F474385

General Info

Members Datasets Scaffolds Average Seq Length
674 368 1348 255

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0000018|Ga0495650_0000018_218774_219538
Length 248
Sequence MSDKTQRPKIILEPDQRKQLVNIQRRMLLRSGLTLGAVSMLTGCNLQDGDQVDKVLWAMSRWNDRVQSWLFSGQKLAQTYRADQITTPFRFNAYYPEYNVNYRLEVSGLVQKKAPWTLEQLQRLPQESQITRLICIEGWSAIGQWKGVPLKTFLQHVGADLTAKYVGFKCDDRYYSSIDMATALHPQTILALDFGGKPLPPDFGYPLRLRMPTKLGFKNAKHIGAIFVTNEYPGGYWEDQGYNWFSGI

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
147 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
150 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
169 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
170 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
173 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
174 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
175 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
176 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
177 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
178 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
179 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
180 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
181 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
185 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
268 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
275 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
276 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
277 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
280 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
281 2506520008 Serratia plymuthica AS12 Isolate Unclassified
282 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
283 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
284 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
285 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
286 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
287 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
288 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
289 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
290 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
291 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
292 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
293 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
294 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
295 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
296 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
297 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
298 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
299 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
300 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
301 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
302 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
303 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
304 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
305 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
306 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
307 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
308 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
309 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
310 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
311 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
312 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
313 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
314 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
315 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
316 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
317 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
318 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
319 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
320 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
321 2818991436 Collimonas arenae 515 Isolate Unclassified
322 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
323 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
324 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
325 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
326 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
327 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
328 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
329 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
330 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
331 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
332 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
333 2855730933 Achromobacter sp. HZ28 Isolate Nodule
334 2855767633 Achromobacter sp. HZ34 Isolate Nodule
335 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
336 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
337 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
338 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
339 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
340 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
341 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
342 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
343 2904504865 Serratia marcescens 1822 Isolate Unclassified
344 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
345 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
346 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
347 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
348 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
349 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
350 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
351 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
352 2919150387 Rahnella aceris 1817 Isolate Unclassified
353 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
354 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
355 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
356 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
357 2927143783 Rahnella sp. 2050 Isolate Unclassified
358 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
359 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
360 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
361 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
362 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
363 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
364 640753048 Serratia proteamaculans 568 Isolate Endosphere
365 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
366 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
367 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
368 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.65
Metatranscriptomes 0
Isolates 13.35

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 9.5
Nodule 1.63
Rhizoplane 3.12
Rhizosphere 69.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0000018 3300046471 Bacteria 538888
2 SwRhRL2b_contig_2097597 2162886007 Bacteria 1603
3 SwRhRL2b_contig_2326806 2162886007 Bacteria 4897
4 MRS1b_contig_117389 2162886011 Bacteria 898
5 JGI25155J39150_1000511 3300002704 Bacteria 9243
6 JGI25156J39149_1000320 3300002705 Bacteria 31857
7 JGI25156J39149_1009833 3300002705 Bacteria 2293
8 JGI25162J39368_1000002 3300002737 Bacteria 663004
9 JGI25162J39368_1000079 3300002737 Bacteria 115162
10 JGI25154J39366_1000264 3300002738 Bacteria 33263
11 JGI25154J39366_1000967 3300002738 Bacteria 11784
12 JGI25157J39369_1001592 3300002741 Bacteria 7972
13 JGI25163J39215_1000003 3300002771 Bacteria 149140
14 JGI25164J39214_1000041 3300002772 Bacteria 127466
15 JGI25165J46597_1000135 3300003214 Bacteria 122924
16 rootH1_10015053 3300003323 Bacteria 13144
17 Ga0055538_1000003 3300003751 Bacteria 663004
18 Ga0055538_1000055 3300003751 Bacteria 122924
19 Ga0055539_1000003 3300003752 Bacteria 663004
20 Ga0055539_1000080 3300003752 Bacteria 122924
21 Ga0055539_1000390 3300003752 Bacteria 17735
22 Ga0055533_1000005 3300003756 Bacteria 663004
23 Ga0055533_1000086 3300003756 Bacteria 122924
24 Ga0055533_1000382 3300003756 Bacteria 17735
25 Ga0055532_1000089 3300003758 Bacteria 105631
26 Ga0055525_1000005 3300003759 Bacteria 663004
27 Ga0055525_1000114 3300003759 Bacteria 122924
28 Ga0055525_1000545 3300003759 Bacteria 17735
29 Ga0055535_1013818 3300003761 Bacteria 1179
30 Ga0055536_1000072 3300003781 Bacteria 91344
31 Ga0055530_10000016 3300003791 Bacteria 146874
32 Ga0055540_1000048 3300003792 Bacteria 146874
33 Ga0055541_1000003 3300003841 Bacteria 663004
34 Ga0055541_1000057 3300003841 Bacteria 122924
35 Ga0055541_1000276 3300003841 Bacteria 17735
36 Ga0065704_10000133 3300005289 Bacteria 53116
37 Ga0065704_10070340 3300005289 Bacteria 31623
38 Ga0065712_10068515 3300005290 Bacteria 10156
39 Ga0065715_10127867 3300005293 Bacteria 2077
40 Ga0065715_10161229 3300005293 Bacteria 1627
41 Ga0070676_10070085 3300005328 Bacteria 2102
42 Ga0070690_100022014 3300005330 Bacteria 3897
43 Ga0070670_100000436 3300005331 Bacteria 34108
44 Ga0070670_100010016 3300005331 Bacteria 8092
45 Ga0070670_100131249 3300005331 Bacteria 2163
46 Ga0070677_10011729 3300005333 Bacteria 3028
47 Ga0070666_10087490 3300005335 Bacteria 2135
48 Ga0070689_100002776 3300005340 Bacteria 11491
49 Ga0070671_100044427 3300005355 Bacteria 3692
50 Ga0070688_100057321 3300005365 Bacteria 2448
51 Ga0070667_100051168 3300005367 Bacteria 3482
52 Ga0070709_10285931 3300005434 Bacteria 1200
53 Ga0070700_100040185 3300005441 Bacteria 2862
54 Ga0070662_100128236 3300005457 Bacteria 1952
55 Ga0070681_10018458 3300005458 Bacteria 6973
56 Ga0070706_100055789 3300005467 Bacteria 3647
57 Ga0070707_100187918 3300005468 Bacteria 2014
58 Ga0070699_100666240 3300005518 Bacteria 950
59 Ga0070672_100029387 3300005543 Bacteria 4121
60 Ga0070665_100166334 3300005548 Bacteria 2207
61 Ga0068855_100000037 3300005563 Bacteria 158161
62 Ga0068855_100032073 3300005563 Bacteria 6272
63 Ga0068854_100006645 3300005578 Bacteria 7368
64 Ga0068856_100027730 3300005614 Bacteria 5525
65 Ga0070702_100022041 3300005615 Bacteria 3362
66 Ga0068852_100002544 3300005616 Bacteria 12561
67 Ga0068870_10157525 3300005840 Bacteria 1343
68 Ga0068858_100054240 3300005842 Bacteria 3707
69 Ga0068860_100139725 3300005843 Bacteria 2327
70 Ga0081455_10000453 3300005937 Bacteria 53921
71 Ga0081455_10026391 3300005937 Bacteria 5343
72 Ga0070717_10060480 3300006028 Bacteria 3137
73 Ga0075434_100122072 3300006871 Bacteria 2621
74 Ga0075434_100332867 3300006871 Bacteria 1539
75 Ga0075434_100995172 3300006871 Bacteria 852
76 Ga0068865_100289272 3300006881 Bacteria 1307
77 Ga0105251_10000016 3300009011 Bacteria 146400
78 Ga0105251_10000119 3300009011 Bacteria 79040
79 Ga0105251_10003359 3300009011 Bacteria 11652
80 Ga0105251_10011487 3300009011 Bacteria 5056
81 Ga0105251_10082218 3300009011 Bacteria 1488
82 Ga0105251_10110851 3300009011 Bacteria 1250
83 Ga0105244_10000190 3300009036 Bacteria 62853
84 Ga0105244_10000216 3300009036 Bacteria 59709
85 Ga0105244_10000425 3300009036 Bacteria 39065
86 Ga0105244_10000450 3300009036 Bacteria 37505
87 Ga0105244_10077183 3300009036 Bacteria 1653
88 Ga0105250_10000003 3300009092 Bacteria 547770
89 Ga0105250_10000265 3300009092 Bacteria 42626
90 Ga0105250_10001281 3300009092 Bacteria 13801
91 Ga0105240_10001596 3300009093 Bacteria 38514
92 Ga0105240_10029133 3300009093 Bacteria 7199
93 Ga0105240_10534087 3300009093 Bacteria 1300
94 Ga0105240_11173564 3300009093 Bacteria 814
95 Ga0111539_10146112 3300009094 Bacteria 2768
96 Ga0105247_10000103 3300009101 Bacteria 90413
97 Ga0105243_10005208 3300009148 Bacteria 10173
98 Ga0105243_10152383 3300009148 Bacteria 1984
99 Ga0105241_10000004 3300009174 Bacteria 803007
100 Ga0105242_10045416 3300009176 Bacteria 3561
101 Ga0105248_10526428 3300009177 Bacteria 1333
102 Ga0105238_10001958 3300009551 Bacteria 20734
103 Ga0105238_10004012 3300009551 Bacteria 14607
104 Ga0105238_10053378 3300009551 Bacteria 4061
105 Ga0105239_10016513 3300010375 Bacteria 8165
106 Ga0105246_10037197 3300011119 Bacteria 3266
107 Ga0157373_10002585 3300013100 Bacteria 13746
108 Ga0157373_10055607 3300013100 Bacteria 2811
109 Ga0157371_10001449 3300013102 Bacteria 24611
110 Ga0157371_10003951 3300013102 Bacteria 13158
111 Ga0157370_10001398 3300013104 Bacteria 29918
112 Ga0157370_10003497 3300013104 Bacteria 18414
113 Ga0157370_10500792 3300013104 Bacteria 1115
114 Ga0157369_10045584 3300013105 Bacteria 4767
115 Ga0157378_10052710 3300013297 Bacteria 3620
116 Ga0157378_10737134 3300013297 Bacteria 1007
117 Ga0163162_10024709 3300013306 Bacteria 5934
118 Ga0157372_10894500 3300013307 Bacteria 1030
119 Ga0163163_10442330 3300014325 Bacteria 1360
120 Ga0157380_10007892 3300014326 Bacteria 7574
121 Ga0182008_10006908 3300014497 Bacteria 6304
122 Ga0182008_10007128 3300014497 Bacteria 6190
123 Ga0182008_10022934 3300014497 Bacteria 3194
124 Ga0182008_10048041 3300014497 Bacteria 2120
125 Ga0157377_10358254 3300014745 Bacteria 981
126 Ga0157379_10029779 3300014968 Bacteria 4854
127 Ga0157376_10670611 3300014969 Bacteria 1039
128 Ga0182006_1002060 3300015261 Bacteria 11273
129 Ga0182006_1021259 3300015261 Bacteria 2708
130 Ga0182006_1023940 3300015261 Bacteria 2525
131 Ga0182006_1046082 3300015261 Bacteria 1695
132 Ga0182007_10000471 3300015262 Bacteria 24311
133 Ga0182007_10003572 3300015262 Bacteria 7315
134 Ga0182007_10004652 3300015262 Bacteria 6195
135 Ga0182007_10026824 3300015262 Bacteria 1992
136 Ga0182005_1000151 3300015265 Bacteria 48745
137 Ga0182005_1000341 3300015265 Bacteria 27029
138 Ga0182005_1018141 3300015265 Bacteria 1945
139 Ga0163161_10000001 3300017792 Bacteria 2041488
140 Ga0213872_10000360 3300021361 Bacteria 38318
141 Ga0213872_10005698 3300021361 Bacteria 6343
142 Ga0213875_10014875 3300021388 Bacteria 3792
143 Ga0209435_100109 3300025206 Bacteria 32283
144 Ga0209435_100890 3300025206 Bacteria 4569
145 Ga0209760_100002 3300025207 Bacteria 274743
146 Ga0209760_101315 3300025207 Bacteria 2696
147 Ga0209784_100001 3300025224 Bacteria 3600592
148 Ga0209784_100010 3300025224 Bacteria 683664
149 Ga0209784_100018 3300025224 Bacteria 456816
150 Ga0209566_100001 3300025225 Bacteria 3600765
151 Ga0209566_100008 3300025225 Bacteria 683664
152 Ga0209566_100016 3300025225 Bacteria 456824
153 Ga0209674_100002 3300025226 Bacteria 3600592
154 Ga0209674_100019 3300025226 Bacteria 683664
155 Ga0209674_100030 3300025226 Bacteria 456824
156 Ga0209147_100060 3300025229 Bacteria 249588
157 Ga0209563_100002 3300025230 Bacteria 2045675
158 Ga0209563_100021 3300025230 Bacteria 683764
159 Ga0209563_100034 3300025230 Bacteria 456824
160 Ga0207427_100009 3300025231 Bacteria 663036
161 Ga0207427_100232 3300025231 Bacteria 46074
162 Ga0209437_100001 3300025233 Bacteria 2045675
163 Ga0209437_100019 3300025233 Bacteria 683764
164 Ga0209437_100081 3300025233 Bacteria 271072
165 Ga0209258_100141 3300025242 Bacteria 166385
166 Ga0209646_1000101 3300025246 Bacteria 164503
167 Ga0209646_1000176 3300025246 Bacteria 81901
168 Ga0209026_1000264 3300025250 Bacteria 64186
169 Ga0209026_1008395 3300025250 Bacteria 2162
170 Ga0209677_100002 3300025253 Bacteria 2045675
171 Ga0209677_100011 3300025253 Bacteria 683664
172 Ga0209677_100019 3300025253 Bacteria 456824
173 Ga0209759_1000264 3300025256 Bacteria 75893
174 Ga0209759_1000296 3300025256 Bacteria 68965
175 Ga0209233_1000025 3300025261 Bacteria 683764
176 Ga0209233_1002373 3300025261 Bacteria 6983
177 Ga0209455_1007786 3300025272 Bacteria 2984
178 Ga0209676_1000020 3300025292 Bacteria 617256
179 Ga0209676_1002238 3300025292 Bacteria 14283
180 Ga0209050_1000013 3300025298 Bacteria 811408
181 Ga0209051_1000007 3300025303 Bacteria 811408
182 Ga0209257_1002079 3300025304 Bacteria 21094
183 Ga0207697_10009917 3300025315 Bacteria 4092
184 Ga0207656_10092937 3300025321 Bacteria 1372
185 Ga0207696_1000001 3300025711 Bacteria 2579611
186 Ga0207696_1000004 3300025711 Bacteria 671626
187 Ga0207696_1000169 3300025711 Bacteria 103182
188 Ga0207655_1000011 3300025728 Bacteria 643321
189 Ga0207655_1000149 3300025728 Bacteria 129937
190 Ga0207655_1001337 3300025728 Bacteria 23216
191 Ga0207655_1002650 3300025728 Bacteria 14127
192 Ga0207655_1037529 3300025728 Bacteria 2133
193 Ga0207713_1000024 3300025735 Bacteria 339156
194 Ga0207713_1000026 3300025735 Bacteria 319032
195 Ga0207713_1000027 3300025735 Bacteria 312621
196 Ga0207713_1000060 3300025735 Bacteria 213145
197 Ga0207713_1002927 3300025735 Bacteria 11951
198 Ga0207713_1034337 3300025735 Bacteria 2204
199 Ga0207713_1075990 3300025735 Bacteria 1223
200 Ga0207642_10002399 3300025899 Bacteria 5833
201 Ga0207710_10000140 3300025900 Bacteria 83223
202 Ga0207688_10047958 3300025901 Bacteria 2386
203 Ga0207645_10005429 3300025907 Bacteria 9243
204 Ga0207643_10054002 3300025908 Bacteria 2283
205 Ga0207684_10134450 3300025910 Bacteria 2123
206 Ga0207654_10000006 3300025911 Bacteria 815027
207 Ga0207695_10000719 3300025913 Bacteria 64361
208 Ga0207695_10003386 3300025913 Bacteria 22534
209 Ga0207695_10038779 3300025913 Bacteria 5124
210 Ga0207695_10814049 3300025913 Bacteria 814
211 Ga0207695_10827877 3300025913 Bacteria 806
212 Ga0207671_10014094 3300025914 Bacteria 6336
213 Ga0207660_10184503 3300025917 Bacteria 1622
214 Ga0207662_10012698 3300025918 Bacteria 4694
215 Ga0207694_10000147 3300025924 Bacteria 72638
216 Ga0207694_10003504 3300025924 Bacteria 12469
217 Ga0207650_10000426 3300025925 Bacteria 37126
218 Ga0207650_10008535 3300025925 Bacteria 6995
219 Ga0207659_10098983 3300025926 Bacteria 2194
220 Ga0207644_10104930 3300025931 Bacteria 2128
221 Ga0207706_10143923 3300025933 Bacteria 2097
222 Ga0207686_10292086 3300025934 Bacteria 1207
223 Ga0207709_10022089 3300025935 Bacteria 3607
224 Ga0207709_10102116 3300025935 Bacteria 1898
225 Ga0207669_10026605 3300025937 Bacteria 3150
226 Ga0207704_10133532 3300025938 Bacteria 1723
227 Ga0207711_10283285 3300025941 Bacteria 1526
228 Ga0207689_10091514 3300025942 Bacteria 2499
229 Ga0207679_10329748 3300025945 Bacteria 1324
230 Ga0207667_10000053 3300025949 Bacteria 226712
231 Ga0207667_10014432 3300025949 Bacteria 9007
232 Ga0207668_10088515 3300025972 Bacteria 2268
233 Ga0207708_10007364 3300026075 Bacteria 8133
234 Ga0207702_10012304 3300026078 Bacteria 7123
235 Ga0207641_10014333 3300026088 Bacteria 6496
236 Ga0207648_10006414 3300026089 Bacteria 11693
237 Ga0207676_10106490 3300026095 Bacteria 2336
238 Ga0207675_100048538 3300026118 Bacteria 3962
239 Ga0207683_10132331 3300026121 Bacteria 2244
240 Ga0207698_10003252 3300026142 Bacteria 9762
241 Ga0207698_10503972 3300026142 Bacteria 1178
242 Ga0209281_1000008 3300027111 Bacteria 867470
243 Ga0209281_1001466 3300027111 Bacteria 13754
244 Ga0209371_1000348 3300027312 Bacteria 50540
245 Ga0307515_10000040 3300028794 Bacteria 322704
246 Ga0307515_10031174 3300028794 Bacteria 8901
247 Ga0268256_1000134 3300030500 Bacteria 102725
248 Ga0265328_10000378 3300031239 Bacteria 20768
249 Ga0265328_10006693 3300031239 Bacteria 4854
250 Ga0265320_10060938 3300031240 Bacteria 1800
251 Ga0265329_10005220 3300031242 Bacteria 5280
252 Ga0265331_10008145 3300031250 Bacteria 5983
253 Ga0265316_10044913 3300031344 Bacteria 3511
254 Ga0265314_10004765 3300031711 Bacteria 12429
255 Ga0307405_10140607 3300031731 Bacteria 1682
256 Ga0307405_10257292 3300031731 Bacteria 1302
257 Ga0307413_10071959 3300031824 Bacteria 2181
258 Ga0307406_10067539 3300031901 Bacteria 2331
259 Ga0307407_10060650 3300031903 Bacteria 2208
260 Ga0307412_10005141 3300031911 Bacteria 7326
261 Ga0307412_10140940 3300031911 Bacteria 1765
262 Ga0307409_100538079 3300031995 Bacteria 1144
263 Ga0307416_100063453 3300032002 Bacteria 3025
264 Ga0307416_100629067 3300032002 Bacteria 1156
265 Ga0307411_10007450 3300032005 Bacteria 5576
266 Ga0307411_10109452 3300032005 Bacteria 1973
267 Ga0436364_0266477 3300037853 Bacteria 1087
268 Ga0436364_0714820 3300037853 Bacteria 4974
269 Ga0436364_1535370 3300037853 Bacteria 953
270 Ga0436365_0916090 3300039437 Bacteria 1114
271 Ga0436361_0376772 3300039447 Bacteria 8066
272 Ga0436361_0409139 3300039447 Bacteria 31464
273 Ga0436361_0659952 3300039447 Bacteria 1671
274 Ga0436363_0254040 3300039450 Bacteria 1198
275 Ga0439438_001380 3300041405 Bacteria 10711
276 Ga0439447_006742 3300041407 Bacteria 3694
277 Ga0439466_0000495 3300041411 Bacteria 14922
278 Ga0439466_0028715 3300041411 Bacteria 1918
279 Ga0439466_0051780 3300041411 Bacteria 1343
280 Ga0439432_014263 3300042006 Bacteria 2691
281 Ga0439451_000047 3300042009 Bacteria 24088
282 Ga0439451_000377 3300042009 Bacteria 8626
283 Ga0439451_002515 3300042009 Bacteria 3725
284 Ga0439452_000043 3300042010 Bacteria 132609
285 Ga0439452_000605 3300042010 Bacteria 18365
286 Ga0439452_001052 3300042010 Bacteria 12186
287 Ga0439456_000335 3300042013 Bacteria 10659
288 Ga0439456_001538 3300042013 Bacteria 4649
289 Ga0439463_000294 3300042016 Bacteria 13843
290 Ga0439463_007569 3300042016 Bacteria 2678
291 Ga0450911_006623 3300042115 Bacteria 1716
292 Ga0450900_000128 3300042136 Bacteria 4434
293 Ga0450902_004091 3300042137 Bacteria 2162
294 Ga0450904_000487 3300042139 Bacteria 7796
295 Ga0450906_000010 3300042145 Bacteria 39195
296 Ga0450907_005684 3300042146 Bacteria 2099
297 Ga0439460_0000060 3300042461 Bacteria 16086
298 Ga0451576_0133593 3300045051 Bacteria 2587
299 Ga0495617_000642 3300046452 Bacteria 17510
300 Ga0495617_041529 3300046452 Bacteria 1537
301 Ga0495627_000018 3300046453 Bacteria 315125
302 Ga0495627_000380 3300046453 Bacteria 40821
303 Ga0495627_005333 3300046453 Bacteria 5204
304 Ga0495627_037220 3300046453 Bacteria 1509
305 Ga0495592_0001072 3300046454 Bacteria 18925
306 Ga0495603_0002989 3300046455 Bacteria 10004
307 Ga0495591_000041 3300046458 Bacteria 155639
308 Ga0495591_000189 3300046458 Bacteria 63919
309 Ga0495591_000234 3300046458 Bacteria 54016
310 Ga0495591_005709 3300046458 Bacteria 5680
311 Ga0495591_016739 3300046458 Bacteria 2539
312 Ga0495591_024088 3300046458 Bacteria 1935
313 Ga0495638_0030846 3300046460 Bacteria 3447
314 Ga0495651_0013562 3300046462 Bacteria 6301
315 Ga0495653_0001089 3300046463 Bacteria 20969
316 Ga0495653_0008898 3300046463 Bacteria 8210
317 Ga0495650_0000034 3300046471 Bacteria 410132
318 Ga0495650_0000309 3300046471 Bacteria 88068
319 Ga0495650_0000780 3300046471 Bacteria 39115
320 Ga0495650_0003367 3300046471 Bacteria 11722
321 Ga0495650_0024507 3300046471 Bacteria 2847
322 Ga0495580_0044817 3300046472 Bacteria 3144
323 Ga0495580_0570184 3300046472 Bacteria 750
324 Ga0495605_0000045 3300046474 Bacteria 176155
325 Ga0495605_0000090 3300046474 Bacteria 116120
326 Ga0495605_0000124 3300046474 Bacteria 101623
327 Ga0495605_0000589 3300046474 Bacteria 29051
328 Ga0495605_0000705 3300046474 Bacteria 24816
329 Ga0495605_0000722 3300046474 Bacteria 24319
330 Ga0495605_0023604 3300046474 Bacteria 3230
331 Ga0495605_0034801 3300046474 Bacteria 2549
332 Ga0495605_0100361 3300046474 Bacteria 1331
333 Ga0495605_0218911 3300046474 Bacteria 823
334 Ga0495584_0002628 3300046491 Bacteria 10131
335 Ga0495584_0008800 3300046491 Bacteria 5220
336 Ga0495584_0009488 3300046491 Bacteria 5010
337 Ga0495585_0001433 3300046492 Bacteria 18714
338 Ga0495585_0002260 3300046492 Bacteria 13931
339 Ga0495594_0000711 3300046499 Bacteria 17137
340 Ga0495596_0013213 3300046500 Bacteria 3509
341 Ga0495596_0068391 3300046500 Bacteria 1380
342 Ga0495607_0000070 3300046501 Bacteria 100876
343 Ga0495607_0000106 3300046501 Bacteria 88081
344 Ga0495607_0000284 3300046501 Bacteria 54384
345 Ga0495607_0000369 3300046501 Bacteria 46319
346 Ga0495607_0005884 3300046501 Bacteria 8710
347 Ga0495607_0006909 3300046501 Bacteria 7912
348 Ga0495607_0012639 3300046501 Bacteria 5563
349 Ga0495607_0021888 3300046501 Bacteria 4020
350 Ga0495607_0081953 3300046501 Bacteria 1771
351 Ga0495607_0083646 3300046501 Bacteria 1747
352 Ga0495583_0000101 3300046506 Bacteria 144916
353 Ga0495583_0000765 3300046506 Bacteria 40365
354 Ga0495583_0001353 3300046506 Bacteria 25396
355 Ga0495583_0002114 3300046506 Bacteria 17839
356 Ga0495583_0002459 3300046506 Bacteria 15815
357 Ga0495583_0056234 3300046506 Bacteria 1775
358 Ga0495606_0000042 3300046507 Bacteria 215099
359 Ga0495606_0000081 3300046507 Bacteria 160491
360 Ga0495606_0000098 3300046507 Bacteria 151131
361 Ga0495606_0000410 3300046507 Bacteria 72184
362 Ga0495606_0000529 3300046507 Bacteria 61769
363 Ga0495606_0001296 3300046507 Bacteria 34490
364 Ga0495606_0003477 3300046507 Bacteria 16691
365 Ga0495606_0063602 3300046507 Bacteria 2352
366 Ga0495606_0097138 3300046507 Bacteria 1801
367 Ga0495608_0001962 3300046511 Bacteria 14737
368 Ga0495610_0012980 3300046512 Bacteria 4977
369 Ga0495616_0046339 3300046513 Bacteria 2195
370 Ga0495618_0003306 3300046514 Bacteria 10083
371 Ga0495620_0000001 3300046515 Bacteria 386508
372 Ga0495620_0001049 3300046515 Bacteria 16939
373 Ga0495620_0001966 3300046515 Bacteria 12033
374 Ga0495620_0049954 3300046515 Bacteria 1786
375 Ga0495628_0001529 3300046516 Bacteria 21206
376 Ga0495631_0001230 3300046518 Bacteria 15793
377 Ga0495631_0001306 3300046518 Bacteria 15273
378 Ga0495631_0005658 3300046518 Bacteria 6519
379 Ga0495631_0009509 3300046518 Bacteria 4854
380 Ga0495631_0032501 3300046518 Bacteria 2352
381 Ga0495631_0094113 3300046518 Bacteria 1290
382 Ga0495632_0002280 3300046519 Bacteria 14783
383 Ga0495632_0016439 3300046519 Bacteria 4116
384 Ga0495632_0041865 3300046519 Bacteria 2299
385 Ga0495632_0055118 3300046519 Bacteria 1946
386 Ga0495637_0000023 3300046520 Bacteria 172407
387 Ga0495637_0000486 3300046520 Bacteria 28876
388 Ga0495637_0001685 3300046520 Bacteria 12767
389 Ga0495637_0005119 3300046520 Bacteria 6725
390 Ga0495637_0014831 3300046520 Bacteria 3671
391 Ga0495637_0055348 3300046520 Bacteria 1645
392 Ga0495637_0067755 3300046520 Bacteria 1448
393 Ga0495643_0000721 3300046522 Bacteria 37800
394 Ga0495643_0019767 3300046522 Bacteria 3894
395 Ga0495643_0058000 3300046522 Bacteria 2061
396 Ga0495643_0092214 3300046522 Bacteria 1561
397 Ga0495644_0000910 3300046523 Bacteria 12254
398 Ga0495644_0002392 3300046523 Bacteria 7489
399 Ga0495648_0003650 3300046524 Bacteria 13464
400 Ga0495648_0004913 3300046524 Bacteria 11245
401 Ga0495648_0010650 3300046524 Bacteria 6987
402 Ga0495666_0035332 3300046526 Bacteria 2437
403 Ga0495652_0007377 3300046529 Bacteria 10136
404 Ga0495654_0000179 3300046530 Bacteria 62287
405 Ga0495654_0002585 3300046530 Bacteria 11561
406 Ga0495654_0004579 3300046530 Bacteria 8167
407 Ga0495654_0007597 3300046530 Bacteria 6041
408 Ga0495654_0010116 3300046530 Bacteria 5145
409 Ga0495654_0049717 3300046530 Bacteria 2052
410 Ga0495654_0059994 3300046530 Bacteria 1829
411 Ga0495609_0000011 3300046538 Bacteria 334377
412 Ga0495609_0000012 3300046538 Bacteria 333994
413 Ga0495609_0000145 3300046538 Bacteria 73765
414 Ga0495609_0004096 3300046538 Bacteria 8110
415 Ga0495609_0006406 3300046538 Bacteria 6009
416 Ga0495597_0000004 3300046542 Bacteria 307496
417 Ga0495597_0003740 3300046542 Bacteria 8677
418 Ga0495645_0108653 3300046543 Bacteria 1964
419 Ga0495645_0130468 3300046543 Bacteria 1762
420 Ga0495622_0004276 3300046557 Bacteria 6646
421 Ga0495622_0072380 3300046557 Bacteria 1590
422 Ga0495622_0114117 3300046557 Bacteria 1236
423 Ga0495633_0000016 3300046558 Bacteria 250457
424 Ga0495633_0000367 3300046558 Bacteria 48597
425 Ga0495633_0009020 3300046558 Bacteria 5548
426 Ga0495667_0379601 3300046559 Bacteria 891
427 Ga0495668_0050878 3300046616 Bacteria 2295
428 Ga0495668_0082153 3300046616 Bacteria 1767
429 Ga0495634_0077027 3300046642 Bacteria 2188
430 Ga0495611_0001082 3300046648 Bacteria 14368
431 Ga0495611_0001380 3300046648 Bacteria 12184
432 Ga0495611_0055885 3300046648 Bacteria 1786
433 Ga0495625_0000010 3300046660 Bacteria 381775
434 Ga0495625_0000108 3300046660 Bacteria 125604
435 Ga0495635_0032032 3300046663 Bacteria 3649
436 Ga0495661_0000004 3300046665 Bacteria 555340
437 Ga0495661_0000010 3300046665 Bacteria 284261
438 Ga0495661_0000018 3300046665 Bacteria 200787
439 Ga0495661_0000020 3300046665 Bacteria 196901
440 Ga0495661_0088125 3300046665 Bacteria 1772
441 Ga0495661_0126149 3300046665 Bacteria 1408
442 Ga0495661_0195530 3300046665 Bacteria 1062
443 Ga0495661_0197514 3300046665 Bacteria 1055
444 Ga0495657_0025488 3300046675 Bacteria 4198
445 Ga0495599_0012638 3300046678 Bacteria 5206
446 Ga0495623_0006756 3300046679 Bacteria 7466
447 Ga0495646_0001802 3300046680 Bacteria 12853
448 Ga0495658_0014570 3300046683 Bacteria 4021
449 Ga0495624_0010937 3300046690 Bacteria 6254
450 Ga0495670_0012175 3300046691 Bacteria 4230
451 Ga0495671_0001070 3300046692 Bacteria 18925
452 Ga0495671_0001369 3300046692 Bacteria 16544
453 Ga0495671_0007179 3300046692 Bacteria 6374
454 Ga0495671_0044115 3300046692 Bacteria 2236
455 Ga0495649_0000027 3300046694 Bacteria 164157
456 Ga0495649_0000083 3300046694 Bacteria 81883
457 Ga0495649_0019663 3300046694 Bacteria 3793
458 Ga0495649_0040948 3300046694 Bacteria 2534
459 Ga0495589_0000002 3300046794 Bacteria 758846
460 Ga0495589_0001428 3300046794 Bacteria 13797
461 Ga0495600_0005526 3300046809 Bacteria 7626
462 Ga0495660_0000004 3300046810 Bacteria 1003183
463 Ga0495660_0000020 3300046810 Bacteria 304768
464 Ga0495660_0000454 3300046810 Bacteria 34113
465 Ga0495660_0000637 3300046810 Bacteria 27250
466 Ga0495660_0007375 3300046810 Bacteria 6458
467 Ga0495660_0031802 3300046810 Bacteria 2965
468 Ga0495660_0087172 3300046810 Bacteria 1628
469 Ga0495604_0013783 3300047317 Bacteria 6445
470 Ga0495604_0034528 3300047317 Bacteria 4000
471 Ga0495672_0000011 3300047320 Bacteria 535362
472 Ga0495672_0003150 3300047320 Bacteria 14359
473 Ga0495672_0007746 3300047320 Bacteria 8038
474 Ga0495672_0016420 3300047320 Bacteria 4989
475 Ga0495672_0036521 3300047320 Bacteria 3016
476 Ga0495672_0061562 3300047320 Bacteria 2163
477 Ga0495672_0069236 3300047320 Bacteria 2004
478 Ga0495672_0111424 3300047320 Bacteria 1468
479 Ga0495676_0000002 3300047321 Bacteria 373918
480 Ga0495683_0000019 3300047323 Bacteria 183206
481 Ga0495683_0000063 3300047323 Bacteria 113542
482 Ga0495683_0000416 3300047323 Bacteria 34093
483 Ga0495683_0042954 3300047323 Bacteria 2277
484 Ga0495683_0092068 3300047323 Bacteria 1467
485 Ga0495687_000579 3300047443 Bacteria 42952
486 Ga0495679_000165 3300047446 Bacteria 59805
487 Ga0495679_000322 3300047446 Bacteria 38037
488 Ga0495673_0000020 3300047469 Bacteria 548327
489 Ga0495673_0000183 3300047469 Bacteria 101083
490 Ga0495673_0000758 3300047469 Bacteria 30622
491 Ga0495673_0001862 3300047469 Bacteria 15831
492 Ga0495673_0004738 3300047469 Bacteria 8437
493 Ga0495673_0010447 3300047469 Bacteria 5047
494 Ga0495673_0014825 3300047469 Bacteria 4039
495 Ga0495673_0019900 3300047469 Bacteria 3353
496 Ga0495673_0022461 3300047469 Bacteria 3091
497 Ga0495673_0055276 3300047469 Bacteria 1722
498 Ga0495673_0062263 3300047469 Bacteria 1594
499 Ga0495673_0089134 3300047469 Bacteria 1263
500 Ga0495681_0000538 3300047470 Bacteria 29051
501 Ga0495681_0001151 3300047470 Bacteria 20032
502 Ga0495681_0050837 3300047470 Bacteria 1951
503 Ga0495686_0055630 3300047472 Bacteria 2473
504 Ga0495686_0142909 3300047472 Bacteria 1411
505 Ga0495602_0025284 3300048088 Bacteria 5747
506 Ga0495626_0000007 3300048091 Bacteria 276374
507 Ga0495626_0000897 3300048091 Bacteria 26379
508 Ga0495626_0039485 3300048091 Bacteria 2234
509 Ga0496102_0782102 3300048905 Bacteria 877
510 Ga0496104_0001712 3300048907 Bacteria 18944
511 Ga0496110_0052219 3300048913 Bacteria 3593
512 Ga0496111_0388315 3300048914 Bacteria 1032
513 Ga0496113_0333225 3300048916 Bacteria 1217
514 Ga0496116_0000023 3300048919 Bacteria 475792
515 Ga0496116_0000083 3300048919 Bacteria 220955
516 Ga0496116_0026142 3300048919 Bacteria 4275
517 Ga0496117_0000463 3300048920 Bacteria 67832
518 Ga0496117_0003404 3300048920 Bacteria 18517
519 Ga0496117_0010690 3300048920 Bacteria 8307
520 Ga0496117_0061188 3300048920 Bacteria 2590
521 Ga0496117_0068768 3300048920 Bacteria 2389
522 Ga0496117_0165761 3300048920 Bacteria 1289
523 Ga0496118_0001450 3300048921 Bacteria 35711
524 Ga0496118_0008485 3300048921 Bacteria 10608
525 Ga0496118_0065412 3300048921 Bacteria 2661
526 Ga0496118_0129287 3300048921 Bacteria 1626
527 Ga0496119_0006664 3300048922 Bacteria 10622
528 Ga0496119_0007198 3300048922 Bacteria 10077
529 Ga0496119_0010183 3300048922 Bacteria 7938
530 Ga0496119_0108605 3300048922 Bacteria 1544
531 Ga0496120_0000052 3300048923 Bacteria 186071
532 Ga0496120_0001403 3300048923 Bacteria 29166
533 Ga0496120_0006927 3300048923 Bacteria 8551
534 Ga0496120_0063720 3300048923 Bacteria 2050
535 Ga0496121_0000824 3300048924 Bacteria 56559
536 Ga0496121_0003602 3300048924 Bacteria 21867
537 Ga0496121_0116803 3300048924 Bacteria 2023
538 Ga0496122_0000135 3300048925 Bacteria 170955
539 Ga0496122_0000146 3300048925 Bacteria 165614
540 Ga0496122_0000167 3300048925 Bacteria 157130
541 Ga0496122_0004158 3300048925 Bacteria 18262
542 Ga0496122_0107291 3300048925 Bacteria 1846
543 Ga0496123_0000004 3300048926 Bacteria 777230
544 Ga0496123_0000127 3300048926 Bacteria 154927
545 Ga0496123_0000475 3300048926 Bacteria 69749
546 Ga0496123_0003312 3300048926 Bacteria 18247
547 Ga0496123_0055389 3300048926 Bacteria 2602
548 Ga0496124_0000017 3300048927 Bacteria 444389
549 Ga0496124_0000140 3300048927 Bacteria 149743
550 Ga0496124_0000292 3300048927 Bacteria 94018
551 Ga0496124_0001314 3300048927 Bacteria 37530
552 Ga0496124_0010375 3300048927 Bacteria 9441
553 Ga0496124_0012407 3300048927 Bacteria 8414
554 Ga0496124_0163452 3300048927 Bacteria 1733
555 Ga0496125_0000131 3300048928 Bacteria 162607
556 Ga0496125_0000195 3300048928 Bacteria 129495
557 Ga0496125_0000896 3300048928 Bacteria 47203
558 Ga0496125_0021687 3300048928 Bacteria 5980
559 Ga0496125_0099143 3300048928 Bacteria 2153
560 Ga0496126_0000300 3300048929 Bacteria 105128
561 Ga0496126_0001270 3300048929 Bacteria 40566
562 Ga0495678_000036 3300049459 Bacteria 198018
563 Ga0495678_000120 3300049459 Bacteria 91473
564 Ga0495678_001857 3300049459 Bacteria 15449
565 Ga0495678_002399 3300049459 Bacteria 12794
566 Ga0495678_005571 3300049459 Bacteria 6899
567 Ga0495678_044875 3300049459 Bacteria 1746
568 Ga0495678_061852 3300049459 Bacteria 1403
569 Ga0495682_0000005 3300049460 Bacteria 360387
570 Ga0495682_0000241 3300049460 Bacteria 43383
571 Ga0495682_0001417 3300049460 Bacteria 13008
572 Ga0495682_0003494 3300049460 Bacteria 6983
573 Ga0501039_0500586 3300049575 Bacteria 954
574 Ga0501035_0604652 3300049822 Bacteria 893
575 nmdc:mga00v17_83208_c1 3300050491 Bacteria 2001
576 nmdc:mga0n895_311442_c1 3300050512 Bacteria 1595
577 nmdc:mga0n895_878473_c1 3300050512 Bacteria 883
578 Ga0495601_0009822 3300053077 Bacteria 5662
579 Ga0500555_003816 3300053103 Bacteria 4290
580 Ga0500618_001248 3300053125 Bacteria 11889
581 Ga0500621_000017 3300053126 Bacteria 87111
582 Ga0500574_003638 3300053141 Bacteria 2760
583 Ga0500616_0074678 3300053153 Bacteria 1718
584 Ga0500636_0008414 3300053177 Bacteria 5983
585 2506577533 2506520007 Bacteria 5442880
586 2506582671 2506520008 Bacteria 5443009
587 2510136388 2510065019 Bacteria 6903379
588 2511252247 2511231003 Bacteria 5606035
589 2513568682 2513237084 Bacteria 7231967
590 2513574457 2513237085 Bacteria 7695351
591 2553005414 2551306416 Bacteria 6152985
592 2555261202 2554235234 Bacteria 5762085
593 2585829745 2585427591 Bacteria 5482980
594 2585835247 2585427592 Bacteria 5370892
595 2599330506 2599185155 Bacteria 5827168
596 2599612201 2599185212 Bacteria 6765997
597 2599932389 2599185300 Bacteria 6062622
598 2599970765 2599185307 Bacteria 6194719
599 2599993103 2599185311 Bacteria 6354990
600 2600022891 2599185316 Bacteria 6320029
601 2600028968 2599185317 Bacteria 6435722
602 2600036724 2599185318 Bacteria 6961590
603 2600043033 2599185319 Bacteria 6637840
604 2600057989 2599185322 Bacteria 6763055
605 2600066319 2599185323 Bacteria 6688755
606 2600076259 2599185325 Bacteria 6324919
607 2600358135 2600254930 Bacteria 6431253
608 2601625072 2600255283 Bacteria 6061572
609 2656277421 2654587920 Bacteria 5475511
610 2656279128 2654587920 Bacteria 5475511
611 2671106985 2667528173 Bacteria 5375747
612 2671130254 2667528176 Bacteria 6724917
613 2689444012 2687453601 Bacteria 5546041
614 2715751410 2713897148 Bacteria 5883533
615 2738688658 2738541271 Bacteria 5657310
616 2738744476 2738541281 Bacteria 5112672
617 2739261439 2738543015 Bacteria 6750701
618 2739265030 2738543016 Bacteria 5657564
619 2739353706 2738543032 Bacteria 5115625
620 2765568344 2765235838 Bacteria 5445269
621 2774131990 2773857672 Bacteria 4993178
622 2806061259 2802429635 Bacteria 7650140
623 2806065677 2802429636 Bacteria 7597525
624 2807179568 2806310673 Bacteria 4801221
625 2808979829 2808606385 Bacteria 6711065
626 2808995549 2808606388 Bacteria 6706662
627 2819541971 2818991436 Bacteria 5376622
628 2819594450 2818991445 Bacteria 4955017
629 2819617780 2818991449 Bacteria 5518009
630 2826585216 2826581358 Bacteria 5963467
631 2839094766 2839094727 Bacteria 5534556
632 2842700068 2842698319 Bacteria 5190321
633 2842818824 2842815866 Bacteria 5947510
634 2842834971 2842832357 Bacteria 5959113
635 2842853582 2842849001 Bacteria 5924277
636 2842858544 2842854478 Bacteria 6143501
637 2852614606 2852612431 Bacteria 6885235
638 2852667656 2852667396 Bacteria 6885555
639 2855736457 2855730933 Bacteria 7047938
640 2855773394 2855767633 Bacteria 7049357
641 2869553387 2869551831 Bacteria 5474685
642 2884814170 2884811622 Bacteria 5552861
643 2884840874 2884836552 Bacteria 5219991
644 2884857530 2884852848 Bacteria 5221161
645 2888368061 2888366609 Bacteria 5155009
646 2896158470 2896154374 Bacteria 5221518
647 2904440039 2904439833 Bacteria 5931679
648 2904475910 2904474040 Bacteria 5504324
649 2904505349 2904504865 Bacteria 5152820
650 2904531010 2904530477 Bacteria 5876334
651 2904587344 2904584206 Bacteria 6028872
652 2904592621 2904589729 Bacteria 6113573
653 2904604597 2904601388 Bacteria 5884906
654 2919047263 2919046199 Bacteria 5567169
655 2919082418 2919079590 Bacteria 5946433
656 2919111346 2919108558 Bacteria 5897419
657 2919128711 2919125081 Bacteria 5385106
658 2919152079 2919150387 Bacteria 5500879
659 2919482282 2919481497 Bacteria 6907839
660 2919489222 2919487758 Bacteria 5929766
661 2923515894 2923510766 Bacteria 5926163
662 2923588491 2923586266 Bacteria 6565975
663 2927144748 2927143783 Bacteria 5504251
664 2928133341 2928130867 Bacteria 5467269
665 2931375443 2931369376 Bacteria 6847892
666 2969307727 2969304461 Bacteria 6601805
667 2971822809 2971820967 Bacteria 5823634
668 2974291065 2974289157 Bacteria 6080362
669 2984503523 2984499530 Bacteria 5020881
670 640937027 640753048 Bacteria 5495657
671 8002060801 8002060224 Bacteria 4026565
672 8015394875 8015394850 Bacteria 5064660
673 8018154112 8018150411 Bacteria 5549903
674 8056168518 8056166840 Bacteria 5820959
675 Ga0495650_0000018
676 SwRhRL2b_contig_2097597
677 SwRhRL2b_contig_2326806
678 MRS1b_contig_117389
679 JGI25155J39150_1000511
680 JGI25156J39149_1000320
681 JGI25156J39149_1009833
682 JGI25162J39368_1000002
683 JGI25162J39368_1000079
684 JGI25154J39366_1000264
685 JGI25154J39366_1000967
686 JGI25157J39369_1001592
687 JGI25163J39215_1000003
688 JGI25164J39214_1000041
689 JGI25165J46597_1000135
690 rootH1_10015053
691 Ga0055538_1000003
692 Ga0055538_1000055
693 Ga0055539_1000003
694 Ga0055539_1000080
695 Ga0055539_1000390
696 Ga0055533_1000005
697 Ga0055533_1000086
698 Ga0055533_1000382
699 Ga0055532_1000089
700 Ga0055525_1000005
701 Ga0055525_1000114
702 Ga0055525_1000545
703 Ga0055535_1013818
704 Ga0055536_1000072
705 Ga0055530_10000016
706 Ga0055540_1000048
707 Ga0055541_1000003
708 Ga0055541_1000057
709 Ga0055541_1000276
710 Ga0065704_10000133
711 Ga0065704_10070340
712 Ga0065712_10068515
713 Ga0065715_10127867
714 Ga0065715_10161229
715 Ga0070676_10070085
716 Ga0070690_100022014
717 Ga0070670_100000436
718 Ga0070670_100010016
719 Ga0070670_100131249
720 Ga0070677_10011729
721 Ga0070666_10087490
722 Ga0070689_100002776
723 Ga0070671_100044427
724 Ga0070688_100057321
725 Ga0070667_100051168
726 Ga0070709_10285931
727 Ga0070700_100040185
728 Ga0070662_100128236
729 Ga0070681_10018458
730 Ga0070706_100055789
731 Ga0070707_100187918
732 Ga0070699_100666240
733 Ga0070672_100029387
734 Ga0070665_100166334
735 Ga0068855_100000037
736 Ga0068855_100032073
737 Ga0068854_100006645
738 Ga0068856_100027730
739 Ga0070702_100022041
740 Ga0068852_100002544
741 Ga0068870_10157525
742 Ga0068858_100054240
743 Ga0068860_100139725
744 Ga0081455_10000453
745 Ga0081455_10026391
746 Ga0070717_10060480
747 Ga0075434_100122072
748 Ga0075434_100332867
749 Ga0075434_100995172
750 Ga0068865_100289272
751 Ga0105251_10000016
752 Ga0105251_10000119
753 Ga0105251_10003359
754 Ga0105251_10011487
755 Ga0105251_10082218
756 Ga0105251_10110851
757 Ga0105244_10000190
758 Ga0105244_10000216
759 Ga0105244_10000425
760 Ga0105244_10000450
761 Ga0105244_10077183
762 Ga0105250_10000003
763 Ga0105250_10000265
764 Ga0105250_10001281
765 Ga0105240_10001596
766 Ga0105240_10029133
767 Ga0105240_10534087
768 Ga0105240_11173564
769 Ga0111539_10146112
770 Ga0105247_10000103
771 Ga0105243_10005208
772 Ga0105243_10152383
773 Ga0105241_10000004
774 Ga0105242_10045416
775 Ga0105248_10526428
776 Ga0105238_10001958
777 Ga0105238_10004012
778 Ga0105238_10053378
779 Ga0105239_10016513
780 Ga0105246_10037197
781 Ga0157373_10002585
782 Ga0157373_10055607
783 Ga0157371_10001449
784 Ga0157371_10003951
785 Ga0157370_10001398
786 Ga0157370_10003497
787 Ga0157370_10500792
788 Ga0157369_10045584
789 Ga0157378_10052710
790 Ga0157378_10737134
791 Ga0163162_10024709
792 Ga0157372_10894500
793 Ga0163163_10442330
794 Ga0157380_10007892
795 Ga0182008_10006908
796 Ga0182008_10007128
797 Ga0182008_10022934
798 Ga0182008_10048041
799 Ga0157377_10358254
800 Ga0157379_10029779
801 Ga0157376_10670611
802 Ga0182006_1002060
803 Ga0182006_1021259
804 Ga0182006_1023940
805 Ga0182006_1046082
806 Ga0182007_10000471
807 Ga0182007_10003572
808 Ga0182007_10004652
809 Ga0182007_10026824
810 Ga0182005_1000151
811 Ga0182005_1000341
812 Ga0182005_1018141
813 Ga0163161_10000001
814 Ga0213872_10000360
815 Ga0213872_10005698
816 Ga0213875_10014875
817 Ga0209435_100109
818 Ga0209435_100890
819 Ga0209760_100002
820 Ga0209760_101315
821 Ga0209784_100001
822 Ga0209784_100010
823 Ga0209784_100018
824 Ga0209566_100001
825 Ga0209566_100008
826 Ga0209566_100016
827 Ga0209674_100002
828 Ga0209674_100019
829 Ga0209674_100030
830 Ga0209147_100060
831 Ga0209563_100002
832 Ga0209563_100021
833 Ga0209563_100034
834 Ga0207427_100009
835 Ga0207427_100232
836 Ga0209437_100001
837 Ga0209437_100019
838 Ga0209437_100081
839 Ga0209258_100141
840 Ga0209646_1000101
841 Ga0209646_1000176
842 Ga0209026_1000264
843 Ga0209026_1008395
844 Ga0209677_100002
845 Ga0209677_100011
846 Ga0209677_100019
847 Ga0209759_1000264
848 Ga0209759_1000296
849 Ga0209233_1000025
850 Ga0209233_1002373
851 Ga0209455_1007786
852 Ga0209676_1000020
853 Ga0209676_1002238
854 Ga0209050_1000013
855 Ga0209051_1000007
856 Ga0209257_1002079
857 Ga0207697_10009917
858 Ga0207656_10092937
859 Ga0207696_1000001
860 Ga0207696_1000004
861 Ga0207696_1000169
862 Ga0207655_1000011
863 Ga0207655_1000149
864 Ga0207655_1001337
865 Ga0207655_1002650
866 Ga0207655_1037529
867 Ga0207713_1000024
868 Ga0207713_1000026
869 Ga0207713_1000027
870 Ga0207713_1000060
871 Ga0207713_1002927
872 Ga0207713_1034337
873 Ga0207713_1075990
874 Ga0207642_10002399
875 Ga0207710_10000140
876 Ga0207688_10047958
877 Ga0207645_10005429
878 Ga0207643_10054002
879 Ga0207684_10134450
880 Ga0207654_10000006
881 Ga0207695_10000719
882 Ga0207695_10003386
883 Ga0207695_10038779
884 Ga0207695_10814049
885 Ga0207695_10827877
886 Ga0207671_10014094
887 Ga0207660_10184503
888 Ga0207662_10012698
889 Ga0207694_10000147
890 Ga0207694_10003504
891 Ga0207650_10000426
892 Ga0207650_10008535
893 Ga0207659_10098983
894 Ga0207644_10104930
895 Ga0207706_10143923
896 Ga0207686_10292086
897 Ga0207709_10022089
898 Ga0207709_10102116
899 Ga0207669_10026605
900 Ga0207704_10133532
901 Ga0207711_10283285
902 Ga0207689_10091514
903 Ga0207679_10329748
904 Ga0207667_10000053
905 Ga0207667_10014432
906 Ga0207668_10088515
907 Ga0207708_10007364
908 Ga0207702_10012304
909 Ga0207641_10014333
910 Ga0207648_10006414
911 Ga0207676_10106490
912 Ga0207675_100048538
913 Ga0207683_10132331
914 Ga0207698_10003252
915 Ga0207698_10503972
916 Ga0209281_1000008
917 Ga0209281_1001466
918 Ga0209371_1000348
919 Ga0307515_10000040
920 Ga0307515_10031174
921 Ga0268256_1000134
922 Ga0265328_10000378
923 Ga0265328_10006693
924 Ga0265320_10060938
925 Ga0265329_10005220
926 Ga0265331_10008145
927 Ga0265316_10044913
928 Ga0265314_10004765
929 Ga0307405_10140607
930 Ga0307405_10257292
931 Ga0307413_10071959
932 Ga0307406_10067539
933 Ga0307407_10060650
934 Ga0307412_10005141
935 Ga0307412_10140940
936 Ga0307409_100538079
937 Ga0307416_100063453
938 Ga0307416_100629067
939 Ga0307411_10007450
940 Ga0307411_10109452
941 Ga0436364_0266477
942 Ga0436364_0714820
943 Ga0436364_1535370
944 Ga0436365_0916090
945 Ga0436361_0376772
946 Ga0436361_0409139
947 Ga0436361_0659952
948 Ga0436363_0254040
949 Ga0439438_001380
950 Ga0439447_006742
951 Ga0439466_0000495
952 Ga0439466_0028715
953 Ga0439466_0051780
954 Ga0439432_014263
955 Ga0439451_000047
956 Ga0439451_000377
957 Ga0439451_002515
958 Ga0439452_000043
959 Ga0439452_000605
960 Ga0439452_001052
961 Ga0439456_000335
962 Ga0439456_001538
963 Ga0439463_000294
964 Ga0439463_007569
965 Ga0450911_006623
966 Ga0450900_000128
967 Ga0450902_004091
968 Ga0450904_000487
969 Ga0450906_000010
970 Ga0450907_005684
971 Ga0439460_0000060
972 Ga0451576_0133593
973 Ga0495617_000642
974 Ga0495617_041529
975 Ga0495627_000018
976 Ga0495627_000380
977 Ga0495627_005333
978 Ga0495627_037220
979 Ga0495592_0001072
980 Ga0495603_0002989
981 Ga0495591_000041
982 Ga0495591_000189
983 Ga0495591_000234
984 Ga0495591_005709
985 Ga0495591_016739
986 Ga0495591_024088
987 Ga0495638_0030846
988 Ga0495651_0013562
989 Ga0495653_0001089
990 Ga0495653_0008898
991 Ga0495650_0000034
992 Ga0495650_0000309
993 Ga0495650_0000780
994 Ga0495650_0003367
995 Ga0495650_0024507
996 Ga0495580_0044817
997 Ga0495580_0570184
998 Ga0495605_0000045
999 Ga0495605_0000090
1000 Ga0495605_0000124
1001 Ga0495605_0000589
1002 Ga0495605_0000705
1003 Ga0495605_0000722
1004 Ga0495605_0023604
1005 Ga0495605_0034801
1006 Ga0495605_0100361
1007 Ga0495605_0218911
1008 Ga0495584_0002628
1009 Ga0495584_0008800
1010 Ga0495584_0009488
1011 Ga0495585_0001433
1012 Ga0495585_0002260
1013 Ga0495594_0000711
1014 Ga0495596_0013213
1015 Ga0495596_0068391
1016 Ga0495607_0000070
1017 Ga0495607_0000106
1018 Ga0495607_0000284
1019 Ga0495607_0000369
1020 Ga0495607_0005884
1021 Ga0495607_0006909
1022 Ga0495607_0012639
1023 Ga0495607_0021888
1024 Ga0495607_0081953
1025 Ga0495607_0083646
1026 Ga0495583_0000101
1027 Ga0495583_0000765
1028 Ga0495583_0001353
1029 Ga0495583_0002114
1030 Ga0495583_0002459
1031 Ga0495583_0056234
1032 Ga0495606_0000042
1033 Ga0495606_0000081
1034 Ga0495606_0000098
1035 Ga0495606_0000410
1036 Ga0495606_0000529
1037 Ga0495606_0001296
1038 Ga0495606_0003477
1039 Ga0495606_0063602
1040 Ga0495606_0097138
1041 Ga0495608_0001962
1042 Ga0495610_0012980
1043 Ga0495616_0046339
1044 Ga0495618_0003306
1045 Ga0495620_0000001
1046 Ga0495620_0001049
1047 Ga0495620_0001966
1048 Ga0495620_0049954
1049 Ga0495628_0001529
1050 Ga0495631_0001230
1051 Ga0495631_0001306
1052 Ga0495631_0005658
1053 Ga0495631_0009509
1054 Ga0495631_0032501
1055 Ga0495631_0094113
1056 Ga0495632_0002280
1057 Ga0495632_0016439
1058 Ga0495632_0041865
1059 Ga0495632_0055118
1060 Ga0495637_0000023
1061 Ga0495637_0000486
1062 Ga0495637_0001685
1063 Ga0495637_0005119
1064 Ga0495637_0014831
1065 Ga0495637_0055348
1066 Ga0495637_0067755
1067 Ga0495643_0000721
1068 Ga0495643_0019767
1069 Ga0495643_0058000
1070 Ga0495643_0092214
1071 Ga0495644_0000910
1072 Ga0495644_0002392
1073 Ga0495648_0003650
1074 Ga0495648_0004913
1075 Ga0495648_0010650
1076 Ga0495666_0035332
1077 Ga0495652_0007377
1078 Ga0495654_0000179
1079 Ga0495654_0002585
1080 Ga0495654_0004579
1081 Ga0495654_0007597
1082 Ga0495654_0010116
1083 Ga0495654_0049717
1084 Ga0495654_0059994
1085 Ga0495609_0000011
1086 Ga0495609_0000012
1087 Ga0495609_0000145
1088 Ga0495609_0004096
1089 Ga0495609_0006406
1090 Ga0495597_0000004
1091 Ga0495597_0003740
1092 Ga0495645_0108653
1093 Ga0495645_0130468
1094 Ga0495622_0004276
1095 Ga0495622_0072380
1096 Ga0495622_0114117
1097 Ga0495633_0000016
1098 Ga0495633_0000367
1099 Ga0495633_0009020
1100 Ga0495667_0379601
1101 Ga0495668_0050878
1102 Ga0495668_0082153
1103 Ga0495634_0077027
1104 Ga0495611_0001082
1105 Ga0495611_0001380
1106 Ga0495611_0055885
1107 Ga0495625_0000010
1108 Ga0495625_0000108
1109 Ga0495635_0032032
1110 Ga0495661_0000004
1111 Ga0495661_0000010
1112 Ga0495661_0000018
1113 Ga0495661_0000020
1114 Ga0495661_0088125
1115 Ga0495661_0126149
1116 Ga0495661_0195530
1117 Ga0495661_0197514
1118 Ga0495657_0025488
1119 Ga0495599_0012638
1120 Ga0495623_0006756
1121 Ga0495646_0001802
1122 Ga0495658_0014570
1123 Ga0495624_0010937
1124 Ga0495670_0012175
1125 Ga0495671_0001070
1126 Ga0495671_0001369
1127 Ga0495671_0007179
1128 Ga0495671_0044115
1129 Ga0495649_0000027
1130 Ga0495649_0000083
1131 Ga0495649_0019663
1132 Ga0495649_0040948
1133 Ga0495589_0000002
1134 Ga0495589_0001428
1135 Ga0495600_0005526
1136 Ga0495660_0000004
1137 Ga0495660_0000020
1138 Ga0495660_0000454
1139 Ga0495660_0000637
1140 Ga0495660_0007375
1141 Ga0495660_0031802
1142 Ga0495660_0087172
1143 Ga0495604_0013783
1144 Ga0495604_0034528
1145 Ga0495672_0000011
1146 Ga0495672_0003150
1147 Ga0495672_0007746
1148 Ga0495672_0016420
1149 Ga0495672_0036521
1150 Ga0495672_0061562
1151 Ga0495672_0069236
1152 Ga0495672_0111424
1153 Ga0495676_0000002
1154 Ga0495683_0000019
1155 Ga0495683_0000063
1156 Ga0495683_0000416
1157 Ga0495683_0042954
1158 Ga0495683_0092068
1159 Ga0495687_000579
1160 Ga0495679_000165
1161 Ga0495679_000322
1162 Ga0495673_0000020
1163 Ga0495673_0000183
1164 Ga0495673_0000758
1165 Ga0495673_0001862
1166 Ga0495673_0004738
1167 Ga0495673_0010447
1168 Ga0495673_0014825
1169 Ga0495673_0019900
1170 Ga0495673_0022461
1171 Ga0495673_0055276
1172 Ga0495673_0062263
1173 Ga0495673_0089134
1174 Ga0495681_0000538
1175 Ga0495681_0001151
1176 Ga0495681_0050837
1177 Ga0495686_0055630
1178 Ga0495686_0142909
1179 Ga0495602_0025284
1180 Ga0495626_0000007
1181 Ga0495626_0000897
1182 Ga0495626_0039485
1183 Ga0496102_0782102
1184 Ga0496104_0001712
1185 Ga0496110_0052219
1186 Ga0496111_0388315
1187 Ga0496113_0333225
1188 Ga0496116_0000023
1189 Ga0496116_0000083
1190 Ga0496116_0026142
1191 Ga0496117_0000463
1192 Ga0496117_0003404
1193 Ga0496117_0010690
1194 Ga0496117_0061188
1195 Ga0496117_0068768
1196 Ga0496117_0165761
1197 Ga0496118_0001450
1198 Ga0496118_0008485
1199 Ga0496118_0065412
1200 Ga0496118_0129287
1201 Ga0496119_0006664
1202 Ga0496119_0007198
1203 Ga0496119_0010183
1204 Ga0496119_0108605
1205 Ga0496120_0000052
1206 Ga0496120_0001403
1207 Ga0496120_0006927
1208 Ga0496120_0063720
1209 Ga0496121_0000824
1210 Ga0496121_0003602
1211 Ga0496121_0116803
1212 Ga0496122_0000135
1213 Ga0496122_0000146
1214 Ga0496122_0000167
1215 Ga0496122_0004158
1216 Ga0496122_0107291
1217 Ga0496123_0000004
1218 Ga0496123_0000127
1219 Ga0496123_0000475
1220 Ga0496123_0003312
1221 Ga0496123_0055389
1222 Ga0496124_0000017
1223 Ga0496124_0000140
1224 Ga0496124_0000292
1225 Ga0496124_0001314
1226 Ga0496124_0010375
1227 Ga0496124_0012407
1228 Ga0496124_0163452
1229 Ga0496125_0000131
1230 Ga0496125_0000195
1231 Ga0496125_0000896
1232 Ga0496125_0021687
1233 Ga0496125_0099143
1234 Ga0496126_0000300
1235 Ga0496126_0001270
1236 Ga0495678_000036
1237 Ga0495678_000120
1238 Ga0495678_001857
1239 Ga0495678_002399
1240 Ga0495678_005571
1241 Ga0495678_044875
1242 Ga0495678_061852
1243 Ga0495682_0000005
1244 Ga0495682_0000241
1245 Ga0495682_0001417
1246 Ga0495682_0003494
1247 Ga0501039_0500586
1248 Ga0501035_0604652
1249 nmdc:mga00v17_83208_c1
1250 nmdc:mga0n895_311442_c1
1251 nmdc:mga0n895_878473_c1
1252 Ga0495601_0009822
1253 Ga0500555_003816
1254 Ga0500618_001248
1255 Ga0500621_000017
1256 Ga0500574_003638
1257 Ga0500616_0074678
1258 Ga0500636_0008414
1259 2506577533
1260 2506582671
1261 2510136388
1262 2511252247
1263 2513568682
1264 2513574457
1265 2553005414
1266 2555261202
1267 2585829745
1268 2585835247
1269 2599330506
1270 2599612201
1271 2599932389
1272 2599970765
1273 2599993103
1274 2600022891
1275 2600028968
1276 2600036724
1277 2600043033
1278 2600057989
1279 2600066319
1280 2600076259
1281 2600358135
1282 2601625072
1283 2656277421
1284 2656279128
1285 2671106985
1286 2671130254
1287 2689444012
1288 2715751410
1289 2738688658
1290 2738744476
1291 2739261439
1292 2739265030
1293 2739353706
1294 2765568344
1295 2774131990
1296 2806061259
1297 2806065677
1298 2807179568
1299 2808979829
1300 2808995549
1301 2819541971
1302 2819594450
1303 2819617780
1304 2826585216
1305 2839094766
1306 2842700068
1307 2842818824
1308 2842834971
1309 2842853582
1310 2842858544
1311 2852614606
1312 2852667656
1313 2855736457
1314 2855773394
1315 2869553387
1316 2884814170
1317 2884840874
1318 2884857530
1319 2888368061
1320 2896158470
1321 2904440039
1322 2904475910
1323 2904505349
1324 2904531010
1325 2904587344
1326 2904592621
1327 2904604597
1328 2919047263
1329 2919082418
1330 2919111346
1331 2919128711
1332 2919152079
1333 2919482282
1334 2919489222
1335 2923515894
1336 2923588491
1337 2927144748
1338 2928133341
1339 2931375443
1340 2969307727
1341 2971822809
1342 2974291065
1343 2984503523
1344 640937027
1345 8002060801
1346 8015394875
1347 8018154112
1348 8056168518

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

92

237

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hc2-assembly1.cif.gz_A-2 crystal structure of chicken sulfite oxidase mutant tyr 322 phe 0.9021 104 247
2a99-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9008 104 247
3r18-assembly1.cif.gz_A-2 chicken sulfite oxidase double mutant with altered activity and substrate affinity 0.8995 104 247
2xts-assembly1.cif.gz_C crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.8977 104 241
3hbp-assembly1.cif.gz_A-2 the crystal structure of c185s mutant of recombinant sulfite oxidase with bound substrate, sulfite, at the active site 0.8971 104 247
ID Description Score Start End Superfamily
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8976 104 241 3.90.420.10
af_A0A0R4IKF7_192_441_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8777 104 252 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.849 80 252 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8429 85 247 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8374 93 241 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A6I4SVQ0-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9707 110 221
AF-A0A537TEQ0-F1-model_v4 Molybdopterin-binding protein 0.9635 79 258
AF-A0A537S0D7-F1-model_v4 Molybdopterin-binding protein 0.9591 48 258
AF-A0A537ALX2-F1-model_v4 Molybdopterin-binding protein 0.9537 48 258
AF-A0A537TEQ0-F1-model_v4 Molybdopterin-binding protein 0.948 79 258

Map