F474368
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 674 | 408 | 1347 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10396322|Ga0213876_103963222 |
| Length | 148 |
| Sequence | MAARHRSRKRALQVLFEWDMRHESIDRAISHYYDSLYSEESETRPKPDKFMEELARGTVANAPDIDKRIEATAENWRLDRMPVVDRNILRLAIYELSQQSVPAPVIIDEALELARRFSNDESLPFINGILDAVNRRIAEPSRDAVAGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 29 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 30 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 31 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 32 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 53 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 56 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 58 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 59 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 61 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 62 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 63 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 65 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 83 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 84 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 85 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 86 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 87 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 88 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 89 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 90 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 91 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 92 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 93 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 94 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 95 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 96 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 97 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 98 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 99 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 100 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 101 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 102 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 103 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 104 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 105 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 106 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 107 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 108 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 109 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 110 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 111 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 112 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 113 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 114 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 115 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 116 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 117 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 118 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 119 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 120 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 121 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 122 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 123 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 124 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 125 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 126 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 127 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 128 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 129 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 130 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 131 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 132 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 133 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 134 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 135 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 136 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 137 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 138 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 139 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 142 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 143 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 144 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 145 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 226 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 272 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 276 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 277 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 278 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 279 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 280 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 282 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 283 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 284 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 285 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 286 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 287 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 288 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 289 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 290 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 291 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 292 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 293 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 294 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 296 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 297 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 298 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 299 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 300 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 301 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 302 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 303 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 305 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 313 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 314 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 315 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 316 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 317 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 318 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 319 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 320 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 321 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 322 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 323 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 324 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 325 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 326 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 327 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 328 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 329 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 330 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 331 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 332 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 333 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 334 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 335 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 336 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 337 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 338 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 339 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 340 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 341 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 342 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 343 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 344 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 345 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 346 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 347 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 348 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 349 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 350 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 351 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 352 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 353 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 354 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 355 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 356 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 357 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 358 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 359 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 360 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 361 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 362 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 363 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 364 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 365 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 366 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 367 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 368 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 369 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 370 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 371 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 372 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 373 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 374 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 375 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 376 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 377 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 378 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 379 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 380 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 381 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 382 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 383 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 384 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 385 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 386 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 387 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 388 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 389 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 390 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 391 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 392 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 393 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 394 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 395 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 396 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 397 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 398 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 399 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 400 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 401 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 402 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 403 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 404 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 405 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 406 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 407 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 408 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.04 |
| Metatranscriptomes | 7.72 |
| Isolates | 14.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.68 |
| Nodule | 0.45 |
| Rhizoplane | 0.74 |
| Rhizosphere | 76.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0213876_10396322 | 3300021384 | Bacteria | 734 |
| 2 | JGI24739J22299_10055804 | 3300001989 | Bacteria | 1262 |
| 3 | JGI24737J22298_10116431 | 3300001990 | Bacteria | 790 |
| 4 | JGI24735J21928_10032874 | 3300002067 | Bacteria | 1534 |
| 5 | JGI24738J21930_10025858 | 3300002075 | Bacteria | 1206 |
| 6 | Ga0006759J45824_1032939 | 3300003163 | Bacteria | 1242 |
| 7 | Ga0006777J48905_1036155 | 3300003308 | Bacteria | 1238 |
| 8 | rootH1_10031237 | 3300003316 | Bacteria | 2187 |
| 9 | rootH1_10031237 | 3300003323 | Bacteria | 3042 |
| 10 | rootH2_10034114 | 3300003320 | Bacteria | 1998 |
| 11 | rootH1_10040758 | 3300003323 | Bacteria | 2038 |
| 12 | JGI25160J50197_1065056 | 3300003354 | Bacteria | 714 |
| 13 | Ga0007429J51699_1015681 | 3300003579 | Bacteria | 1262 |
| 14 | Ga0032354_1035482 | 3300003693 | Bacteria | 1250 |
| 15 | Ga0058860_12012580 | 3300004801 | Bacteria | 1150 |
| 16 | Ga0070668_100962204 | 3300005347 | Bacteria | 766 |
| 17 | Ga0070713_100892576 | 3300005436 | Bacteria | 855 |
| 18 | Ga0070700_100621755 | 3300005441 | Bacteria | 849 |
| 19 | Ga0070663_100024046 | 3300005455 | Bacteria | 4093 |
| 20 | Ga0070663_100402752 | 3300005455 | Bacteria | 1119 |
| 21 | Ga0070678_100623914 | 3300005456 | Bacteria | 965 |
| 22 | Ga0070685_10858566 | 3300005466 | Bacteria | 673 |
| 23 | Ga0068853_100286515 | 3300005539 | Bacteria | 1519 |
| 24 | Ga0070665_100026333 | 3300005548 | Bacteria | 5857 |
| 25 | Ga0070665_100255573 | 3300005548 | Bacteria | 1753 |
| 26 | Ga0068855_100157186 | 3300005563 | Bacteria | 2582 |
| 27 | Ga0068854_100104955 | 3300005578 | Bacteria | 2124 |
| 28 | Ga0068856_100019950 | 3300005614 | Bacteria | 6507 |
| 29 | Ga0068856_100155350 | 3300005614 | Bacteria | 2298 |
| 30 | Ga0081455_10008729 | 3300005937 | Bacteria | 10497 |
| 31 | Ga0070717_10824194 | 3300006028 | Unclassified | 844 |
| 32 | Ga0075365_10290836 | 3300006038 | Bacteria | 1149 |
| 33 | Ga0075368_10014916 | 3300006042 | Bacteria | 2876 |
| 34 | Ga0075363_100119550 | 3300006048 | Bacteria | 1470 |
| 35 | Ga0075367_10026522 | 3300006178 | Bacteria | 3287 |
| 36 | Ga0075370_10211348 | 3300006353 | Bacteria | 1145 |
| 37 | Ga0068871_100934239 | 3300006358 | Unclassified | 805 |
| 38 | Ga0105251_10010987 | 3300009011 | Bacteria | 5204 |
| 39 | Ga0105251_10163052 | 3300009011 | Bacteria | 1005 |
| 40 | Ga0105250_10041818 | 3300009092 | Bacteria | 1837 |
| 41 | Ga0105240_10105251 | 3300009093 | Bacteria | 3425 |
| 42 | Ga0105240_10185075 | 3300009093 | Bacteria | 2454 |
| 43 | Ga0105240_10568995 | 3300009093 | Unclassified | 1251 |
| 44 | Ga0105245_10950677 | 3300009098 | Bacteria | 902 |
| 45 | Ga0105243_10068550 | 3300009148 | Bacteria | 2859 |
| 46 | Ga0105243_10250429 | 3300009148 | Bacteria | 1581 |
| 47 | Ga0105241_11598753 | 3300009174 | Unclassified | 630 |
| 48 | Ga0105242_10965277 | 3300009176 | Bacteria | 857 |
| 49 | Ga0105237_10092682 | 3300009545 | Bacteria | 3010 |
| 50 | Ga0105238_10101763 | 3300009551 | Bacteria | 2855 |
| 51 | Ga0105238_10172196 | 3300009551 | Bacteria | 2141 |
| 52 | Ga0105238_11850257 | 3300009551 | Unclassified | 636 |
| 53 | Ga0105249_10577177 | 3300009553 | Bacteria | 1177 |
| 54 | Ga0105239_10216162 | 3300010375 | Bacteria | 2149 |
| 55 | Ga0105239_12541863 | 3300010375 | Unclassified | 597 |
| 56 | Ga0105246_10048719 | 3300011119 | Bacteria | 2898 |
| 57 | Ga0105246_10237725 | 3300011119 | Bacteria | 1438 |
| 58 | Ga0157373_10430037 | 3300013100 | Unclassified | 948 |
| 59 | Ga0157370_10077839 | 3300013104 | Bacteria | 3123 |
| 60 | Ga0157369_10149368 | 3300013105 | Bacteria | 2470 |
| 61 | Ga0157378_11770451 | 3300013297 | Bacteria | 665 |
| 62 | Ga0157372_10354375 | 3300013307 | Bacteria | 1710 |
| 63 | Ga0157372_13053094 | 3300013307 | Bacteria | 535 |
| 64 | Ga0163163_11743996 | 3300014325 | Bacteria | 683 |
| 65 | Ga0182008_10000988 | 3300014497 | Bacteria | 19736 |
| 66 | Ga0157376_10813856 | 3300014969 | Bacteria | 947 |
| 67 | Ga0182007_10003459 | 3300015262 | Bacteria | 7435 |
| 68 | Ga0183367_1017 | 3300015688 | Bacteria | 126691 |
| 69 | Ga0197907_11334973 | 3300020069 | Bacteria | 884 |
| 70 | Ga0206356_11574620 | 3300020070 | Bacteria | 560 |
| 71 | Ga0206355_1211322 | 3300020076 | Bacteria | 1006 |
| 72 | Ga0206352_10491978 | 3300020078 | Bacteria | 1005 |
| 73 | Ga0213873_10022928 | 3300021358 | Bacteria | 1483 |
| 74 | Ga0213874_10024878 | 3300021377 | Bacteria | 1683 |
| 75 | Ga0213874_10054339 | 3300021377 | Unclassified | 1238 |
| 76 | Ga0213876_10007819 | 3300021384 | Bacteria | 5799 |
| 77 | Ga0213875_10000006 | 3300021388 | Bacteria | 579005 |
| 78 | Ga0213875_10000864 | 3300021388 | Bacteria | 22378 |
| 79 | Ga0213875_10000915 | 3300021388 | Bacteria | 21352 |
| 80 | Ga0213875_10001927 | 3300021388 | Bacteria | 12850 |
| 81 | Ga0213875_10166490 | 3300021388 | Unclassified | 1035 |
| 82 | Ga0213875_10317748 | 3300021388 | Bacteria | 738 |
| 83 | Ga0224712_10456910 | 3300022467 | Bacteria | 614 |
| 84 | Ga0256744_126621 | 3300023309 | Bacteria | 1334 |
| 85 | Ga0209758_1013065 | 3300025297 | Bacteria | 4568 |
| 86 | Ga0207426_1002709 | 3300025302 | Bacteria | 10787 |
| 87 | Ga0207426_1030467 | 3300025302 | Bacteria | 1768 |
| 88 | Ga0207713_1025206 | 3300025735 | Bacteria | 2752 |
| 89 | Ga0207647_10032063 | 3300025904 | Bacteria | 3379 |
| 90 | Ga0207695_10099559 | 3300025913 | Unclassified | 2904 |
| 91 | Ga0207695_10451202 | 3300025913 | Bacteria | 1169 |
| 92 | Ga0207694_10361151 | 3300025924 | Unclassified | 1204 |
| 93 | Ga0207694_11224802 | 3300025924 | Unclassified | 635 |
| 94 | Ga0207687_10501973 | 3300025927 | Bacteria | 1013 |
| 95 | Ga0207709_10511310 | 3300025935 | Bacteria | 939 |
| 96 | Ga0207709_10875260 | 3300025935 | Bacteria | 729 |
| 97 | Ga0207691_10867973 | 3300025940 | Bacteria | 756 |
| 98 | Ga0207667_10323303 | 3300025949 | Unclassified | 1575 |
| 99 | Ga0207668_11148783 | 3300025972 | Bacteria | 697 |
| 100 | Ga0207678_10964334 | 3300026067 | Bacteria | 754 |
| 101 | Ga0207702_10032363 | 3300026078 | Bacteria | 4364 |
| 102 | Ga0207702_10288721 | 3300026078 | Bacteria | 1553 |
| 103 | Ga0207676_11377523 | 3300026095 | Bacteria | 701 |
| 104 | Ga0209371_1034607 | 3300027312 | Bacteria | 1069 |
| 105 | Ga0209813_10017281 | 3300027866 | Bacteria | 1979 |
| 106 | Ga0268266_10071701 | 3300028379 | Bacteria | 3003 |
| 107 | Ga0268266_10075196 | 3300028379 | Bacteria | 2934 |
| 108 | Ga0268266_11092176 | 3300028379 | Bacteria | 772 |
| 109 | Ga0307517_10006575 | 3300028786 | Bacteria | 17165 |
| 110 | Ga0307517_10006948 | 3300028786 | Bacteria | 16631 |
| 111 | Ga0307515_10002608 | 3300028794 | Bacteria | 38833 |
| 112 | Ga0307515_10160601 | 3300028794 | Bacteria | 2294 |
| 113 | Ga0307515_10656761 | 3300028794 | Bacteria | 661 |
| 114 | Ga0310981_1040932 | 3300029285 | Bacteria | 701 |
| 115 | Ga0268256_1036724 | 3300030500 | Bacteria | 1128 |
| 116 | Ga0307511_10004244 | 3300030521 | Bacteria | 14631 |
| 117 | Ga0307511_10373286 | 3300030521 | Bacteria | 600 |
| 118 | Ga0307512_10236493 | 3300030522 | Bacteria | 930 |
| 119 | Ga0307512_10343552 | 3300030522 | Bacteria | 662 |
| 120 | Ga0307513_10023135 | 3300031456 | Bacteria | 7271 |
| 121 | Ga0307513_10080246 | 3300031456 | Bacteria | 3366 |
| 122 | Ga0307513_10460710 | 3300031456 | Bacteria | 994 |
| 123 | Ga0307509_10178836 | 3300031507 | Bacteria | 1990 |
| 124 | Ga0307508_10001597 | 3300031616 | Bacteria | 25266 |
| 125 | Ga0307508_10117503 | 3300031616 | Bacteria | 2260 |
| 126 | Ga0307508_10451782 | 3300031616 | Bacteria | 877 |
| 127 | Ga0307514_10003022 | 3300031649 | Bacteria | 16626 |
| 128 | Ga0307514_10252073 | 3300031649 | Bacteria | 1043 |
| 129 | Ga0307514_10435850 | 3300031649 | Bacteria | 651 |
| 130 | Ga0307516_10017360 | 3300031730 | Bacteria | 7506 |
| 131 | Ga0307516_10450024 | 3300031730 | Bacteria | 944 |
| 132 | Ga0307516_10557730 | 3300031730 | Bacteria | 799 |
| 133 | Ga0307518_10514525 | 3300031838 | Bacteria | 609 |
| 134 | Ga0307409_100395735 | 3300031995 | Bacteria | 1318 |
| 135 | Ga0307416_100475213 | 3300032002 | Bacteria | 1309 |
| 136 | Ga0307507_10272018 | 3300033179 | Bacteria | 1069 |
| 137 | Ga0307510_10092342 | 3300033180 | Bacteria | 2863 |
| 138 | Ga0307510_10108802 | 3300033180 | Bacteria | 2523 |
| 139 | Ga0307510_10121579 | 3300033180 | Bacteria | 2314 |
| 140 | Ga0307510_10484548 | 3300033180 | Bacteria | 678 |
| 141 | Ga0395898_1042758 | 3300037466 | Bacteria | 753 |
| 142 | Ga0436364_0056406 | 3300037853 | Bacteria | 12221 |
| 143 | Ga0436364_0244345 | 3300037853 | Bacteria | 3299 |
| 144 | Ga0436364_0270098 | 3300037853 | Bacteria | 68489 |
| 145 | Ga0436364_0478514 | 3300037853 | Bacteria | 578677 |
| 146 | Ga0436364_0510827 | 3300037853 | Bacteria | 1203 |
| 147 | Ga0436364_0556898 | 3300037853 | Bacteria | 847 |
| 148 | Ga0436364_0846682 | 3300037853 | Bacteria | 27024 |
| 149 | Ga0436364_0883683 | 3300037853 | Bacteria | 14743 |
| 150 | Ga0436364_1382991 | 3300037853 | Bacteria | 508 |
| 151 | Ga0436364_1494813 | 3300037853 | Bacteria | 8329 |
| 152 | Ga0395901_0157962 | 3300038443 | Bacteria | 2381 |
| 153 | Ga0436365_0674457 | 3300039437 | Unclassified | 792 |
| 154 | Ga0436365_0965826 | 3300039437 | Unclassified | 1075 |
| 155 | Ga0436365_1169743 | 3300039437 | Bacteria | 1346 |
| 156 | Ga0436365_1859987 | 3300039437 | Unclassified | 716 |
| 157 | Ga0436360_0895846 | 3300039438 | Bacteria | 914 |
| 158 | Ga0436363_0075268 | 3300039450 | Unclassified | 893 |
| 159 | Ga0436363_0723725 | 3300039450 | Bacteria | 7798 |
| 160 | Ga0436363_0782860 | 3300039450 | Unclassified | 750 |
| 161 | Ga0436363_0831071 | 3300039450 | Bacteria | 3124 |
| 162 | Ga0436362_0161559 | 3300039453 | Unclassified | 1044 |
| 163 | Ga0436362_0460211 | 3300039453 | Bacteria | 922 |
| 164 | Ga0436362_0905448 | 3300039453 | Bacteria | 3499 |
| 165 | Ga0439436_0031145 | 3300041404 | Bacteria | 1548 |
| 166 | Ga0439438_153303 | 3300041405 | Bacteria | 549 |
| 167 | Ga0439439_0004399 | 3300041406 | Bacteria | 3172 |
| 168 | Ga0439439_0042543 | 3300041406 | Bacteria | 1180 |
| 169 | Ga0439439_0047432 | 3300041406 | Bacteria | 1122 |
| 170 | Ga0439466_0164429 | 3300041411 | Bacteria | 678 |
| 171 | Ga0451789_1319408 | 3300041443 | Bacteria | 1019 |
| 172 | Ga0451837_0603095 | 3300041494 | Bacteria | 1438 |
| 173 | Ga0451837_1301561 | 3300041494 | Bacteria | 955 |
| 174 | Ga0451841_0092612 | 3300041498 | Bacteria | 725 |
| 175 | Ga0451843_0953098 | 3300041509 | Bacteria | 889 |
| 176 | Ga0451853_0211892 | 3300041512 | Bacteria | 1254 |
| 177 | Ga0451853_0490855 | 3300041512 | Bacteria | 6155 |
| 178 | Ga0451853_1580339 | 3300041512 | Bacteria | 2081 |
| 179 | Ga0439433_0008791 | 3300041999 | Bacteria | 2195 |
| 180 | Ga0439442_041904 | 3300042002 | Bacteria | 962 |
| 181 | Ga0439448_0011854 | 3300042005 | Bacteria | 2600 |
| 182 | Ga0439432_183324 | 3300042006 | Bacteria | 609 |
| 183 | Ga0439449_0032393 | 3300042007 | Bacteria | 1948 |
| 184 | Ga0439449_0099150 | 3300042007 | Bacteria | 1076 |
| 185 | Ga0439450_038977 | 3300042008 | Bacteria | 1097 |
| 186 | Ga0439457_000613 | 3300042014 | Bacteria | 10525 |
| 187 | Ga0439457_001721 | 3300042014 | Bacteria | 6485 |
| 188 | Ga0450894_000807 | 3300042131 | Bacteria | 5049 |
| 189 | Ga0450896_000627 | 3300042133 | Bacteria | 3842 |
| 190 | Ga0450898_008769 | 3300042134 | Bacteria | 1604 |
| 191 | Ga0450899_000169 | 3300042135 | Bacteria | 6496 |
| 192 | Ga0450902_054662 | 3300042137 | Bacteria | 687 |
| 193 | Ga0450903_000046 | 3300042138 | Bacteria | 24085 |
| 194 | Ga0450906_000464 | 3300042145 | Bacteria | 8490 |
| 195 | Ga0439458_0004062 | 3300042157 | Bacteria | 3377 |
| 196 | Ga0450908_038407 | 3300042184 | Bacteria | 830 |
| 197 | Ga0450893_0103765 | 3300042532 | Bacteria | 581 |
| 198 | Ga0466969_0003467 | 3300044656 | Bacteria | 8385 |
| 199 | Ga0466969_0144300 | 3300044656 | Bacteria | 1099 |
| 200 | Ga0466969_0168029 | 3300044656 | Bacteria | 1006 |
| 201 | Ga0466972_0000856 | 3300044658 | Bacteria | 14601 |
| 202 | Ga0466972_0012638 | 3300044658 | Bacteria | 4240 |
| 203 | Ga0466965_0150425 | 3300044683 | Bacteria | 1216 |
| 204 | Ga0466965_0516090 | 3300044683 | Bacteria | 671 |
| 205 | Ga0466965_0608954 | 3300044683 | Bacteria | 621 |
| 206 | Ga0466966_0003382 | 3300044684 | Bacteria | 10518 |
| 207 | Ga0466966_0007385 | 3300044684 | Bacteria | 7289 |
| 208 | Ga0466966_0173309 | 3300044684 | Bacteria | 1310 |
| 209 | Ga0466961_0009126 | 3300044693 | Bacteria | 6316 |
| 210 | Ga0466961_0041940 | 3300044693 | Bacteria | 2934 |
| 211 | Ga0466961_0047806 | 3300044693 | Bacteria | 2735 |
| 212 | Ga0466961_0165756 | 3300044693 | Bacteria | 1375 |
| 213 | Ga0466963_0002539 | 3300044694 | Bacteria | 10223 |
| 214 | Ga0466963_0004501 | 3300044694 | Bacteria | 8108 |
| 215 | Ga0466971_0023115 | 3300044719 | Bacteria | 2770 |
| 216 | Ga0466971_0141063 | 3300044719 | Bacteria | 1122 |
| 217 | Ga0466971_0181142 | 3300044719 | Bacteria | 990 |
| 218 | Ga0466968_0236056 | 3300044735 | Bacteria | 865 |
| 219 | Ga0466970_0042533 | 3300044765 | Bacteria | 2416 |
| 220 | Ga0466970_0212431 | 3300044765 | Bacteria | 1078 |
| 221 | Ga0466970_0273866 | 3300044765 | Bacteria | 948 |
| 222 | Ga0466970_0493555 | 3300044765 | Bacteria | 704 |
| 223 | Ga0466957_0250516 | 3300044842 | Bacteria | 1177 |
| 224 | Ga0466957_0496629 | 3300044842 | Bacteria | 845 |
| 225 | Ga0466960_0022863 | 3300044901 | Bacteria | 2799 |
| 226 | Ga0466959_0021880 | 3300045049 | Bacteria | 4722 |
| 227 | Ga0466959_0226088 | 3300045049 | Bacteria | 1296 |
| 228 | Ga0466959_0243481 | 3300045049 | Bacteria | 1241 |
| 229 | Ga0466958_0019276 | 3300045836 | Bacteria | 3969 |
| 230 | Ga0466967_0007504 | 3300045976 | Bacteria | 7875 |
| 231 | Ga0466967_0254921 | 3300045976 | Bacteria | 1677 |
| 232 | Ga0466967_0920919 | 3300045976 | Bacteria | 869 |
| 233 | Ga0495627_028646 | 3300046453 | Bacteria | 1778 |
| 234 | Ga0495592_0033363 | 3300046454 | Bacteria | 3883 |
| 235 | Ga0495592_0036940 | 3300046454 | Bacteria | 3677 |
| 236 | Ga0495603_0006352 | 3300046455 | Bacteria | 7071 |
| 237 | Ga0495603_0038202 | 3300046455 | Bacteria | 2880 |
| 238 | Ga0495603_0095012 | 3300046455 | Bacteria | 1741 |
| 239 | Ga0495603_0195704 | 3300046455 | Bacteria | 1168 |
| 240 | Ga0495590_0046480 | 3300046457 | Bacteria | 1514 |
| 241 | Ga0495629_0029219 | 3300046459 | Bacteria | 3911 |
| 242 | Ga0495629_0065494 | 3300046459 | Bacteria | 2536 |
| 243 | Ga0495629_0162811 | 3300046459 | Bacteria | 1549 |
| 244 | Ga0495629_0317896 | 3300046459 | Bacteria | 1064 |
| 245 | Ga0495629_0825641 | 3300046459 | Bacteria | 610 |
| 246 | Ga0495638_0009750 | 3300046460 | Bacteria | 6708 |
| 247 | Ga0495638_0044492 | 3300046460 | Bacteria | 2796 |
| 248 | Ga0495638_0291622 | 3300046460 | Bacteria | 882 |
| 249 | Ga0495638_0394629 | 3300046460 | Bacteria | 719 |
| 250 | Ga0495651_0030718 | 3300046462 | Bacteria | 4189 |
| 251 | Ga0495651_0048941 | 3300046462 | Bacteria | 3263 |
| 252 | Ga0495580_0138645 | 3300046472 | Bacteria | 1686 |
| 253 | Ga0495605_0104447 | 3300046474 | Bacteria | 1298 |
| 254 | Ga0495639_0086195 | 3300046475 | Bacteria | 1468 |
| 255 | Ga0495662_0124218 | 3300046476 | Bacteria | 1267 |
| 256 | Ga0495662_0348912 | 3300046476 | Bacteria | 727 |
| 257 | Ga0495662_0381662 | 3300046476 | Bacteria | 692 |
| 258 | Ga0495662_0650704 | 3300046476 | Bacteria | 514 |
| 259 | Ga0495664_0149545 | 3300046477 | Bacteria | 1416 |
| 260 | Ga0495584_0125757 | 3300046491 | Bacteria | 1299 |
| 261 | Ga0495594_0022258 | 3300046499 | Bacteria | 3389 |
| 262 | Ga0495594_0084940 | 3300046499 | Bacteria | 1770 |
| 263 | Ga0495594_0115316 | 3300046499 | Bacteria | 1516 |
| 264 | Ga0495594_0257265 | 3300046499 | Bacteria | 994 |
| 265 | Ga0495596_0036541 | 3300046500 | Bacteria | 1945 |
| 266 | Ga0495607_0040941 | 3300046501 | Bacteria | 2754 |
| 267 | Ga0495606_0041254 | 3300046507 | Bacteria | 3095 |
| 268 | Ga0495616_0030172 | 3300046513 | Bacteria | 2852 |
| 269 | Ga0495618_0072653 | 3300046514 | Bacteria | 2189 |
| 270 | Ga0495618_0245294 | 3300046514 | Bacteria | 1125 |
| 271 | Ga0495620_0206742 | 3300046515 | Bacteria | 754 |
| 272 | Ga0495628_0019731 | 3300046516 | Bacteria | 5570 |
| 273 | Ga0495628_0751467 | 3300046516 | Bacteria | 685 |
| 274 | Ga0495628_0901379 | 3300046516 | Bacteria | 613 |
| 275 | Ga0495630_0088688 | 3300046517 | Bacteria | 2336 |
| 276 | Ga0495631_0052433 | 3300046518 | Bacteria | 1781 |
| 277 | Ga0495632_0328201 | 3300046519 | Bacteria | 675 |
| 278 | Ga0495637_0039914 | 3300046520 | Bacteria | 2023 |
| 279 | Ga0495643_0005160 | 3300046522 | Bacteria | 8920 |
| 280 | Ga0495643_0107561 | 3300046522 | Bacteria | 1421 |
| 281 | Ga0495648_0474817 | 3300046524 | Bacteria | 541 |
| 282 | Ga0495642_0417812 | 3300046528 | Bacteria | 592 |
| 283 | Ga0495652_0066063 | 3300046529 | Bacteria | 3037 |
| 284 | Ga0495652_0073097 | 3300046529 | Bacteria | 2856 |
| 285 | Ga0495654_0052156 | 3300046530 | Bacteria | 1993 |
| 286 | Ga0495640_0010859 | 3300046533 | Bacteria | 7024 |
| 287 | Ga0495640_0074440 | 3300046533 | Bacteria | 2271 |
| 288 | Ga0495640_0177362 | 3300046533 | Bacteria | 1360 |
| 289 | Ga0495587_0003878 | 3300046536 | Bacteria | 9922 |
| 290 | Ga0495609_0026656 | 3300046538 | Bacteria | 2645 |
| 291 | Ga0495597_0029329 | 3300046542 | Bacteria | 2512 |
| 292 | Ga0495622_0032353 | 3300046557 | Bacteria | 2442 |
| 293 | Ga0495622_0092576 | 3300046557 | Bacteria | 1388 |
| 294 | Ga0495633_0028713 | 3300046558 | Bacteria | 2708 |
| 295 | Ga0495667_0152104 | 3300046559 | Bacteria | 1490 |
| 296 | Ga0495668_0376498 | 3300046616 | Bacteria | 779 |
| 297 | Ga0495634_0025545 | 3300046642 | Bacteria | 4131 |
| 298 | Ga0495611_0003810 | 3300046648 | Bacteria | 6578 |
| 299 | Ga0495611_0087266 | 3300046648 | Bacteria | 1440 |
| 300 | Ga0495625_0138882 | 3300046660 | Bacteria | 1640 |
| 301 | Ga0495635_0032901 | 3300046663 | Bacteria | 3596 |
| 302 | Ga0495635_0285726 | 3300046663 | Bacteria | 1108 |
| 303 | Ga0495659_0251362 | 3300046664 | Bacteria | 737 |
| 304 | Ga0495661_0468870 | 3300046665 | Bacteria | 604 |
| 305 | Ga0495588_0014001 | 3300046674 | Bacteria | 3832 |
| 306 | Ga0495588_0093011 | 3300046674 | Bacteria | 1580 |
| 307 | Ga0495588_0272043 | 3300046674 | Bacteria | 892 |
| 308 | Ga0495657_0002935 | 3300046675 | Bacteria | 14138 |
| 309 | Ga0495657_0043952 | 3300046675 | Bacteria | 3042 |
| 310 | Ga0495599_0862752 | 3300046678 | Bacteria | 514 |
| 311 | Ga0495623_0667768 | 3300046679 | Bacteria | 535 |
| 312 | Ga0495646_0001643 | 3300046680 | Bacteria | 13336 |
| 313 | Ga0495658_0007199 | 3300046683 | Bacteria | 5496 |
| 314 | Ga0495613_0014244 | 3300046689 | Bacteria | 5901 |
| 315 | Ga0495613_0053918 | 3300046689 | Bacteria | 2956 |
| 316 | Ga0495613_0282576 | 3300046689 | Bacteria | 1152 |
| 317 | Ga0495613_0287042 | 3300046689 | Bacteria | 1141 |
| 318 | Ga0495613_0442453 | 3300046689 | Bacteria | 881 |
| 319 | Ga0495624_0163850 | 3300046690 | Bacteria | 1357 |
| 320 | Ga0495624_0333191 | 3300046690 | Bacteria | 913 |
| 321 | Ga0495624_0722654 | 3300046690 | Bacteria | 590 |
| 322 | Ga0495670_0024416 | 3300046691 | Bacteria | 2987 |
| 323 | Ga0495670_0085986 | 3300046691 | Bacteria | 1605 |
| 324 | Ga0495671_0070870 | 3300046692 | Bacteria | 1712 |
| 325 | Ga0495649_0123737 | 3300046694 | Bacteria | 1366 |
| 326 | Ga0495649_0193527 | 3300046694 | Bacteria | 1058 |
| 327 | Ga0495589_0058900 | 3300046794 | Bacteria | 1888 |
| 328 | Ga0495589_0184953 | 3300046794 | Bacteria | 987 |
| 329 | Ga0495589_0200681 | 3300046794 | Bacteria | 941 |
| 330 | Ga0495589_0323393 | 3300046794 | Bacteria | 712 |
| 331 | Ga0495600_0002980 | 3300046809 | Bacteria | 9880 |
| 332 | Ga0495600_0010512 | 3300046809 | Bacteria | 5748 |
| 333 | Ga0495600_0587765 | 3300046809 | Bacteria | 677 |
| 334 | Ga0495660_0085225 | 3300046810 | Bacteria | 1651 |
| 335 | Ga0495660_0139744 | 3300046810 | Bacteria | 1206 |
| 336 | Ga0495581_0048759 | 3300047315 | Bacteria | 2445 |
| 337 | Ga0495581_0088443 | 3300047315 | Bacteria | 1796 |
| 338 | Ga0495581_0212672 | 3300047315 | Bacteria | 1130 |
| 339 | Ga0495581_0322925 | 3300047315 | Bacteria | 902 |
| 340 | Ga0495604_0002330 | 3300047317 | Bacteria | 15212 |
| 341 | Ga0495636_0229125 | 3300047318 | Bacteria | 854 |
| 342 | Ga0495674_0163005 | 3300047319 | Bacteria | 1864 |
| 343 | Ga0495672_0081248 | 3300047320 | Bacteria | 1805 |
| 344 | Ga0495676_0004289 | 3300047321 | Bacteria | 13019 |
| 345 | Ga0495676_0004409 | 3300047321 | Bacteria | 12868 |
| 346 | Ga0495676_0029226 | 3300047321 | Bacteria | 4695 |
| 347 | Ga0495676_0049427 | 3300047321 | Bacteria | 3381 |
| 348 | Ga0495676_0084656 | 3300047321 | Bacteria | 2392 |
| 349 | Ga0495676_0283752 | 3300047321 | Bacteria | 1120 |
| 350 | Ga0495676_0289283 | 3300047321 | Bacteria | 1107 |
| 351 | Ga0495683_0038000 | 3300047323 | Bacteria | 2438 |
| 352 | Ga0495687_002181 | 3300047443 | Bacteria | 16294 |
| 353 | Ga0495687_009612 | 3300047443 | Bacteria | 5385 |
| 354 | Ga0495687_045737 | 3300047443 | Bacteria | 1893 |
| 355 | Ga0495687_140747 | 3300047443 | Bacteria | 839 |
| 356 | Ga0495675_0051898 | 3300047444 | Bacteria | 2604 |
| 357 | Ga0495675_0222769 | 3300047444 | Bacteria | 1141 |
| 358 | Ga0495677_0035866 | 3300047445 | Bacteria | 1810 |
| 359 | Ga0495679_109172 | 3300047446 | Bacteria | 762 |
| 360 | Ga0495685_000258 | 3300047447 | Bacteria | 18267 |
| 361 | Ga0495685_006768 | 3300047447 | Bacteria | 3765 |
| 362 | Ga0495685_049117 | 3300047447 | Bacteria | 1433 |
| 363 | Ga0495685_172357 | 3300047447 | Bacteria | 698 |
| 364 | Ga0495681_0001206 | 3300047470 | Bacteria | 19657 |
| 365 | Ga0495684_0514041 | 3300047471 | Bacteria | 821 |
| 366 | Ga0495686_0098686 | 3300047472 | Bacteria | 1764 |
| 367 | Ga0495686_0328566 | 3300047472 | Bacteria | 836 |
| 368 | Ga0495686_0452791 | 3300047472 | Bacteria | 682 |
| 369 | Ga0495593_0033838 | 3300047673 | Bacteria | 2781 |
| 370 | Ga0495593_0245963 | 3300047673 | Bacteria | 896 |
| 371 | Ga0495593_0420379 | 3300047673 | Bacteria | 669 |
| 372 | Ga0495614_0065220 | 3300048089 | Bacteria | 1566 |
| 373 | Ga0495614_0093641 | 3300048089 | Bacteria | 1308 |
| 374 | Ga0495614_0469582 | 3300048089 | Bacteria | 596 |
| 375 | Ga0495614_0663271 | 3300048089 | Bacteria | 503 |
| 376 | Ga0495615_0314131 | 3300048090 | Bacteria | 510 |
| 377 | Ga0495626_0025863 | 3300048091 | Bacteria | 2866 |
| 378 | Ga0496102_0865084 | 3300048905 | Bacteria | 826 |
| 379 | Ga0496106_0186212 | 3300048909 | Bacteria | 1649 |
| 380 | Ga0496110_1847591 | 3300048913 | Bacteria | 514 |
| 381 | Ga0496126_1209159 | 3300048929 | Unclassified | 555 |
| 382 | Ga0501306_003717 | 3300049127 | Bacteria | 1662 |
| 383 | Ga0501306_015608 | 3300049127 | Bacteria | 1013 |
| 384 | Ga0501306_017192 | 3300049127 | Bacteria | 979 |
| 385 | Ga0501308_022690 | 3300049128 | Bacteria | 796 |
| 386 | Ga0501309_015852 | 3300049129 | Bacteria | 1023 |
| 387 | Ga0501309_089010 | 3300049129 | Bacteria | 525 |
| 388 | Ga0501310_011967 | 3300049130 | Bacteria | 989 |
| 389 | Ga0501310_029261 | 3300049130 | Bacteria | 725 |
| 390 | Ga0495678_028156 | 3300049459 | Bacteria | 2375 |
| 391 | Ga0501311_007147 | 3300049527 | Bacteria | 1280 |
| 392 | Ga0501311_014213 | 3300049527 | Bacteria | 1014 |
| 393 | Ga0501312_019319 | 3300049528 | Bacteria | 1000 |
| 394 | Ga0501312_021894 | 3300049528 | Bacteria | 955 |
| 395 | Ga0501313_029467 | 3300049529 | Bacteria | 707 |
| 396 | Ga0501315_013840 | 3300049531 | Bacteria | 1015 |
| 397 | Ga0501315_027060 | 3300049531 | Bacteria | 807 |
| 398 | Ga0501316_066473 | 3300049532 | Bacteria | 540 |
| 399 | Ga0501317_005396 | 3300049533 | Bacteria | 1368 |
| 400 | Ga0501317_008083 | 3300049533 | Bacteria | 1204 |
| 401 | Ga0501318_004481 | 3300049534 | Bacteria | 1341 |
| 402 | Ga0501318_005240 | 3300049534 | Bacteria | 1277 |
| 403 | Ga0501318_018940 | 3300049534 | Bacteria | 855 |
| 404 | Ga0501319_002258 | 3300049535 | Bacteria | 1207 |
| 405 | Ga0501320_005888 | 3300049536 | Bacteria | 1132 |
| 406 | Ga0501320_008684 | 3300049536 | Bacteria | 1004 |
| 407 | Ga0501320_011503 | 3300049536 | Bacteria | 918 |
| 408 | Ga0501321_006255 | 3300049537 | Bacteria | 1205 |
| 409 | Ga0501322_017773 | 3300049538 | Bacteria | 605 |
| 410 | Ga0501323_007984 | 3300049539 | Bacteria | 1220 |
| 411 | Ga0501323_013342 | 3300049539 | Bacteria | 1015 |
| 412 | Ga0501323_024234 | 3300049539 | Bacteria | 819 |
| 413 | Ga0501323_025022 | 3300049539 | Bacteria | 810 |
| 414 | Ga0501323_065089 | 3300049539 | Bacteria | 575 |
| 415 | Ga0501324_007747 | 3300049540 | Bacteria | 933 |
| 416 | Ga0501324_009205 | 3300049540 | Bacteria | 882 |
| 417 | Ga0501324_034136 | 3300049540 | Bacteria | 564 |
| 418 | Ga0501325_002795 | 3300049541 | Bacteria | 1224 |
| 419 | Ga0501031_0001063 | 3300049568 | Bacteria | 16659 |
| 420 | Ga0501031_0036778 | 3300049568 | Bacteria | 3194 |
| 421 | Ga0501031_0150345 | 3300049568 | Bacteria | 1521 |
| 422 | Ga0501031_0174982 | 3300049568 | Bacteria | 1402 |
| 423 | Ga0501031_0249599 | 3300049568 | Bacteria | 1153 |
| 424 | Ga0501031_0508101 | 3300049568 | Bacteria | 777 |
| 425 | Ga0501032_0006508 | 3300049569 | Bacteria | 8585 |
| 426 | Ga0501032_0011853 | 3300049569 | Bacteria | 6245 |
| 427 | Ga0501032_0137594 | 3300049569 | Bacteria | 1609 |
| 428 | Ga0501032_0622955 | 3300049569 | Bacteria | 686 |
| 429 | Ga0501032_0715263 | 3300049569 | Bacteria | 634 |
| 430 | Ga0501033_0004692 | 3300049570 | Bacteria | 10937 |
| 431 | Ga0501033_0045310 | 3300049570 | Bacteria | 3273 |
| 432 | Ga0501033_0356771 | 3300049570 | Bacteria | 1023 |
| 433 | Ga0501033_0673618 | 3300049570 | Bacteria | 705 |
| 434 | Ga0501033_0835326 | 3300049570 | Bacteria | 621 |
| 435 | Ga0501034_0002413 | 3300049571 | Bacteria | 22626 |
| 436 | Ga0501034_0004049 | 3300049571 | Bacteria | 16445 |
| 437 | Ga0501034_0021980 | 3300049571 | Bacteria | 6499 |
| 438 | Ga0501034_0050260 | 3300049571 | Bacteria | 4205 |
| 439 | Ga0501034_0061146 | 3300049571 | Bacteria | 3783 |
| 440 | Ga0501034_0232847 | 3300049571 | Bacteria | 1790 |
| 441 | Ga0501034_0795472 | 3300049571 | Bacteria | 839 |
| 442 | Ga0501036_0002141 | 3300049572 | Bacteria | 15410 |
| 443 | Ga0501036_0002186 | 3300049572 | Bacteria | 15263 |
| 444 | Ga0501036_0013951 | 3300049572 | Bacteria | 6681 |
| 445 | Ga0501036_0060745 | 3300049572 | Bacteria | 3201 |
| 446 | Ga0501036_0097141 | 3300049572 | Bacteria | 2490 |
| 447 | Ga0501036_0135291 | 3300049572 | Bacteria | 2080 |
| 448 | Ga0501036_1166549 | 3300049572 | Bacteria | 628 |
| 449 | Ga0501037_0002849 | 3300049573 | Bacteria | 12534 |
| 450 | Ga0501037_0009060 | 3300049573 | Bacteria | 7294 |
| 451 | Ga0501037_0031541 | 3300049573 | Bacteria | 3912 |
| 452 | Ga0501037_0085798 | 3300049573 | Bacteria | 2279 |
| 453 | Ga0501037_0252346 | 3300049573 | Bacteria | 1234 |
| 454 | Ga0501037_0318079 | 3300049573 | Bacteria | 1078 |
| 455 | Ga0501037_0511632 | 3300049573 | Bacteria | 813 |
| 456 | Ga0501038_0008847 | 3300049574 | Bacteria | 9238 |
| 457 | Ga0501038_0015266 | 3300049574 | Bacteria | 6983 |
| 458 | Ga0501038_0023267 | 3300049574 | Bacteria | 5541 |
| 459 | Ga0501038_0232812 | 3300049574 | Bacteria | 1465 |
| 460 | Ga0501038_0529590 | 3300049574 | Bacteria | 898 |
| 461 | Ga0501038_0680283 | 3300049574 | Bacteria | 772 |
| 462 | Ga0501039_0002709 | 3300049575 | Bacteria | 13220 |
| 463 | Ga0501039_0040935 | 3300049575 | Bacteria | 3577 |
| 464 | Ga0501040_0016468 | 3300049576 | Bacteria | 4894 |
| 465 | Ga0501041_0014510 | 3300049577 | Bacteria | 4679 |
| 466 | Ga0501042_0002745 | 3300049578 | Bacteria | 10860 |
| 467 | Ga0501042_0042276 | 3300049578 | Bacteria | 3243 |
| 468 | Ga0501043_0000622 | 3300049579 | Bacteria | 31276 |
| 469 | Ga0501043_0002135 | 3300049579 | Bacteria | 16882 |
| 470 | Ga0501043_0014191 | 3300049579 | Bacteria | 6234 |
| 471 | Ga0501043_0060149 | 3300049579 | Bacteria | 2981 |
| 472 | Ga0501046_0001707 | 3300049580 | Bacteria | 20974 |
| 473 | Ga0501046_0008676 | 3300049580 | Bacteria | 8834 |
| 474 | Ga0501046_0101912 | 3300049580 | Bacteria | 2201 |
| 475 | Ga0501046_0325413 | 3300049580 | Bacteria | 1119 |
| 476 | Ga0501046_0716152 | 3300049580 | Bacteria | 704 |
| 477 | Ga0501047_0000182 | 3300049581 | Bacteria | 76846 |
| 478 | Ga0501047_0000248 | 3300049581 | Bacteria | 63961 |
| 479 | Ga0501047_0018108 | 3300049581 | Bacteria | 6750 |
| 480 | Ga0501047_0031371 | 3300049581 | Bacteria | 5125 |
| 481 | Ga0501047_0050702 | 3300049581 | Bacteria | 4008 |
| 482 | Ga0501047_0062942 | 3300049581 | Bacteria | 3578 |
| 483 | Ga0501047_0423784 | 3300049581 | Bacteria | 1162 |
| 484 | Ga0501047_0676120 | 3300049581 | Bacteria | 850 |
| 485 | Ga0501048_0003271 | 3300049582 | Bacteria | 12342 |
| 486 | Ga0501048_0052749 | 3300049582 | Bacteria | 2894 |
| 487 | Ga0501048_1316060 | 3300049582 | Bacteria | 519 |
| 488 | Ga0501067_0003554 | 3300049583 | Bacteria | 8578 |
| 489 | Ga0501067_0261861 | 3300049583 | Bacteria | 963 |
| 490 | Ga0501068_0000719 | 3300049584 | Bacteria | 16975 |
| 491 | Ga0501068_0313739 | 3300049584 | Bacteria | 1005 |
| 492 | Ga0501070_0006632 | 3300049586 | Bacteria | 9852 |
| 493 | Ga0501070_0012050 | 3300049586 | Bacteria | 7297 |
| 494 | Ga0501070_0043686 | 3300049586 | Bacteria | 3729 |
| 495 | Ga0501070_0855707 | 3300049586 | Bacteria | 711 |
| 496 | Ga0501070_0861727 | 3300049586 | Bacteria | 708 |
| 497 | Ga0501071_0000025 | 3300049587 | Bacteria | 49332 |
| 498 | Ga0501072_0000410 | 3300049588 | Bacteria | 30636 |
| 499 | Ga0501072_0972483 | 3300049588 | Bacteria | 662 |
| 500 | Ga0501073_0139717 | 3300049589 | Bacteria | 1678 |
| 501 | Ga0501073_0167170 | 3300049589 | Bacteria | 1523 |
| 502 | Ga0501073_0415757 | 3300049589 | Bacteria | 929 |
| 503 | Ga0501074_0014815 | 3300049590 | Bacteria | 5670 |
| 504 | Ga0501074_0094143 | 3300049590 | Bacteria | 2145 |
| 505 | Ga0501077_0001957 | 3300049593 | Bacteria | 12453 |
| 506 | Ga0501079_0032626 | 3300049741 | Bacteria | 4004 |
| 507 | Ga0501079_0988032 | 3300049741 | Bacteria | 663 |
| 508 | Ga0501080_0002814 | 3300049742 | Bacteria | 15291 |
| 509 | Ga0501083_0000422 | 3300049744 | Bacteria | 27169 |
| 510 | Ga0501282_002722 | 3300049778 | Bacteria | 1913 |
| 511 | Ga0501035_0000416 | 3300049822 | Bacteria | 48248 |
| 512 | Ga0501035_0002470 | 3300049822 | Bacteria | 18053 |
| 513 | Ga0501035_0002656 | 3300049822 | Bacteria | 17390 |
| 514 | Ga0501035_0006603 | 3300049822 | Bacteria | 10857 |
| 515 | Ga0501035_0023041 | 3300049822 | Bacteria | 5715 |
| 516 | Ga0501035_0038021 | 3300049822 | Bacteria | 4357 |
| 517 | Ga0501035_0058146 | 3300049822 | Bacteria | 3446 |
| 518 | Ga0501035_0096680 | 3300049822 | Bacteria | 2594 |
| 519 | Ga0501035_0606436 | 3300049822 | Bacteria | 891 |
| 520 | Ga0501035_0765940 | 3300049822 | Bacteria | 773 |
| 521 | Ga0501044_0001535 | 3300049823 | Bacteria | 27090 |
| 522 | Ga0501044_0008206 | 3300049823 | Bacteria | 11459 |
| 523 | Ga0501044_0009479 | 3300049823 | Bacteria | 10601 |
| 524 | Ga0501044_0040369 | 3300049823 | Bacteria | 4863 |
| 525 | Ga0501044_0129060 | 3300049823 | Bacteria | 2523 |
| 526 | Ga0501044_0364058 | 3300049823 | Bacteria | 1363 |
| 527 | Ga0501044_0903107 | 3300049823 | Bacteria | 758 |
| 528 | Ga0501044_1183657 | 3300049823 | Bacteria | 632 |
| 529 | Ga0501044_1581423 | 3300049823 | Bacteria | 520 |
| 530 | Ga0501045_0001009 | 3300049824 | Bacteria | 18478 |
| 531 | Ga0501045_0195359 | 3300049824 | Bacteria | 1508 |
| 532 | Ga0501045_0365317 | 3300049824 | Bacteria | 1074 |
| 533 | Ga0501045_0648470 | 3300049824 | Bacteria | 780 |
| 534 | nmdc:mga03n38_14633_c1 | 3300050490 | Bacteria | 3012 |
| 535 | nmdc:mga03n38_671493_c1 | 3300050490 | Bacteria | 595 |
| 536 | nmdc:mga0yw44_39781_c1 | 3300050492 | Bacteria | 2790 |
| 537 | nmdc:mga06z11_260534_c1 | 3300050494 | Bacteria | 1023 |
| 538 | nmdc:mga06z11_2689_c1 | 3300050494 | Bacteria | 6804 |
| 539 | nmdc:mga04h51_38167_c1 | 3300050495 | Bacteria | 1554 |
| 540 | nmdc:mga07m45_10260_c1 | 3300050496 | Bacteria | 4887 |
| 541 | nmdc:mga07m45_302064_c1 | 3300050496 | Bacteria | 931 |
| 542 | Ga0495655_0083228 | 3300053083 | Bacteria | 919 |
| 543 | Ga0495655_0238366 | 3300053083 | Bacteria | 608 |
| 544 | Ga0500578_0015819 | 3300053086 | Bacteria | 4843 |
| 545 | Ga0500647_0403925 | 3300053091 | Bacteria | 553 |
| 546 | Ga0500583_0147570 | 3300053092 | Bacteria | 1170 |
| 547 | Ga0500566_0062625 | 3300053094 | Bacteria | 2102 |
| 548 | Ga0500640_001709 | 3300053095 | Bacteria | 6841 |
| 549 | Ga0500654_029379 | 3300053099 | Bacteria | 3338 |
| 550 | Ga0500660_062614 | 3300053100 | Bacteria | 1784 |
| 551 | Ga0500660_125738 | 3300053100 | Bacteria | 1056 |
| 552 | Ga0500553_078599 | 3300053101 | Bacteria | 1493 |
| 553 | Ga0500560_030100 | 3300053107 | Bacteria | 1633 |
| 554 | Ga0500569_024007 | 3300053109 | Bacteria | 1645 |
| 555 | Ga0500608_149342 | 3300053122 | Bacteria | 1026 |
| 556 | Ga0500628_001962 | 3300053129 | Bacteria | 3458 |
| 557 | Ga0500652_022031 | 3300053131 | Bacteria | 2407 |
| 558 | Ga0500658_0423978 | 3300053134 | Bacteria | 607 |
| 559 | Ga0500561_0001570 | 3300053137 | Bacteria | 3727 |
| 560 | Ga0500573_0052596 | 3300053140 | Bacteria | 2341 |
| 561 | Ga0500579_077488 | 3300053143 | Bacteria | 1880 |
| 562 | Ga0500590_311945 | 3300053148 | Bacteria | 585 |
| 563 | Ga0500600_0016706 | 3300053149 | Bacteria | 4439 |
| 564 | Ga0500600_0286062 | 3300053149 | Bacteria | 715 |
| 565 | Ga0500616_0006235 | 3300053153 | Bacteria | 7865 |
| 566 | Ga0500633_0003334 | 3300053160 | Bacteria | 3488 |
| 567 | Ga0500634_0027131 | 3300053161 | Bacteria | 3120 |
| 568 | Ga0500636_0520146 | 3300053177 | Bacteria | 521 |
| 569 | Ga0500565_002669 | 3300053734 | Bacteria | 1351 |
| 570 | Ga0500587_000159 | 3300053739 | Bacteria | 6630 |
| 571 | Ga0501084_0011064 | 3300054114 | Bacteria | 7471 |
| 572 | Ga0587082_131938 | 3300059504 | Bacteria | 575 |
| 573 | Ga0587090_051002 | 3300059510 | Bacteria | 758 |
| 574 | Ga0587106_019813 | 3300059605 | Bacteria | 986 |
| 575 | Ga0587115_041165 | 3300059626 | Bacteria | 722 |
| 576 | Ga0501082_0007246 | 3300060353 | Bacteria | 9566 |
| 577 | Ga0466962_0023780 | 3300061719 | Bacteria | 2944 |
| 578 | Ga0466962_0028751 | 3300061719 | Bacteria | 2662 |
| 579 | 2547406514 | 2547132111 | Bacteria | 8013147 |
| 580 | 2554259563 | 2554235005 | Bacteria | 6457341 |
| 581 | 2585300375 | 2582581312 | Bacteria | 7308206 |
| 582 | 2585303511 | 2582581313 | Bacteria | 10042643 |
| 583 | 2585316994 | 2582581314 | Bacteria | 11452267 |
| 584 | 2616695604 | 2616644814 | Bacteria | 11555299 |
| 585 | 2616900842 | 2616644941 | Bacteria | 8510691 |
| 586 | 2643760231 | 2643221548 | Bacteria | 8053412 |
| 587 | 2643904471 | 2643221578 | Bacteria | 9213798 |
| 588 | 2643946568 | 2643221587 | Bacteria | 7586415 |
| 589 | 2644268002 | 2643221647 | Bacteria | 10741251 |
| 590 | 2644389080 | 2643221670 | Bacteria | 6497041 |
| 591 | 2644406261 | 2643221673 | Bacteria | 9196637 |
| 592 | 2644434372 | 2643221677 | Bacteria | 7584031 |
| 593 | 2644443678 | 2643221678 | Bacteria | 9540101 |
| 594 | 2644460073 | 2643221682 | Bacteria | 6743283 |
| 595 | 2644629608 | 2643221714 | Bacteria | 9015452 |
| 596 | 2784586731 | 2784132148 | Bacteria | 8627943 |
| 597 | 2785345755 | 2784746763 | Bacteria | 9783172 |
| 598 | 2785367134 | 2784746768 | Bacteria | 10036182 |
| 599 | 2786668182 | 2786546132 | Bacteria | 10419719 |
| 600 | 2793976637 | 2791355406 | Bacteria | 11364898 |
| 601 | 2804843716 | 2802429296 | Bacteria | 7227771 |
| 602 | 2808847640 | 2808606359 | Bacteria | 9866990 |
| 603 | 2808918374 | 2808606375 | Bacteria | 9466072 |
| 604 | 2809230298 | 2808606448 | Bacteria | 8656184 |
| 605 | 2811846950 | 2808606982 | Bacteria | 7791042 |
| 606 | 2812360335 | 2811994879 | Bacteria | 9313447 |
| 607 | 2819696350 | 2818991463 | Bacteria | 7948711 |
| 608 | 2852637694 | 2852635781 | Bacteria | 8251373 |
| 609 | 2862186267 | 2862178590 | Bacteria | 8583590 |
| 610 | 2862289678 | 2862281513 | Bacteria | 9621493 |
| 611 | 2862292448 | 2862290372 | Bacteria | 7471434 |
| 612 | 2862386975 | 2862382967 | Bacteria | 10317375 |
| 613 | 2862510401 | 2862507626 | Bacteria | 9425308 |
| 614 | 2862583737 | 2862574272 | Bacteria | 10567477 |
| 615 | 2862711231 | 2862705112 | Bacteria | 6563286 |
| 616 | 2863406990 | 2863404153 | Bacteria | 9672205 |
| 617 | 2867346816 | 2867346516 | Bacteria | 7608576 |
| 618 | 2867369836 | 2867369537 | Bacteria | 6501581 |
| 619 | 2867430061 | 2867428634 | Bacteria | 9590268 |
| 620 | 2867475684 | 2867475112 | Bacteria | 6909112 |
| 621 | 2873157698 | 2873151551 | Bacteria | 8625867 |
| 622 | 2875392675 | 2875391855 | Bacteria | 7600475 |
| 623 | 2877683412 | 2877676314 | Bacteria | 9512378 |
| 624 | 2912722419 | 2912715099 | Bacteria | 9460473 |
| 625 | 2912726123 | 2912723979 | Bacteria | 8557534 |
| 626 | 2912758873 | 2912757875 | Bacteria | 7940295 |
| 627 | 2918502502 | 2918501144 | Bacteria | 8668083 |
| 628 | 2919472211 | 2919468124 | Bacteria | 9133025 |
| 629 | 2946052039 | 2946045630 | Bacteria | 8527308 |
| 630 | 2946065553 | 2946064051 | Bacteria | 8957905 |
| 631 | 2946073914 | 2946072368 | Bacteria | 8999607 |
| 632 | 2947231856 | 2947224130 | Bacteria | 9938529 |
| 633 | 2954011090 | 2954002825 | Bacteria | 9173742 |
| 634 | 2954388659 | 2954380949 | Bacteria | 10050426 |
| 635 | 2954674465 | 2954673503 | Bacteria | 9685905 |
| 636 | 2954689667 | 2954682443 | Bacteria | 9862841 |
| 637 | 2954699450 | 2954691527 | Bacteria | 10720516 |
| 638 | 2954702768 | 2954701450 | Bacteria | 10834262 |
| 639 | 2954718390 | 2954711539 | Bacteria | 10867210 |
| 640 | 2954728360 | 2954721474 | Bacteria | 10456478 |
| 641 | 2954733449 | 2954731030 | Bacteria | 10243860 |
| 642 | 2954747256 | 2954740390 | Bacteria | 10229294 |
| 643 | 2954752332 | 2954749733 | Bacteria | 10366972 |
| 644 | 2954766371 | 2954759201 | Bacteria | 9358192 |
| 645 | 2966604435 | 2966598605 | Bacteria | 7676064 |
| 646 | 2990045848 | 2990044586 | Bacteria | 6603797 |
| 647 | 2990059594 | 2990059506 | Bacteria | 9321252 |
| 648 | 2995469375 | 2995463766 | Bacteria | 8577691 |
| 649 | 2997453992 | 2997451912 | Bacteria | 8492419 |
| 650 | 2997605692 | 2997600082 | Bacteria | 9896405 |
| 651 | 3006328030 | 3006321560 | Bacteria | 8247479 |
| 652 | 3006399558 | 3006393351 | Bacteria | 6615579 |
| 653 | 3006430690 | 3006425503 | Bacteria | 6491253 |
| 654 | 3006490460 | 3006486233 | Bacteria | 8157040 |
| 655 | 3006495135 | 3006493962 | Bacteria | 8825450 |
| 656 | 8008486582 | 8008485437 | Bacteria | 7198341 |
| 657 | 8008561295 | 8008558824 | Bacteria | 10610750 |
| 658 | 8008580767 | 8008574985 | Bacteria | 7815457 |
| 659 | 8023625009 | 8023623736 | Bacteria | 8593882 |
| 660 | 8025414828 | 8025413630 | Bacteria | 7014048 |
| 661 | 8025484321 | 8025478263 | Bacteria | 8209203 |
| 662 | 8025525651 | 8025524527 | Bacteria | 7197316 |
| 663 | 8025534175 | 8025530807 | Bacteria | 8495698 |
| 664 | 8033685009 | 8033684223 | Bacteria | 6906479 |
| 665 | 8047894829 | 8047893842 | Bacteria | 11723082 |
| 666 | 8048130385 | 8048127548 | Bacteria | 11053136 |
| 667 | 8048364220 | 8048356638 | Bacteria | 11044339 |
| 668 | 8048371848 | 8048369669 | Bacteria | 11666822 |
| 669 | 8048380781 | 8048379754 | Bacteria | 11877923 |
| 670 | 8048408148 | 8048406513 | Bacteria | 8936924 |
| 671 | 8054163831 | 8054160619 | Bacteria | 7783213 |
| 672 | 8056449966 | 8056447290 | Bacteria | 7680491 |
| 673 | 8056670551 | 8056667051 | Bacteria | 6953971 |
| 674 | 8056835720 | 8056829672 | Bacteria | 9045328 |
| 675 | Ga0213876_10396322 | |||
| 676 | JGI24739J22299_10055804 | |||
| 677 | JGI24737J22298_10116431 | |||
| 678 | JGI24735J21928_10032874 | |||
| 679 | JGI24738J21930_10025858 | |||
| 680 | Ga0006759J45824_1032939 | |||
| 681 | Ga0006777J48905_1036155 | |||
| 682 | rootH1_10031237 | |||
| 683 | rootH2_10034114 | |||
| 684 | rootH1_10040758 | |||
| 685 | JGI25160J50197_1065056 | |||
| 686 | Ga0007429J51699_1015681 | |||
| 687 | Ga0032354_1035482 | |||
| 688 | Ga0058860_12012580 | |||
| 689 | Ga0070668_100962204 | |||
| 690 | Ga0070713_100892576 | |||
| 691 | Ga0070700_100621755 | |||
| 692 | Ga0070663_100024046 | |||
| 693 | Ga0070663_100402752 | |||
| 694 | Ga0070678_100623914 | |||
| 695 | Ga0070685_10858566 | |||
| 696 | Ga0068853_100286515 | |||
| 697 | Ga0070665_100026333 | |||
| 698 | Ga0070665_100255573 | |||
| 699 | Ga0068855_100157186 | |||
| 700 | Ga0068854_100104955 | |||
| 701 | Ga0068856_100019950 | |||
| 702 | Ga0068856_100155350 | |||
| 703 | Ga0081455_10008729 | |||
| 704 | Ga0070717_10824194 | |||
| 705 | Ga0075365_10290836 | |||
| 706 | Ga0075368_10014916 | |||
| 707 | Ga0075363_100119550 | |||
| 708 | Ga0075367_10026522 | |||
| 709 | Ga0075370_10211348 | |||
| 710 | Ga0068871_100934239 | |||
| 711 | Ga0105251_10010987 | |||
| 712 | Ga0105251_10163052 | |||
| 713 | Ga0105250_10041818 | |||
| 714 | Ga0105240_10105251 | |||
| 715 | Ga0105240_10185075 | |||
| 716 | Ga0105240_10568995 | |||
| 717 | Ga0105245_10950677 | |||
| 718 | Ga0105243_10068550 | |||
| 719 | Ga0105243_10250429 | |||
| 720 | Ga0105241_11598753 | |||
| 721 | Ga0105242_10965277 | |||
| 722 | Ga0105237_10092682 | |||
| 723 | Ga0105238_10101763 | |||
| 724 | Ga0105238_10172196 | |||
| 725 | Ga0105238_11850257 | |||
| 726 | Ga0105249_10577177 | |||
| 727 | Ga0105239_10216162 | |||
| 728 | Ga0105239_12541863 | |||
| 729 | Ga0105246_10048719 | |||
| 730 | Ga0105246_10237725 | |||
| 731 | Ga0157373_10430037 | |||
| 732 | Ga0157370_10077839 | |||
| 733 | Ga0157369_10149368 | |||
| 734 | Ga0157378_11770451 | |||
| 735 | Ga0157372_10354375 | |||
| 736 | Ga0157372_13053094 | |||
| 737 | Ga0163163_11743996 | |||
| 738 | Ga0182008_10000988 | |||
| 739 | Ga0157376_10813856 | |||
| 740 | Ga0182007_10003459 | |||
| 741 | Ga0183367_1017 | |||
| 742 | Ga0197907_11334973 | |||
| 743 | Ga0206356_11574620 | |||
| 744 | Ga0206355_1211322 | |||
| 745 | Ga0206352_10491978 | |||
| 746 | Ga0213873_10022928 | |||
| 747 | Ga0213874_10024878 | |||
| 748 | Ga0213874_10054339 | |||
| 749 | Ga0213876_10007819 | |||
| 750 | Ga0213875_10000006 | |||
| 751 | Ga0213875_10000864 | |||
| 752 | Ga0213875_10000915 | |||
| 753 | Ga0213875_10001927 | |||
| 754 | Ga0213875_10166490 | |||
| 755 | Ga0213875_10317748 | |||
| 756 | Ga0224712_10456910 | |||
| 757 | Ga0256744_126621 | |||
| 758 | Ga0209758_1013065 | |||
| 759 | Ga0207426_1002709 | |||
| 760 | Ga0207426_1030467 | |||
| 761 | Ga0207713_1025206 | |||
| 762 | Ga0207647_10032063 | |||
| 763 | Ga0207695_10099559 | |||
| 764 | Ga0207695_10451202 | |||
| 765 | Ga0207694_10361151 | |||
| 766 | Ga0207694_11224802 | |||
| 767 | Ga0207687_10501973 | |||
| 768 | Ga0207709_10511310 | |||
| 769 | Ga0207709_10875260 | |||
| 770 | Ga0207691_10867973 | |||
| 771 | Ga0207667_10323303 | |||
| 772 | Ga0207668_11148783 | |||
| 773 | Ga0207678_10964334 | |||
| 774 | Ga0207702_10032363 | |||
| 775 | Ga0207702_10288721 | |||
| 776 | Ga0207676_11377523 | |||
| 777 | Ga0209371_1034607 | |||
| 778 | Ga0209813_10017281 | |||
| 779 | Ga0268266_10071701 | |||
| 780 | Ga0268266_10075196 | |||
| 781 | Ga0268266_11092176 | |||
| 782 | Ga0307517_10006575 | |||
| 783 | Ga0307517_10006948 | |||
| 784 | Ga0307515_10002608 | |||
| 785 | Ga0307515_10160601 | |||
| 786 | Ga0307515_10656761 | |||
| 787 | Ga0310981_1040932 | |||
| 788 | Ga0268256_1036724 | |||
| 789 | Ga0307511_10004244 | |||
| 790 | Ga0307511_10373286 | |||
| 791 | Ga0307512_10236493 | |||
| 792 | Ga0307512_10343552 | |||
| 793 | Ga0307513_10023135 | |||
| 794 | Ga0307513_10080246 | |||
| 795 | Ga0307513_10460710 | |||
| 796 | Ga0307509_10178836 | |||
| 797 | Ga0307508_10001597 | |||
| 798 | Ga0307508_10117503 | |||
| 799 | Ga0307508_10451782 | |||
| 800 | Ga0307514_10003022 | |||
| 801 | Ga0307514_10252073 | |||
| 802 | Ga0307514_10435850 | |||
| 803 | Ga0307516_10017360 | |||
| 804 | Ga0307516_10450024 | |||
| 805 | Ga0307516_10557730 | |||
| 806 | Ga0307518_10514525 | |||
| 807 | Ga0307409_100395735 | |||
| 808 | Ga0307416_100475213 | |||
| 809 | Ga0307507_10272018 | |||
| 810 | Ga0307510_10092342 | |||
| 811 | Ga0307510_10108802 | |||
| 812 | Ga0307510_10121579 | |||
| 813 | Ga0307510_10484548 | |||
| 814 | Ga0395898_1042758 | |||
| 815 | Ga0436364_0056406 | |||
| 816 | Ga0436364_0244345 | |||
| 817 | Ga0436364_0270098 | |||
| 818 | Ga0436364_0478514 | |||
| 819 | Ga0436364_0510827 | |||
| 820 | Ga0436364_0556898 | |||
| 821 | Ga0436364_0846682 | |||
| 822 | Ga0436364_0883683 | |||
| 823 | Ga0436364_1382991 | |||
| 824 | Ga0436364_1494813 | |||
| 825 | Ga0395901_0157962 | |||
| 826 | Ga0436365_0674457 | |||
| 827 | Ga0436365_0965826 | |||
| 828 | Ga0436365_1169743 | |||
| 829 | Ga0436365_1859987 | |||
| 830 | Ga0436360_0895846 | |||
| 831 | Ga0436363_0075268 | |||
| 832 | Ga0436363_0723725 | |||
| 833 | Ga0436363_0782860 | |||
| 834 | Ga0436363_0831071 | |||
| 835 | Ga0436362_0161559 | |||
| 836 | Ga0436362_0460211 | |||
| 837 | Ga0436362_0905448 | |||
| 838 | Ga0439436_0031145 | |||
| 839 | Ga0439438_153303 | |||
| 840 | Ga0439439_0004399 | |||
| 841 | Ga0439439_0042543 | |||
| 842 | Ga0439439_0047432 | |||
| 843 | Ga0439466_0164429 | |||
| 844 | Ga0451789_1319408 | |||
| 845 | Ga0451837_0603095 | |||
| 846 | Ga0451837_1301561 | |||
| 847 | Ga0451841_0092612 | |||
| 848 | Ga0451843_0953098 | |||
| 849 | Ga0451853_0211892 | |||
| 850 | Ga0451853_0490855 | |||
| 851 | Ga0451853_1580339 | |||
| 852 | Ga0439433_0008791 | |||
| 853 | Ga0439442_041904 | |||
| 854 | Ga0439448_0011854 | |||
| 855 | Ga0439432_183324 | |||
| 856 | Ga0439449_0032393 | |||
| 857 | Ga0439449_0099150 | |||
| 858 | Ga0439450_038977 | |||
| 859 | Ga0439457_000613 | |||
| 860 | Ga0439457_001721 | |||
| 861 | Ga0450894_000807 | |||
| 862 | Ga0450896_000627 | |||
| 863 | Ga0450898_008769 | |||
| 864 | Ga0450899_000169 | |||
| 865 | Ga0450902_054662 | |||
| 866 | Ga0450903_000046 | |||
| 867 | Ga0450906_000464 | |||
| 868 | Ga0439458_0004062 | |||
| 869 | Ga0450908_038407 | |||
| 870 | Ga0450893_0103765 | |||
| 871 | Ga0466969_0003467 | |||
| 872 | Ga0466969_0144300 | |||
| 873 | Ga0466969_0168029 | |||
| 874 | Ga0466972_0000856 | |||
| 875 | Ga0466972_0012638 | |||
| 876 | Ga0466965_0150425 | |||
| 877 | Ga0466965_0516090 | |||
| 878 | Ga0466965_0608954 | |||
| 879 | Ga0466966_0003382 | |||
| 880 | Ga0466966_0007385 | |||
| 881 | Ga0466966_0173309 | |||
| 882 | Ga0466961_0009126 | |||
| 883 | Ga0466961_0041940 | |||
| 884 | Ga0466961_0047806 | |||
| 885 | Ga0466961_0165756 | |||
| 886 | Ga0466963_0002539 | |||
| 887 | Ga0466963_0004501 | |||
| 888 | Ga0466971_0023115 | |||
| 889 | Ga0466971_0141063 | |||
| 890 | Ga0466971_0181142 | |||
| 891 | Ga0466968_0236056 | |||
| 892 | Ga0466970_0042533 | |||
| 893 | Ga0466970_0212431 | |||
| 894 | Ga0466970_0273866 | |||
| 895 | Ga0466970_0493555 | |||
| 896 | Ga0466957_0250516 | |||
| 897 | Ga0466957_0496629 | |||
| 898 | Ga0466960_0022863 | |||
| 899 | Ga0466959_0021880 | |||
| 900 | Ga0466959_0226088 | |||
| 901 | Ga0466959_0243481 | |||
| 902 | Ga0466958_0019276 | |||
| 903 | Ga0466967_0007504 | |||
| 904 | Ga0466967_0254921 | |||
| 905 | Ga0466967_0920919 | |||
| 906 | Ga0495627_028646 | |||
| 907 | Ga0495592_0033363 | |||
| 908 | Ga0495592_0036940 | |||
| 909 | Ga0495603_0006352 | |||
| 910 | Ga0495603_0038202 | |||
| 911 | Ga0495603_0095012 | |||
| 912 | Ga0495603_0195704 | |||
| 913 | Ga0495590_0046480 | |||
| 914 | Ga0495629_0029219 | |||
| 915 | Ga0495629_0065494 | |||
| 916 | Ga0495629_0162811 | |||
| 917 | Ga0495629_0317896 | |||
| 918 | Ga0495629_0825641 | |||
| 919 | Ga0495638_0009750 | |||
| 920 | Ga0495638_0044492 | |||
| 921 | Ga0495638_0291622 | |||
| 922 | Ga0495638_0394629 | |||
| 923 | Ga0495651_0030718 | |||
| 924 | Ga0495651_0048941 | |||
| 925 | Ga0495580_0138645 | |||
| 926 | Ga0495605_0104447 | |||
| 927 | Ga0495639_0086195 | |||
| 928 | Ga0495662_0124218 | |||
| 929 | Ga0495662_0348912 | |||
| 930 | Ga0495662_0381662 | |||
| 931 | Ga0495662_0650704 | |||
| 932 | Ga0495664_0149545 | |||
| 933 | Ga0495584_0125757 | |||
| 934 | Ga0495594_0022258 | |||
| 935 | Ga0495594_0084940 | |||
| 936 | Ga0495594_0115316 | |||
| 937 | Ga0495594_0257265 | |||
| 938 | Ga0495596_0036541 | |||
| 939 | Ga0495607_0040941 | |||
| 940 | Ga0495606_0041254 | |||
| 941 | Ga0495616_0030172 | |||
| 942 | Ga0495618_0072653 | |||
| 943 | Ga0495618_0245294 | |||
| 944 | Ga0495620_0206742 | |||
| 945 | Ga0495628_0019731 | |||
| 946 | Ga0495628_0751467 | |||
| 947 | Ga0495628_0901379 | |||
| 948 | Ga0495630_0088688 | |||
| 949 | Ga0495631_0052433 | |||
| 950 | Ga0495632_0328201 | |||
| 951 | Ga0495637_0039914 | |||
| 952 | Ga0495643_0005160 | |||
| 953 | Ga0495643_0107561 | |||
| 954 | Ga0495648_0474817 | |||
| 955 | Ga0495642_0417812 | |||
| 956 | Ga0495652_0066063 | |||
| 957 | Ga0495652_0073097 | |||
| 958 | Ga0495654_0052156 | |||
| 959 | Ga0495640_0010859 | |||
| 960 | Ga0495640_0074440 | |||
| 961 | Ga0495640_0177362 | |||
| 962 | Ga0495587_0003878 | |||
| 963 | Ga0495609_0026656 | |||
| 964 | Ga0495597_0029329 | |||
| 965 | Ga0495622_0032353 | |||
| 966 | Ga0495622_0092576 | |||
| 967 | Ga0495633_0028713 | |||
| 968 | Ga0495667_0152104 | |||
| 969 | Ga0495668_0376498 | |||
| 970 | Ga0495634_0025545 | |||
| 971 | Ga0495611_0003810 | |||
| 972 | Ga0495611_0087266 | |||
| 973 | Ga0495625_0138882 | |||
| 974 | Ga0495635_0032901 | |||
| 975 | Ga0495635_0285726 | |||
| 976 | Ga0495659_0251362 | |||
| 977 | Ga0495661_0468870 | |||
| 978 | Ga0495588_0014001 | |||
| 979 | Ga0495588_0093011 | |||
| 980 | Ga0495588_0272043 | |||
| 981 | Ga0495657_0002935 | |||
| 982 | Ga0495657_0043952 | |||
| 983 | Ga0495599_0862752 | |||
| 984 | Ga0495623_0667768 | |||
| 985 | Ga0495646_0001643 | |||
| 986 | Ga0495658_0007199 | |||
| 987 | Ga0495613_0014244 | |||
| 988 | Ga0495613_0053918 | |||
| 989 | Ga0495613_0282576 | |||
| 990 | Ga0495613_0287042 | |||
| 991 | Ga0495613_0442453 | |||
| 992 | Ga0495624_0163850 | |||
| 993 | Ga0495624_0333191 | |||
| 994 | Ga0495624_0722654 | |||
| 995 | Ga0495670_0024416 | |||
| 996 | Ga0495670_0085986 | |||
| 997 | Ga0495671_0070870 | |||
| 998 | Ga0495649_0123737 | |||
| 999 | Ga0495649_0193527 | |||
| 1000 | Ga0495589_0058900 | |||
| 1001 | Ga0495589_0184953 | |||
| 1002 | Ga0495589_0200681 | |||
| 1003 | Ga0495589_0323393 | |||
| 1004 | Ga0495600_0002980 | |||
| 1005 | Ga0495600_0010512 | |||
| 1006 | Ga0495600_0587765 | |||
| 1007 | Ga0495660_0085225 | |||
| 1008 | Ga0495660_0139744 | |||
| 1009 | Ga0495581_0048759 | |||
| 1010 | Ga0495581_0088443 | |||
| 1011 | Ga0495581_0212672 | |||
| 1012 | Ga0495581_0322925 | |||
| 1013 | Ga0495604_0002330 | |||
| 1014 | Ga0495636_0229125 | |||
| 1015 | Ga0495674_0163005 | |||
| 1016 | Ga0495672_0081248 | |||
| 1017 | Ga0495676_0004289 | |||
| 1018 | Ga0495676_0004409 | |||
| 1019 | Ga0495676_0029226 | |||
| 1020 | Ga0495676_0049427 | |||
| 1021 | Ga0495676_0084656 | |||
| 1022 | Ga0495676_0283752 | |||
| 1023 | Ga0495676_0289283 | |||
| 1024 | Ga0495683_0038000 | |||
| 1025 | Ga0495687_002181 | |||
| 1026 | Ga0495687_009612 | |||
| 1027 | Ga0495687_045737 | |||
| 1028 | Ga0495687_140747 | |||
| 1029 | Ga0495675_0051898 | |||
| 1030 | Ga0495675_0222769 | |||
| 1031 | Ga0495677_0035866 | |||
| 1032 | Ga0495679_109172 | |||
| 1033 | Ga0495685_000258 | |||
| 1034 | Ga0495685_006768 | |||
| 1035 | Ga0495685_049117 | |||
| 1036 | Ga0495685_172357 | |||
| 1037 | Ga0495681_0001206 | |||
| 1038 | Ga0495684_0514041 | |||
| 1039 | Ga0495686_0098686 | |||
| 1040 | Ga0495686_0328566 | |||
| 1041 | Ga0495686_0452791 | |||
| 1042 | Ga0495593_0033838 | |||
| 1043 | Ga0495593_0245963 | |||
| 1044 | Ga0495593_0420379 | |||
| 1045 | Ga0495614_0065220 | |||
| 1046 | Ga0495614_0093641 | |||
| 1047 | Ga0495614_0469582 | |||
| 1048 | Ga0495614_0663271 | |||
| 1049 | Ga0495615_0314131 | |||
| 1050 | Ga0495626_0025863 | |||
| 1051 | Ga0496102_0865084 | |||
| 1052 | Ga0496106_0186212 | |||
| 1053 | Ga0496110_1847591 | |||
| 1054 | Ga0496126_1209159 | |||
| 1055 | Ga0501306_003717 | |||
| 1056 | Ga0501306_015608 | |||
| 1057 | Ga0501306_017192 | |||
| 1058 | Ga0501308_022690 | |||
| 1059 | Ga0501309_015852 | |||
| 1060 | Ga0501309_089010 | |||
| 1061 | Ga0501310_011967 | |||
| 1062 | Ga0501310_029261 | |||
| 1063 | Ga0495678_028156 | |||
| 1064 | Ga0501311_007147 | |||
| 1065 | Ga0501311_014213 | |||
| 1066 | Ga0501312_019319 | |||
| 1067 | Ga0501312_021894 | |||
| 1068 | Ga0501313_029467 | |||
| 1069 | Ga0501315_013840 | |||
| 1070 | Ga0501315_027060 | |||
| 1071 | Ga0501316_066473 | |||
| 1072 | Ga0501317_005396 | |||
| 1073 | Ga0501317_008083 | |||
| 1074 | Ga0501318_004481 | |||
| 1075 | Ga0501318_005240 | |||
| 1076 | Ga0501318_018940 | |||
| 1077 | Ga0501319_002258 | |||
| 1078 | Ga0501320_005888 | |||
| 1079 | Ga0501320_008684 | |||
| 1080 | Ga0501320_011503 | |||
| 1081 | Ga0501321_006255 | |||
| 1082 | Ga0501322_017773 | |||
| 1083 | Ga0501323_007984 | |||
| 1084 | Ga0501323_013342 | |||
| 1085 | Ga0501323_024234 | |||
| 1086 | Ga0501323_025022 | |||
| 1087 | Ga0501323_065089 | |||
| 1088 | Ga0501324_007747 | |||
| 1089 | Ga0501324_009205 | |||
| 1090 | Ga0501324_034136 | |||
| 1091 | Ga0501325_002795 | |||
| 1092 | Ga0501031_0001063 | |||
| 1093 | Ga0501031_0036778 | |||
| 1094 | Ga0501031_0150345 | |||
| 1095 | Ga0501031_0174982 | |||
| 1096 | Ga0501031_0249599 | |||
| 1097 | Ga0501031_0508101 | |||
| 1098 | Ga0501032_0006508 | |||
| 1099 | Ga0501032_0011853 | |||
| 1100 | Ga0501032_0137594 | |||
| 1101 | Ga0501032_0622955 | |||
| 1102 | Ga0501032_0715263 | |||
| 1103 | Ga0501033_0004692 | |||
| 1104 | Ga0501033_0045310 | |||
| 1105 | Ga0501033_0356771 | |||
| 1106 | Ga0501033_0673618 | |||
| 1107 | Ga0501033_0835326 | |||
| 1108 | Ga0501034_0002413 | |||
| 1109 | Ga0501034_0004049 | |||
| 1110 | Ga0501034_0021980 | |||
| 1111 | Ga0501034_0050260 | |||
| 1112 | Ga0501034_0061146 | |||
| 1113 | Ga0501034_0232847 | |||
| 1114 | Ga0501034_0795472 | |||
| 1115 | Ga0501036_0002141 | |||
| 1116 | Ga0501036_0002186 | |||
| 1117 | Ga0501036_0013951 | |||
| 1118 | Ga0501036_0060745 | |||
| 1119 | Ga0501036_0097141 | |||
| 1120 | Ga0501036_0135291 | |||
| 1121 | Ga0501036_1166549 | |||
| 1122 | Ga0501037_0002849 | |||
| 1123 | Ga0501037_0009060 | |||
| 1124 | Ga0501037_0031541 | |||
| 1125 | Ga0501037_0085798 | |||
| 1126 | Ga0501037_0252346 | |||
| 1127 | Ga0501037_0318079 | |||
| 1128 | Ga0501037_0511632 | |||
| 1129 | Ga0501038_0008847 | |||
| 1130 | Ga0501038_0015266 | |||
| 1131 | Ga0501038_0023267 | |||
| 1132 | Ga0501038_0232812 | |||
| 1133 | Ga0501038_0529590 | |||
| 1134 | Ga0501038_0680283 | |||
| 1135 | Ga0501039_0002709 | |||
| 1136 | Ga0501039_0040935 | |||
| 1137 | Ga0501040_0016468 | |||
| 1138 | Ga0501041_0014510 | |||
| 1139 | Ga0501042_0002745 | |||
| 1140 | Ga0501042_0042276 | |||
| 1141 | Ga0501043_0000622 | |||
| 1142 | Ga0501043_0002135 | |||
| 1143 | Ga0501043_0014191 | |||
| 1144 | Ga0501043_0060149 | |||
| 1145 | Ga0501046_0001707 | |||
| 1146 | Ga0501046_0008676 | |||
| 1147 | Ga0501046_0101912 | |||
| 1148 | Ga0501046_0325413 | |||
| 1149 | Ga0501046_0716152 | |||
| 1150 | Ga0501047_0000182 | |||
| 1151 | Ga0501047_0000248 | |||
| 1152 | Ga0501047_0018108 | |||
| 1153 | Ga0501047_0031371 | |||
| 1154 | Ga0501047_0050702 | |||
| 1155 | Ga0501047_0062942 | |||
| 1156 | Ga0501047_0423784 | |||
| 1157 | Ga0501047_0676120 | |||
| 1158 | Ga0501048_0003271 | |||
| 1159 | Ga0501048_0052749 | |||
| 1160 | Ga0501048_1316060 | |||
| 1161 | Ga0501067_0003554 | |||
| 1162 | Ga0501067_0261861 | |||
| 1163 | Ga0501068_0000719 | |||
| 1164 | Ga0501068_0313739 | |||
| 1165 | Ga0501070_0006632 | |||
| 1166 | Ga0501070_0012050 | |||
| 1167 | Ga0501070_0043686 | |||
| 1168 | Ga0501070_0855707 | |||
| 1169 | Ga0501070_0861727 | |||
| 1170 | Ga0501071_0000025 | |||
| 1171 | Ga0501072_0000410 | |||
| 1172 | Ga0501072_0972483 | |||
| 1173 | Ga0501073_0139717 | |||
| 1174 | Ga0501073_0167170 | |||
| 1175 | Ga0501073_0415757 | |||
| 1176 | Ga0501074_0014815 | |||
| 1177 | Ga0501074_0094143 | |||
| 1178 | Ga0501077_0001957 | |||
| 1179 | Ga0501079_0032626 | |||
| 1180 | Ga0501079_0988032 | |||
| 1181 | Ga0501080_0002814 | |||
| 1182 | Ga0501083_0000422 | |||
| 1183 | Ga0501282_002722 | |||
| 1184 | Ga0501035_0000416 | |||
| 1185 | Ga0501035_0002470 | |||
| 1186 | Ga0501035_0002656 | |||
| 1187 | Ga0501035_0006603 | |||
| 1188 | Ga0501035_0023041 | |||
| 1189 | Ga0501035_0038021 | |||
| 1190 | Ga0501035_0058146 | |||
| 1191 | Ga0501035_0096680 | |||
| 1192 | Ga0501035_0606436 | |||
| 1193 | Ga0501035_0765940 | |||
| 1194 | Ga0501044_0001535 | |||
| 1195 | Ga0501044_0008206 | |||
| 1196 | Ga0501044_0009479 | |||
| 1197 | Ga0501044_0040369 | |||
| 1198 | Ga0501044_0129060 | |||
| 1199 | Ga0501044_0364058 | |||
| 1200 | Ga0501044_0903107 | |||
| 1201 | Ga0501044_1183657 | |||
| 1202 | Ga0501044_1581423 | |||
| 1203 | Ga0501045_0001009 | |||
| 1204 | Ga0501045_0195359 | |||
| 1205 | Ga0501045_0365317 | |||
| 1206 | Ga0501045_0648470 | |||
| 1207 | nmdc:mga03n38_14633_c1 | |||
| 1208 | nmdc:mga03n38_671493_c1 | |||
| 1209 | nmdc:mga0yw44_39781_c1 | |||
| 1210 | nmdc:mga06z11_260534_c1 | |||
| 1211 | nmdc:mga06z11_2689_c1 | |||
| 1212 | nmdc:mga04h51_38167_c1 | |||
| 1213 | nmdc:mga07m45_10260_c1 | |||
| 1214 | nmdc:mga07m45_302064_c1 | |||
| 1215 | Ga0495655_0083228 | |||
| 1216 | Ga0495655_0238366 | |||
| 1217 | Ga0500578_0015819 | |||
| 1218 | Ga0500647_0403925 | |||
| 1219 | Ga0500583_0147570 | |||
| 1220 | Ga0500566_0062625 | |||
| 1221 | Ga0500640_001709 | |||
| 1222 | Ga0500654_029379 | |||
| 1223 | Ga0500660_062614 | |||
| 1224 | Ga0500660_125738 | |||
| 1225 | Ga0500553_078599 | |||
| 1226 | Ga0500560_030100 | |||
| 1227 | Ga0500569_024007 | |||
| 1228 | Ga0500608_149342 | |||
| 1229 | Ga0500628_001962 | |||
| 1230 | Ga0500652_022031 | |||
| 1231 | Ga0500658_0423978 | |||
| 1232 | Ga0500561_0001570 | |||
| 1233 | Ga0500573_0052596 | |||
| 1234 | Ga0500579_077488 | |||
| 1235 | Ga0500590_311945 | |||
| 1236 | Ga0500600_0016706 | |||
| 1237 | Ga0500600_0286062 | |||
| 1238 | Ga0500616_0006235 | |||
| 1239 | Ga0500633_0003334 | |||
| 1240 | Ga0500634_0027131 | |||
| 1241 | Ga0500636_0520146 | |||
| 1242 | Ga0500565_002669 | |||
| 1243 | Ga0500587_000159 | |||
| 1244 | Ga0501084_0011064 | |||
| 1245 | Ga0587082_131938 | |||
| 1246 | Ga0587090_051002 | |||
| 1247 | Ga0587106_019813 | |||
| 1248 | Ga0587115_041165 | |||
| 1249 | Ga0501082_0007246 | |||
| 1250 | Ga0466962_0023780 | |||
| 1251 | Ga0466962_0028751 | |||
| 1252 | 2547406514 | |||
| 1253 | 2554259563 | |||
| 1254 | 2585300375 | |||
| 1255 | 2585303511 | |||
| 1256 | 2585316994 | |||
| 1257 | 2616695604 | |||
| 1258 | 2616900842 | |||
| 1259 | 2643760231 | |||
| 1260 | 2643904471 | |||
| 1261 | 2643946568 | |||
| 1262 | 2644268002 | |||
| 1263 | 2644389080 | |||
| 1264 | 2644406261 | |||
| 1265 | 2644434372 | |||
| 1266 | 2644443678 | |||
| 1267 | 2644460073 | |||
| 1268 | 2644629608 | |||
| 1269 | 2784586731 | |||
| 1270 | 2785345755 | |||
| 1271 | 2785367134 | |||
| 1272 | 2786668182 | |||
| 1273 | 2793976637 | |||
| 1274 | 2804843716 | |||
| 1275 | 2808847640 | |||
| 1276 | 2808918374 | |||
| 1277 | 2809230298 | |||
| 1278 | 2811846950 | |||
| 1279 | 2812360335 | |||
| 1280 | 2819696350 | |||
| 1281 | 2852637694 | |||
| 1282 | 2862186267 | |||
| 1283 | 2862289678 | |||
| 1284 | 2862292448 | |||
| 1285 | 2862386975 | |||
| 1286 | 2862510401 | |||
| 1287 | 2862583737 | |||
| 1288 | 2862711231 | |||
| 1289 | 2863406990 | |||
| 1290 | 2867346816 | |||
| 1291 | 2867369836 | |||
| 1292 | 2867430061 | |||
| 1293 | 2867475684 | |||
| 1294 | 2873157698 | |||
| 1295 | 2875392675 | |||
| 1296 | 2877683412 | |||
| 1297 | 2912722419 | |||
| 1298 | 2912726123 | |||
| 1299 | 2912758873 | |||
| 1300 | 2918502502 | |||
| 1301 | 2919472211 | |||
| 1302 | 2946052039 | |||
| 1303 | 2946065553 | |||
| 1304 | 2946073914 | |||
| 1305 | 2947231856 | |||
| 1306 | 2954011090 | |||
| 1307 | 2954388659 | |||
| 1308 | 2954674465 | |||
| 1309 | 2954689667 | |||
| 1310 | 2954699450 | |||
| 1311 | 2954702768 | |||
| 1312 | 2954718390 | |||
| 1313 | 2954728360 | |||
| 1314 | 2954733449 | |||
| 1315 | 2954747256 | |||
| 1316 | 2954752332 | |||
| 1317 | 2954766371 | |||
| 1318 | 2966604435 | |||
| 1319 | 2990045848 | |||
| 1320 | 2990059594 | |||
| 1321 | 2995469375 | |||
| 1322 | 2997453992 | |||
| 1323 | 2997605692 | |||
| 1324 | 3006328030 | |||
| 1325 | 3006399558 | |||
| 1326 | 3006430690 | |||
| 1327 | 3006490460 | |||
| 1328 | 3006495135 | |||
| 1329 | 8008486582 | |||
| 1330 | 8008561295 | |||
| 1331 | 8008580767 | |||
| 1332 | 8023625009 | |||
| 1333 | 8025414828 | |||
| 1334 | 8025484321 | |||
| 1335 | 8025525651 | |||
| 1336 | 8025534175 | |||
| 1337 | 8033685009 | |||
| 1338 | 8047894829 | |||
| 1339 | 8048130385 | |||
| 1340 | 8048364220 | |||
| 1341 | 8048371848 | |||
| 1342 | 8048380781 | |||
| 1343 | 8048408148 | |||
| 1344 | 8054163831 | |||
| 1345 | 8056449966 | |||
| 1346 | 8056670551 | |||
| 1347 | 8056835720 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1eyv-assembly1.cif.gz_A | the crystal structure of nusb from mycobacterium tuberculosis | 0.9269 | 4 | 132 |
| 1eyv-assembly1.cif.gz_A | the crystal structure of nusb from mycobacterium tuberculosis | 0.9069 | 4 | 132 |
| 3r2d-assembly1.cif.gz_A | crystal structure of antitermination factors nusb and nuse in complex with dsrna | 0.8729 | 1 | 134 |
| 1tzx-assembly2.cif.gz_B | t. maritima nusb, p3221 | 0.8717 | 5 | 134 |
| 5lm7-assembly2.cif.gz_D | crystal structure of the lambda n-nus factor complex | 0.8635 | 4 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WIV1_1_139_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9429 | 1 | 132 | 1.10.940.10 |
| 1eyvA00 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9269 | 4 | 132 | 1.10.940.10 |
| 1eyvA00 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9069 | 4 | 132 | 1.10.940.10 |
| af_P9WIV1_1_139_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.8911 | 1 | 132 | 1.10.940.10 |
| 1tztA00 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.883 | 4 | 134 | 1.10.940.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3QUQ0-F1-model_v4 | Transcription antitermination protein NusB (Antitermination factor NusB) | 1.002 | 1 | 141 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A3N1M5S0-F1-model_v4 | deleted | 1.002 | 1 | 144 |
|
| AF-Q9KXR0-F1-model_v4 | Transcription antitermination protein NusB (Antitermination factor NusB) | 1.002 | 1 | 141 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A0B5EYJ1-F1-model_v4 | Transcription antitermination protein NusB (Antitermination factor NusB) | 1.001 | 1 | 143 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A6I5MY64-F1-model_v4 | deleted | 1 | 1 | 141 |
|