 Bacteria 8578
489 Ga0501067_0261861 3300049583 Bacteria 963
490 Ga0501068_0000719 3300049584 Bacteria 16975
491 Ga0501068_0313739 3300049584 Bacteria 1005
492 Ga0501070_0006632 3300049586 Bacteria 9852
493 Ga0501070_0012050 3300049586 Bacteria 7297
494 Ga0501070_0043686 3300049586 Bacteria 3729
495 Ga0501070_0855707 3300049586 Bacteria 711
496 Ga0501070_0861727 3300049586 Bacteria 708
497 Ga0501071_0000025 3300049587 Bacteria 49332
498 Ga0501072_0000410 3300049588 Bacteria 30636
499 Ga0501072_0972483 3300049588 Bacteria 662
500 Ga0501073_0139717 3300049589 Bacteria 1678
501 Ga0501073_0167170 3300049589 Bacteria 1523
502 Ga0501073_0415757 3300049589 Bacteria 929
503 Ga0501074_0014815 3300049590 Bacteria 5670
504 Ga0501074_0094143 3300049590 Bacteria 2145
505 Ga0501077_0001957 3300049593 Bacteria 12453
506 Ga0501079_0032626 3300049741 Bacteria 4004
507 Ga0501079_0988032 3300049741 Bacteria 663
508 Ga0501080_0002814 3300049742 Bacteria 15291
509 Ga0501083_0000422 3300049744 Bacteria 27169
510 Ga0501282_002722 3300049778 Bacteria 1913
511 Ga0501035_0000416 3300049822 Bacteria 48248
512 Ga0501035_0002470 3300049822 Bacteria 18053
513 Ga0501035_0002656 3300049822 Bacteria 17390
514 Ga0501035_0006603 3300049822 Bacteria 10857
515 Ga0501035_0023041 3300049822 Bacteria 5715
516 Ga0501035_0038021 3300049822 Bacteria 4357
517 Ga0501035_0058146 3300049822 Bacteria 3446
518 Ga0501035_0096680 3300049822 Bacteria 2594
519 Ga0501035_0606436 3300049822 Bacteria 891
520 Ga0501035_0765940 3300049822 Bacteria 773
521 Ga0501044_0001535 3300049823 Bacteria 27090
522 Ga0501044_0008206 3300049823 Bacteria 11459
523 Ga0501044_0009479 3300049823 Bacteria 10601
524 Ga0501044_0040369 3300049823 Bacteria 4863
525 Ga0501044_0129060 3300049823 Bacteria 2523
526 Ga0501044_0364058 3300049823 Bacteria 1363
527 Ga0501044_0903107 3300049823 Bacteria 758
528 Ga0501044_1183657 3300049823 Bacteria 632
529 Ga0501044_1581423 3300049823 Bacteria 520
530 Ga0501045_0001009 3300049824 Bacteria 18478
531 Ga0501045_0195359 3300049824 Bacteria 1508
532 Ga0501045_0365317 3300049824 Bacteria 1074
533 Ga0501045_0648470 3300049824 Bacteria 780
534 nmdc:mga03n38_14633_c1 3300050490 Bacteria 3012
535 nmdc:mga03n38_671493_c1 3300050490 Bacteria 595
536 nmdc:mga0yw44_39781_c1 3300050492 Bacteria 2790
537 nmdc:mga06z11_260534_c1 3300050494 Bacteria 1023
538 nmdc:mga06z11_2689_c1 3300050494 Bacteria 6804
539 nmdc:mga04h51_38167_c1 3300050495 Bacteria 1554
540 nmdc:mga07m45_10260_c1 3300050496 Bacteria 4887
541 nmdc:mga07m45_302064_c1 3300050496 Bacteria 931
542 Ga0495655_0083228 3300053083 Bacteria 919
543 Ga0495655_0238366 3300053083 Bacteria 608
544 Ga0500578_0015819 3300053086 Bacteria 4843
545 Ga0500647_0403925 3300053091 Bacteria 553
546 Ga0500583_0147570 3300053092 Bacteria 1170
547 Ga0500566_0062625 3300053094 Bacteria 2102
548 Ga0500640_001709 3300053095 Bacteria 6841
549 Ga0500654_029379 3300053099 Bacteria 3338
550 Ga0500660_062614 3300053100 Bacteria 1784
551 Ga0500660_125738 3300053100 Bacteria 1056
552 Ga0500553_078599 3300053101 Bacteria 1493
553 Ga0500560_030100 3300053107 Bacteria 1633
554 Ga0500569_024007 3300053109 Bacteria 1645
555 Ga0500608_149342 3300053122 Bacteria 1026
556 Ga0500628_001962 3300053129 Bacteria 3458
557 Ga0500652_022031 3300053131 Bacteria 2407
558 Ga0500658_0423978 3300053134 Bacteria 607
559 Ga0500561_0001570 3300053137 Bacteria 3727
560 Ga0500573_0052596 3300053140 Bacteria 2341
561 Ga0500579_077488 3300053143 Bacteria 1880
562 Ga0500590_311945 3300053148 Bacteria 585
563 Ga0500600_0016706 3300053149 Bacteria 4439
564 Ga0500600_0286062 3300053149 Bacteria 715
565 Ga0500616_0006235 3300053153 Bacteria 7865
566 Ga0500633_0003334 3300053160 Bacteria 3488
567 Ga0500634_0027131 3300053161 Bacteria 3120
568 Ga0500636_0520146 3300053177 Bacteria 521
569 Ga0500565_002669 3300053734 Bacteria 1351
570 Ga0500587_000159 3300053739 Bacteria 6630
571 Ga0501084_0011064 3300054114 Bacteria 7471
572 Ga0587082_131938 3300059504 Bacteria 575
573 Ga0587090_051002 3300059510 Bacteria 758
574 Ga0587106_019813 3300059605 Bacteria 986
575 Ga0587115_041165 3300059626 Bacteria 722
576 Ga0501082_0007246 3300060353 Bacteria 9566
577 Ga0466962_0023780 3300061719 Bacteria 2944
578 Ga0466962_0028751 3300061719 Bacteria 2662
579 2547406514 2547132111 Bacteria 8013147
580 2554259563 2554235005 Bacteria 6457341
581 2585300375 2582581312 Bacteria 7308206
582 2585303511 2582581313 Bacteria 10042643
583 2585316994 2582581314 Bacteria 11452267
584 2616695604 2616644814 Bacteria 11555299
585 2616900842 2616644941 Bacteria 8510691
586 2643760231 2643221548 Bacteria 8053412
587 2643904471 2643221578 Bacteria 9213798
588 2643946568 2643221587 Bacteria 7586415
589 2644268002 2643221647 Bacteria 10741251
590 2644389080 2643221670 Bacteria 6497041
591 2644406261 2643221673 Bacteria 9196637
592 2644434372 2643221677 Bacteria 7584031
593 2644443678 2643221678 Bacteria 9540101
594 2644460073 2643221682 Bacteria 6743283
595 2644629608 2643221714 Bacteria 9015452
596 2784586731 2784132148 Bacteria 8627943
597 2785345755 2784746763 Bacteria 9783172
598 2785367134 2784746768 Bacteria 10036182
599 2786668182 2786546132 Bacteria 10419719
600 2793976637 2791355406 Bacteria 11364898
601 2804843716 2802429296 Bacteria 7227771
602 2808847640 2808606359 Bacteria 9866990
603 2808918374 2808606375 Bacteria 9466072
604 2809230298 2808606448 Bacteria 8656184
605 2811846950 2808606982 Bacteria 7791042
606 2812360335 2811994879 Bacteria 9313447
607 2819696350 2818991463 Bacteria 7948711
608 2852637694 2852635781 Bacteria 8251373
609 2862186267 2862178590 Bacteria 8583590
610 2862289678 2862281513 Bacteria 9621493
611 2862292448 2862290372 Bacteria 7471434
612 2862386975 2862382967 Bacteria 10317375
613 2862510401 2862507626 Bacteria 9425308
614 2862583737 2862574272 Bacteria 10567477
615 2862711231 2862705112 Bacteria 6563286
616 2863406990 2863404153 Bacteria 9672205
617 2867346816 2867346516 Bacteria 7608576
618 2867369836 2867369537 Bacteria 6501581
619 2867430061 2867428634 Bacteria 9590268
620 2867475684 2867475112 Bacteria 6909112
621 2873157698 2873151551 Bacteria 8625867
622 2875392675 2875391855 Bacteria 7600475
623 2877683412 2877676314 Bacteria 9512378
624 2912722419 2912715099 Bacteria 9460473
625 2912726123 2912723979 Bacteria 8557534
626 2912758873 2912757875 Bacteria 7940295
627 2918502502 2918501144 Bacteria 8668083
628 2919472211 2919468124 Bacteria 9133025
629 2946052039 2946045630 Bacteria 8527308
630 2946065553 2946064051 Bacteria 8957905
631 2946073914 2946072368 Bacteria 8999607
632 2947231856 2947224130 Bacteria 9938529
633 2954011090 2954002825 Bacteria 9173742
634 2954388659 2954380949 Bacteria 10050426
635 2954674465 2954673503 Bacteria 9685905
636 2954689667 2954682443 Bacteria 9862841
637 2954699450 2954691527 Bacteria 10720516
638 2954702768 2954701450 Bacteria 10834262
639 2954718390 2954711539 Bacteria 10867210
640 2954728360 2954721474 Bacteria 10456478
641 2954733449 2954731030 Bacteria 10243860
642 2954747256 2954740390 Bacteria 10229294
643 2954752332 2954749733 Bacteria 10366972
644 2954766371 2954759201 Bacteria 9358192
645 2966604435 2966598605 Bacteria 7676064
646 2990045848 2990044586 Bacteria 6603797
647 2990059594 2990059506 Bacteria 9321252
648 2995469375 2995463766 Bacteria 8577691
649 2997453992 2997451912 Bacteria 8492419
650 2997605692 2997600082 Bacteria 9896405
651 3006328030 3006321560 Bacteria 8247479
652 3006399558 3006393351 Bacteria 6615579
653 3006430690 3006425503 Bacteria 6491253
654 3006490460 3006486233 Bacteria 8157040
655 3006495135 3006493962 Bacteria 8825450
656 8008486582 8008485437 Bacteria 7198341
657 8008561295 8008558824 Bacteria 10610750
658 8008580767 8008574985 Bacteria 7815457
659 8023625009 8023623736 Bacteria 8593882
660 8025414828 8025413630 Bacteria 7014048
661 8025484321 8025478263 Bacteria 8209203
662 8025525651 8025524527 Bacteria 7197316
663 8025534175 8025530807 Bacteria 8495698
664 8033685009 8033684223 Bacteria 6906479
665 8047894829 8047893842 Bacteria 11723082
666 8048130385 8048127548 Bacteria 11053136
667 8048364220 8048356638 Bacteria 11044339
668 8048371848 8048369669 Bacteria 11666822
669 8048380781 8048379754 Bacteria 11877923
670 8048408148 8048406513 Bacteria 8936924
671 8054163831 8054160619 Bacteria 7783213
672 8056449966 8056447290 Bacteria 7680491
673 8056670551 8056667051 Bacteria 6953971
674 8056835720 8056829672 Bacteria 9045328
675 Ga0213876_10396322
676 JGI24739J22299_10055804
677 JGI24737J22298_10116431
678 JGI24735J21928_10032874
679 JGI24738J21930_10025858
680 Ga0006759J45824_1032939
681 Ga0006777J48905_1036155
682 rootH1_10031237
683 rootH2_10034114
684 rootH1_10040758
685 JGI25160J50197_1065056
686 Ga0007429J51699_1015681
687 Ga0032354_1035482
688 Ga0058860_12012580
689 Ga0070668_100962204
690 Ga0070713_100892576
691 Ga0070700_100621755
692 Ga0070663_100024046
693 Ga0070663_100402752
694 Ga0070678_100623914
695 Ga0070685_10858566
696 Ga0068853_100286515
697 Ga0070665_100026333
698 Ga0070665_100255573
699 Ga0068855_100157186
700 Ga0068854_100104955
701 Ga0068856_100019950
702 Ga0068856_100155350
703 Ga0081455_10008729
704 Ga0070717_10824194
705 Ga0075365_10290836
706 Ga0075368_10014916
707 Ga0075363_100119550
708 Ga0075367_10026522
709 Ga0075370_10211348
710 Ga0068871_100934239
711 Ga0105251_10010987
712 Ga0105251_10163052
713 Ga0105250_10041818
714 Ga0105240_10105251
715 Ga0105240_10185075
716 Ga0105240_10568995
717 Ga0105245_10950677
718 Ga0105243_10068550
719 Ga0105243_10250429
720 Ga0105241_11598753
721 Ga0105242_10965277
722 Ga0105237_10092682
723 Ga0105238_10101763
724 Ga0105238_10172196
725 Ga0105238_11850257
726 Ga0105249_10577177
727 Ga0105239_10216162
728 Ga0105239_12541863
729 Ga0105246_10048719
730 Ga0105246_10237725
731 Ga0157373_10430037
732 Ga0157370_10077839
733 Ga0157369_10149368
734 Ga0157378_11770451
735 Ga0157372_10354375
736 Ga0157372_13053094
737 Ga0163163_11743996
738 Ga0182008_10000988
739 Ga0157376_10813856
740 Ga0182007_10003459
741 Ga0183367_1017
742 Ga0197907_11334973
743 Ga0206356_11574620
744 Ga0206355_1211322
745 Ga0206352_10491978
746 Ga0213873_10022928
747 Ga0213874_10024878
748 Ga0213874_10054339
749 Ga0213876_10007819
750 Ga0213875_10000006
751 Ga0213875_10000864
752 Ga0213875_10000915
753 Ga0213875_10001927
754 Ga0213875_10166490
755 Ga0213875_10317748
756 Ga0224712_10456910
757 Ga0256744_126621
758 Ga0209758_1013065
759 Ga0207426_1002709
760 Ga0207426_1030467
761 Ga0207713_1025206
762 Ga0207647_10032063
763 Ga0207695_10099559
764 Ga0207695_10451202
765 Ga0207694_10361151
766 Ga0207694_11224802
767 Ga0207687_10501973
768 Ga0207709_10511310
769 Ga0207709_10875260
770 Ga0207691_10867973
771 Ga0207667_10323303
772 Ga0207668_11148783
773 Ga0207678_10964334
774 Ga0207702_10032363
775 Ga0207702_10288721
776 Ga0207676_11377523
777 Ga0209371_1034607
778 Ga0209813_10017281
779 Ga0268266_10071701
780 Ga0268266_10075196
781 Ga0268266_11092176
782 Ga0307517_10006575
783 Ga0307517_10006948
784 Ga0307515_10002608
785 Ga0307515_10160601
786 Ga0307515_10656761
787 Ga0310981_1040932
788 Ga0268256_1036724
789 Ga0307511_10004244
790 Ga0307511_10373286
791 Ga0307512_10236493
792 Ga0307512_10343552
793 Ga0307513_10023135
794 Ga0307513_10080246
795 Ga0307513_10460710
796 Ga0307509_10178836
797 Ga0307508_10001597
798 Ga0307508_10117503
799 Ga0307508_10451782
800 Ga0307514_10003022
801 Ga0307514_10252073
802 Ga0307514_10435850
803 Ga0307516_10017360
804 Ga0307516_10450024
805 Ga0307516_10557730
806 Ga0307518_10514525
807 Ga0307409_100395735
808 Ga0307416_100475213
809 Ga0307507_10272018
810 Ga0307510_10092342
811 Ga0307510_10108802
812 Ga0307510_10121579
813 Ga0307510_10484548
814 Ga0395898_1042758
815 Ga0436364_0056406
816 Ga0436364_0244345
817 Ga0436364_0270098
818 Ga0436364_0478514
819 Ga0436364_0510827
820 Ga0436364_0556898
821 Ga0436364_0846682
822 Ga0436364_0883683
823 Ga0436364_1382991
824 Ga0436364_1494813
825 Ga0395901_0157962
826 Ga0436365_0674457
827 Ga0436365_0965826
828 Ga0436365_1169743
829 Ga0436365_1859987
830 Ga0436360_0895846
831 Ga0436363_0075268
832 Ga0436363_0723725
833 Ga0436363_0782860
834 Ga0436363_0831071
835 Ga0436362_0161559
836 Ga0436362_0460211
837 Ga0436362_0905448
838 Ga0439436_0031145
839 Ga0439438_153303
840 Ga0439439_0004399
841 Ga0439439_0042543
842 Ga0439439_0047432
843 Ga0439466_0164429
844 Ga0451789_1319408
845 Ga0451837_0603095
846 Ga0451837_1301561
847 Ga0451841_0092612
848 Ga0451843_0953098
849 Ga0451853_0211892
850 Ga0451853_0490855
851 Ga0451853_1580339
852 Ga0439433_0008791
853 Ga0439442_041904
854 Ga0439448_0011854
855 Ga0439432_183324
856 Ga0439449_0032393
857 Ga0439449_0099150
858 Ga0439450_038977
859 Ga0439457_000613
860 Ga0439457_001721
861 Ga0450894_000807
862 Ga0450896_000627
863 Ga0450898_008769
864 Ga0450899_000169
865 Ga0450902_054662
866 Ga0450903_000046
867 Ga0450906_000464
868 Ga0439458_0004062
869 Ga0450908_038407
870 Ga0450893_0103765
871 Ga0466969_0003467
872 Ga0466969_0144300
873 Ga0466969_0168029
874 Ga0466972_0000856
875 Ga0466972_0012638
876 Ga0466965_0150425
877 Ga0466965_0516090
878 Ga0466965_0608954
879 Ga0466966_0003382
880 Ga0466966_0007385
881 Ga0466966_0173309
882 Ga0466961_0009126
883 Ga0466961_0041940
884 Ga0466961_0047806
885 Ga0466961_0165756
886 Ga0466963_0002539
887 Ga0466963_0004501
888 Ga0466971_0023115
889 Ga0466971_0141063
890 Ga0466971_0181142
891 Ga0466968_0236056
892 Ga0466970_0042533
893 Ga0466970_0212431
894 Ga0466970_0273866
895 Ga0466970_0493555
896 Ga0466957_0250516
897 Ga0466957_0496629
898 Ga0466960_0022863
899 Ga0466959_0021880
900 Ga0466959_0226088
901 Ga0466959_0243481
902 Ga0466958_0019276
903 Ga0466967_0007504
904 Ga0466967_0254921
905 Ga0466967_0920919
906 Ga0495627_028646
907 Ga0495592_0033363
908 Ga0495592_0036940
909 Ga0495603_0006352
910 Ga0495603_0038202
911 Ga0495603_0095012
912 Ga0495603_0195704
913 Ga0495590_0046480
914 Ga0495629_0029219
915 Ga0495629_0065494
916 Ga0495629_0162811
917 Ga0495629_0317896
918 Ga0495629_0825641
919 Ga0495638_0009750
920 Ga0495638_0044492
921 Ga0495638_0291622
922 Ga0495638_0394629
923 Ga0495651_0030718
924 Ga0495651_0048941
925 Ga0495580_0138645
926 Ga0495605_0104447
927 Ga0495639_0086195
928 Ga0495662_0124218
929 Ga0495662_0348912
930 Ga0495662_0381662
931 Ga0495662_0650704
932 Ga0495664_0149545
933 Ga0495584_0125757
934 Ga0495594_0022258
935 Ga0495594_0084940
936 Ga0495594_0115316
937 Ga0495594_0257265
938 Ga0495596_0036541
939 Ga0495607_0040941
940 Ga0495606_0041254
941 Ga0495616_0030172
942 Ga0495618_0072653
943 Ga0495618_0245294
944 Ga0495620_0206742
945 Ga0495628_0019731
946 Ga0495628_0751467
947 Ga0495628_0901379
948 Ga0495630_0088688
949 Ga0495631_0052433
950 Ga0495632_0328201
951 Ga0495637_0039914
952 Ga0495643_0005160
953 Ga0495643_0107561
954 Ga0495648_0474817
955 Ga0495642_0417812
956 Ga0495652_0066063
957 Ga0495652_0073097
958 Ga0495654_0052156
959 Ga0495640_0010859
960 Ga0495640_0074440
961 Ga0495640_0177362
962 Ga0495587_0003878
963 Ga0495609_0026656
964 Ga0495597_0029329
965 Ga0495622_0032353
966 Ga0495622_0092576
967 Ga0495633_0028713
968 Ga0495667_0152104
969 Ga0495668_0376498
970 Ga0495634_0025545
971 Ga0495611_0003810
972 Ga0495611_0087266
973 Ga0495625_0138882
974 Ga0495635_0032901
975 Ga0495635_0285726
976 Ga0495659_0251362
977 Ga0495661_0468870
978 Ga0495588_0014001
979 Ga0495588_0093011
980 Ga0495588_0272043
981 Ga0495657_0002935
982 Ga0495657_0043952
983 Ga0495599_0862752
984 Ga0495623_0667768
985 Ga0495646_0001643
986 Ga0495658_0007199
987 Ga0495613_0014244
988 Ga0495613_0053918
989 Ga0495613_0282576
990 Ga0495613_0287042
991 Ga0495613_0442453
992 Ga0495624_0163850
993 Ga0495624_0333191
994 Ga0495624_0722654
995 Ga0495670_0024416
996 Ga0495670_0085986
997 Ga0495671_0070870
998 Ga0495649_0123737
999 Ga0495649_0193527
1000 Ga0495589_0058900
1001 Ga0495589_0184953
1002 Ga0495589_0200681
1003 Ga0495589_0323393
1004 Ga0495600_0002980
1005 Ga0495600_0010512
1006 Ga0495600_0587765
1007 Ga0495660_0085225
1008 Ga0495660_0139744
1009 Ga0495581_0048759
1010 Ga0495581_0088443
1011 Ga0495581_0212672
1012 Ga0495581_0322925
1013 Ga0495604_0002330
1014 Ga0495636_0229125
1015 Ga0495674_0163005
1016 Ga0495672_0081248
1017 Ga0495676_0004289
1018 Ga0495676_0004409
1019 Ga0495676_0029226
1020 Ga0495676_0049427
1021 Ga0495676_0084656
1022 Ga0495676_0283752
1023 Ga0495676_0289283
1024 Ga0495683_0038000
1025 Ga0495687_002181
1026 Ga0495687_009612
1027 Ga0495687_045737
1028 Ga0495687_140747
1029 Ga0495675_0051898
1030 Ga0495675_0222769
1031 Ga0495677_0035866
1032 Ga0495679_109172
1033 Ga0495685_000258
1034 Ga0495685_006768
1035 Ga0495685_049117
1036 Ga0495685_172357
1037 Ga0495681_0001206
1038 Ga0495684_0514041
1039 Ga0495686_0098686
1040 Ga0495686_0328566
1041 Ga0495686_0452791
1042 Ga0495593_0033838
1043 Ga0495593_0245963
1044 Ga0495593_0420379
1045 Ga0495614_0065220
1046 Ga0495614_0093641
1047 Ga0495614_0469582
1048 Ga0495614_0663271
1049 Ga0495615_0314131
1050 Ga0495626_0025863
1051 Ga0496102_0865084
1052 Ga0496106_0186212
1053 Ga0496110_1847591
1054 Ga0496126_1209159
1055 Ga0501306_003717
1056 Ga0501306_015608
1057 Ga0501306_017192
1058 Ga0501308_022690
1059 Ga0501309_015852
1060 Ga0501309_089010
1061 Ga0501310_011967
1062 Ga0501310_029261
1063 Ga0495678_028156
1064 Ga0501311_007147
1065 Ga0501311_014213
1066 Ga0501312_019319
1067 Ga0501312_021894
1068 Ga0501313_029467
1069 Ga0501315_013840
1070 Ga0501315_027060
1071 Ga0501316_066473
1072 Ga0501317_005396
1073 Ga0501317_008083
1074 Ga0501318_004481
1075 Ga0501318_005240
1076 Ga0501318_018940
1077 Ga0501319_002258
1078 Ga0501320_005888
1079 Ga0501320_008684
1080 Ga0501320_011503
1081 Ga0501321_006255
1082 Ga0501322_017773
1083 Ga0501323_007984
1084 Ga0501323_013342
1085 Ga0501323_024234
1086 Ga0501323_025022
1087 Ga0501323_065089
1088 Ga0501324_007747
1089 Ga0501324_009205
1090 Ga0501324_034136
1091 Ga0501325_002795
1092 Ga0501031_0001063
1093 Ga0501031_0036778
1094 Ga0501031_0150345
1095 Ga0501031_0174982
1096 Ga0501031_0249599
1097 Ga0501031_0508101
1098 Ga0501032_0006508
1099 Ga0501032_0011853
1100 Ga0501032_0137594
1101 Ga0501032_0622955
1102 Ga0501032_0715263
1103 Ga0501033_0004692
1104 Ga0501033_0045310
1105 Ga0501033_0356771
1106 Ga0501033_0673618
1107 Ga0501033_0835326
1108 Ga0501034_0002413
1109 Ga0501034_0004049
1110 Ga0501034_0021980
1111 Ga0501034_0050260
1112 Ga0501034_0061146
1113 Ga0501034_0232847
1114 Ga0501034_0795472
1115 Ga0501036_0002141
1116 Ga0501036_0002186
1117 Ga0501036_0013951
1118 Ga0501036_0060745
1119 Ga0501036_0097141
1120 Ga0501036_0135291
1121 Ga0501036_1166549
1122 Ga0501037_0002849
1123 Ga0501037_0009060
1124 Ga0501037_0031541
1125 Ga0501037_0085798
1126 Ga0501037_0252346
1127 Ga0501037_0318079
1128 Ga0501037_0511632
1129 Ga0501038_0008847
1130 Ga0501038_0015266
1131 Ga0501038_0023267
1132 Ga0501038_0232812
1133 Ga0501038_0529590
1134 Ga0501038_0680283
1135 Ga0501039_0002709
1136 Ga0501039_0040935
1137 Ga0501040_0016468
1138 Ga0501041_0014510
1139 Ga0501042_0002745
1140 Ga0501042_0042276
1141 Ga0501043_0000622
1142 Ga0501043_0002135
1143 Ga0501043_0014191
1144 Ga0501043_0060149
1145 Ga0501046_0001707
1146 Ga0501046_0008676
1147 Ga0501046_0101912
1148 Ga0501046_0325413
1149 Ga0501046_0716152
1150 Ga0501047_0000182
1151 Ga0501047_0000248
1152 Ga0501047_0018108
1153 Ga0501047_0031371
1154 Ga0501047_0050702
1155 Ga0501047_0062942
1156 Ga0501047_0423784
1157 Ga0501047_0676120
1158 Ga0501048_0003271
1159 Ga0501048_0052749
1160 Ga0501048_1316060
1161 Ga0501067_0003554
1162 Ga0501067_0261861
1163 Ga0501068_0000719
1164 Ga0501068_0313739
1165 Ga0501070_0006632
1166 Ga0501070_0012050
1167 Ga0501070_0043686
1168 Ga0501070_0855707
1169 Ga0501070_0861727
1170 Ga0501071_0000025
1171 Ga0501072_0000410
1172 Ga0501072_0972483
1173 Ga0501073_0139717
1174 Ga0501073_0167170
1175 Ga0501073_0415757
1176 Ga0501074_0014815
1177 Ga0501074_0094143
1178 Ga0501077_0001957
1179 Ga0501079_0032626
1180 Ga0501079_0988032
1181 Ga0501080_0002814
1182 Ga0501083_0000422
1183 Ga0501282_002722
1184 Ga0501035_0000416
1185 Ga0501035_0002470
1186 Ga0501035_0002656
1187 Ga0501035_0006603
1188 Ga0501035_0023041
1189 Ga0501035_0038021
1190 Ga0501035_0058146
1191 Ga0501035_0096680
1192 Ga0501035_0606436
1193 Ga0501035_0765940
1194 Ga0501044_0001535
1195 Ga0501044_0008206
1196 Ga0501044_0009479
1197 Ga0501044_0040369
1198 Ga0501044_0129060
1199 Ga0501044_0364058
1200 Ga0501044_0903107
1201 Ga0501044_1183657
1202 Ga0501044_1581423
1203 Ga0501045_0001009
1204 Ga0501045_0195359
1205 Ga0501045_0365317
1206 Ga0501045_0648470
1207 nmdc:mga03n38_14633_c1
1208 nmdc:mga03n38_671493_c1
1209 nmdc:mga0yw44_39781_c1
1210 nmdc:mga06z11_260534_c1
1211 nmdc:mga06z11_2689_c1
1212 nmdc:mga04h51_38167_c1
1213 nmdc:mga07m45_10260_c1
1214 nmdc:mga07m45_302064_c1
1215 Ga0495655_0083228
1216 Ga0495655_0238366
1217 Ga0500578_0015819
1218 Ga0500647_0403925
1219 Ga0500583_0147570
1220 Ga0500566_0062625
1221 Ga0500640_001709
1222 Ga0500654_029379
1223 Ga0500660_062614
1224 Ga0500660_125738
1225 Ga0500553_078599
1226 Ga0500560_030100
1227 Ga0500569_024007
1228 Ga0500608_149342
1229 Ga0500628_001962
1230 Ga0500652_022031
1231 Ga0500658_0423978
1232 Ga0500561_0001570
1233 Ga0500573_0052596
1234 Ga0500579_077488
1235 Ga0500590_311945
1236 Ga0500600_0016706
1237 Ga0500600_0286062
1238 Ga0500616_0006235
1239 Ga0500633_0003334
1240 Ga0500634_0027131
1241 Ga0500636_0520146
1242 Ga0500565_002669
1243 Ga0500587_000159
1244 Ga0501084_0011064
1245 Ga0587082_131938
1246 Ga0587090_051002
1247 Ga0587106_019813
1248 Ga0587115_041165
1249 Ga0501082_0007246
1250 Ga0466962_0023780
1251 Ga0466962_0028751
1252 2547406514
1253 2554259563
1254 2585300375
1255 2585303511
1256 2585316994
1257 2616695604
1258 2616900842
1259 2643760231
1260 2643904471
1261 2643946568
1262 2644268002
1263 2644389080
1264 2644406261
1265 2644434372
1266 2644443678
1267 2644460073
1268 2644629608
1269 2784586731
1270 2785345755
1271 2785367134
1272 2786668182
1273 2793976637
1274 2804843716
1275 2808847640
1276 2808918374
1277 2809230298
1278 2811846950
1279 2812360335
1280 2819696350
1281 2852637694
1282 2862186267
1283 2862289678
1284 2862292448
1285 2862386975
1286 2862510401
1287 2862583737
1288 2862711231
1289 2863406990
1290 2867346816
1291 2867369836
1292 2867430061
1293 2867475684
1294 2873157698
1295 2875392675
1296 2877683412
1297 2912722419
1298 2912726123
1299 2912758873
1300 2918502502
1301 2919472211
1302 2946052039
1303 2946065553
1304 2946073914
1305 2947231856
1306 2954011090
1307 2954388659
1308 2954674465
1309 2954689667
1310 2954699450
1311 2954702768
1312 2954718390
1313 2954728360
1314 2954733449
1315 2954747256
1316 2954752332
1317 2954766371
1318 2966604435
1319 2990045848
1320 2990059594
1321 2995469375
1322 2997453992
1323 2997605692
1324 3006328030
1325 3006399558
1326 3006430690
1327 3006490460
1328 3006495135
1329 8008486582
1330 8008561295
1331 8008580767
1332 8023625009
1333 8025414828
1334 8025484321
1335 8025525651
1336 8025534175
1337 8033685009
1338 8047894829
1339 8048130385
1340 8048364220
1341 8048371848
1342 8048380781
1343 8048408148
1344 8054163831
1345 8056449966
1346 8056670551
1347 8056835720

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01029

NusB

NusB family

5

135

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eyv-assembly1.cif.gz_A the crystal structure of nusb from mycobacterium tuberculosis 0.9269 4 132
1eyv-assembly1.cif.gz_A the crystal structure of nusb from mycobacterium tuberculosis 0.9069 4 132
3r2d-assembly1.cif.gz_A crystal structure of antitermination factors nusb and nuse in complex with dsrna 0.8729 1 134
1tzx-assembly2.cif.gz_B t. maritima nusb, p3221 0.8717 5 134
5lm7-assembly2.cif.gz_D crystal structure of the lambda n-nus factor complex 0.8635 4 135
ID Description Score Start End Superfamily
af_P9WIV1_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9429 1 132 1.10.940.10
1eyvA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9269 4 132 1.10.940.10
1eyvA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9069 4 132 1.10.940.10
af_P9WIV1_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8911 1 132 1.10.940.10
1tztA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.883 4 134 1.10.940.10
ID Description Score Start End GO Terms
AF-A0A6B3QUQ0-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 1.002 1 141 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A3N1M5S0-F1-model_v4 deleted 1.002 1 144
AF-Q9KXR0-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 1.002 1 141 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A0B5EYJ1-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 1.001 1 143 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A6I5MY64-F1-model_v4 deleted 1 1 141

Map