F474385
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 674 | 368 | 1348 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300046471|Ga0495650_0000018|Ga0495650_0000018_218774_219538 |
| Length | 248 |
| Sequence | MSDKTQRPKIILEPDQRKQLVNIQRRMLLRSGLTLGAVSMLTGCNLQDGDQVDKVLWAMSRWNDRVQSWLFSGQKLAQTYRADQITTPFRFNAYYPEYNVNYRLEVSGLVQKKAPWTLEQLQRLPQESQITRLICIEGWSAIGQWKGVPLKTFLQHVGADLTAKYVGFKCDDRYYSSIDMATALHPQTILALDFGGKPLPPDFGYPLRLRMPTKLGFKNAKHIGAIFVTNEYPGGYWEDQGYNWFSGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 87 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 88 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 147 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 149 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 159 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 165 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 166 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 167 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 168 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 169 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 170 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 171 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 172 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 173 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 174 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 175 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 176 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 177 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 178 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 179 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 180 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 181 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 182 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 183 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 184 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 257 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 260 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 261 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 262 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 263 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 264 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 265 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 276 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 277 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 278 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 279 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 280 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 281 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 282 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 283 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 284 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 285 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 286 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 287 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 288 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 289 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 290 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 291 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 292 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 293 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 294 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 295 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 296 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 297 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 298 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 299 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 300 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 301 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 302 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 303 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 304 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 305 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 306 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 307 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 308 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 309 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 310 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 311 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 312 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 313 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 314 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 315 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 316 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 317 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 318 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 319 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 320 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 321 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 322 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 323 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 324 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 325 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 326 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 327 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 328 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 329 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 330 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 331 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 332 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 333 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 334 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 335 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 336 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 337 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 338 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 339 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 340 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 341 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 342 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 343 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 344 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 345 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 346 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 347 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 348 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 349 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 350 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 351 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 352 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 353 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 354 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 355 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 356 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 357 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 358 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 359 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 360 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 361 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 362 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 363 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 364 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 365 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 366 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 367 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 368 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.65 |
| Metatranscriptomes | 0 |
| Isolates | 13.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 9.5 |
| Nodule | 1.63 |
| Rhizoplane | 3.12 |
| Rhizosphere | 69.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495650_0000018 | 3300046471 | Bacteria | 538888 |
| 2 | SwRhRL2b_contig_2097597 | 2162886007 | Bacteria | 1603 |
| 3 | SwRhRL2b_contig_2326806 | 2162886007 | Bacteria | 4897 |
| 4 | MRS1b_contig_117389 | 2162886011 | Bacteria | 898 |
| 5 | JGI25155J39150_1000511 | 3300002704 | Bacteria | 9243 |
| 6 | JGI25156J39149_1000320 | 3300002705 | Bacteria | 31857 |
| 7 | JGI25156J39149_1009833 | 3300002705 | Bacteria | 2293 |
| 8 | JGI25162J39368_1000002 | 3300002737 | Bacteria | 663004 |
| 9 | JGI25162J39368_1000079 | 3300002737 | Bacteria | 115162 |
| 10 | JGI25154J39366_1000264 | 3300002738 | Bacteria | 33263 |
| 11 | JGI25154J39366_1000967 | 3300002738 | Bacteria | 11784 |
| 12 | JGI25157J39369_1001592 | 3300002741 | Bacteria | 7972 |
| 13 | JGI25163J39215_1000003 | 3300002771 | Bacteria | 149140 |
| 14 | JGI25164J39214_1000041 | 3300002772 | Bacteria | 127466 |
| 15 | JGI25165J46597_1000135 | 3300003214 | Bacteria | 122924 |
| 16 | rootH1_10015053 | 3300003323 | Bacteria | 13144 |
| 17 | Ga0055538_1000003 | 3300003751 | Bacteria | 663004 |
| 18 | Ga0055538_1000055 | 3300003751 | Bacteria | 122924 |
| 19 | Ga0055539_1000003 | 3300003752 | Bacteria | 663004 |
| 20 | Ga0055539_1000080 | 3300003752 | Bacteria | 122924 |
| 21 | Ga0055539_1000390 | 3300003752 | Bacteria | 17735 |
| 22 | Ga0055533_1000005 | 3300003756 | Bacteria | 663004 |
| 23 | Ga0055533_1000086 | 3300003756 | Bacteria | 122924 |
| 24 | Ga0055533_1000382 | 3300003756 | Bacteria | 17735 |
| 25 | Ga0055532_1000089 | 3300003758 | Bacteria | 105631 |
| 26 | Ga0055525_1000005 | 3300003759 | Bacteria | 663004 |
| 27 | Ga0055525_1000114 | 3300003759 | Bacteria | 122924 |
| 28 | Ga0055525_1000545 | 3300003759 | Bacteria | 17735 |
| 29 | Ga0055535_1013818 | 3300003761 | Bacteria | 1179 |
| 30 | Ga0055536_1000072 | 3300003781 | Bacteria | 91344 |
| 31 | Ga0055530_10000016 | 3300003791 | Bacteria | 146874 |
| 32 | Ga0055540_1000048 | 3300003792 | Bacteria | 146874 |
| 33 | Ga0055541_1000003 | 3300003841 | Bacteria | 663004 |
| 34 | Ga0055541_1000057 | 3300003841 | Bacteria | 122924 |
| 35 | Ga0055541_1000276 | 3300003841 | Bacteria | 17735 |
| 36 | Ga0065704_10000133 | 3300005289 | Bacteria | 53116 |
| 37 | Ga0065704_10070340 | 3300005289 | Bacteria | 31623 |
| 38 | Ga0065712_10068515 | 3300005290 | Bacteria | 10156 |
| 39 | Ga0065715_10127867 | 3300005293 | Bacteria | 2077 |
| 40 | Ga0065715_10161229 | 3300005293 | Bacteria | 1627 |
| 41 | Ga0070676_10070085 | 3300005328 | Bacteria | 2102 |
| 42 | Ga0070690_100022014 | 3300005330 | Bacteria | 3897 |
| 43 | Ga0070670_100000436 | 3300005331 | Bacteria | 34108 |
| 44 | Ga0070670_100010016 | 3300005331 | Bacteria | 8092 |
| 45 | Ga0070670_100131249 | 3300005331 | Bacteria | 2163 |
| 46 | Ga0070677_10011729 | 3300005333 | Bacteria | 3028 |
| 47 | Ga0070666_10087490 | 3300005335 | Bacteria | 2135 |
| 48 | Ga0070689_100002776 | 3300005340 | Bacteria | 11491 |
| 49 | Ga0070671_100044427 | 3300005355 | Bacteria | 3692 |
| 50 | Ga0070688_100057321 | 3300005365 | Bacteria | 2448 |
| 51 | Ga0070667_100051168 | 3300005367 | Bacteria | 3482 |
| 52 | Ga0070709_10285931 | 3300005434 | Bacteria | 1200 |
| 53 | Ga0070700_100040185 | 3300005441 | Bacteria | 2862 |
| 54 | Ga0070662_100128236 | 3300005457 | Bacteria | 1952 |
| 55 | Ga0070681_10018458 | 3300005458 | Bacteria | 6973 |
| 56 | Ga0070706_100055789 | 3300005467 | Bacteria | 3647 |
| 57 | Ga0070707_100187918 | 3300005468 | Bacteria | 2014 |
| 58 | Ga0070699_100666240 | 3300005518 | Bacteria | 950 |
| 59 | Ga0070672_100029387 | 3300005543 | Bacteria | 4121 |
| 60 | Ga0070665_100166334 | 3300005548 | Bacteria | 2207 |
| 61 | Ga0068855_100000037 | 3300005563 | Bacteria | 158161 |
| 62 | Ga0068855_100032073 | 3300005563 | Bacteria | 6272 |
| 63 | Ga0068854_100006645 | 3300005578 | Bacteria | 7368 |
| 64 | Ga0068856_100027730 | 3300005614 | Bacteria | 5525 |
| 65 | Ga0070702_100022041 | 3300005615 | Bacteria | 3362 |
| 66 | Ga0068852_100002544 | 3300005616 | Bacteria | 12561 |
| 67 | Ga0068870_10157525 | 3300005840 | Bacteria | 1343 |
| 68 | Ga0068858_100054240 | 3300005842 | Bacteria | 3707 |
| 69 | Ga0068860_100139725 | 3300005843 | Bacteria | 2327 |
| 70 | Ga0081455_10000453 | 3300005937 | Bacteria | 53921 |
| 71 | Ga0081455_10026391 | 3300005937 | Bacteria | 5343 |
| 72 | Ga0070717_10060480 | 3300006028 | Bacteria | 3137 |
| 73 | Ga0075434_100122072 | 3300006871 | Bacteria | 2621 |
| 74 | Ga0075434_100332867 | 3300006871 | Bacteria | 1539 |
| 75 | Ga0075434_100995172 | 3300006871 | Bacteria | 852 |
| 76 | Ga0068865_100289272 | 3300006881 | Bacteria | 1307 |
| 77 | Ga0105251_10000016 | 3300009011 | Bacteria | 146400 |
| 78 | Ga0105251_10000119 | 3300009011 | Bacteria | 79040 |
| 79 | Ga0105251_10003359 | 3300009011 | Bacteria | 11652 |
| 80 | Ga0105251_10011487 | 3300009011 | Bacteria | 5056 |
| 81 | Ga0105251_10082218 | 3300009011 | Bacteria | 1488 |
| 82 | Ga0105251_10110851 | 3300009011 | Bacteria | 1250 |
| 83 | Ga0105244_10000190 | 3300009036 | Bacteria | 62853 |
| 84 | Ga0105244_10000216 | 3300009036 | Bacteria | 59709 |
| 85 | Ga0105244_10000425 | 3300009036 | Bacteria | 39065 |
| 86 | Ga0105244_10000450 | 3300009036 | Bacteria | 37505 |
| 87 | Ga0105244_10077183 | 3300009036 | Bacteria | 1653 |
| 88 | Ga0105250_10000003 | 3300009092 | Bacteria | 547770 |
| 89 | Ga0105250_10000265 | 3300009092 | Bacteria | 42626 |
| 90 | Ga0105250_10001281 | 3300009092 | Bacteria | 13801 |
| 91 | Ga0105240_10001596 | 3300009093 | Bacteria | 38514 |
| 92 | Ga0105240_10029133 | 3300009093 | Bacteria | 7199 |
| 93 | Ga0105240_10534087 | 3300009093 | Bacteria | 1300 |
| 94 | Ga0105240_11173564 | 3300009093 | Bacteria | 814 |
| 95 | Ga0111539_10146112 | 3300009094 | Bacteria | 2768 |
| 96 | Ga0105247_10000103 | 3300009101 | Bacteria | 90413 |
| 97 | Ga0105243_10005208 | 3300009148 | Bacteria | 10173 |
| 98 | Ga0105243_10152383 | 3300009148 | Bacteria | 1984 |
| 99 | Ga0105241_10000004 | 3300009174 | Bacteria | 803007 |
| 100 | Ga0105242_10045416 | 3300009176 | Bacteria | 3561 |
| 101 | Ga0105248_10526428 | 3300009177 | Bacteria | 1333 |
| 102 | Ga0105238_10001958 | 3300009551 | Bacteria | 20734 |
| 103 | Ga0105238_10004012 | 3300009551 | Bacteria | 14607 |
| 104 | Ga0105238_10053378 | 3300009551 | Bacteria | 4061 |
| 105 | Ga0105239_10016513 | 3300010375 | Bacteria | 8165 |
| 106 | Ga0105246_10037197 | 3300011119 | Bacteria | 3266 |
| 107 | Ga0157373_10002585 | 3300013100 | Bacteria | 13746 |
| 108 | Ga0157373_10055607 | 3300013100 | Bacteria | 2811 |
| 109 | Ga0157371_10001449 | 3300013102 | Bacteria | 24611 |
| 110 | Ga0157371_10003951 | 3300013102 | Bacteria | 13158 |
| 111 | Ga0157370_10001398 | 3300013104 | Bacteria | 29918 |
| 112 | Ga0157370_10003497 | 3300013104 | Bacteria | 18414 |
| 113 | Ga0157370_10500792 | 3300013104 | Bacteria | 1115 |
| 114 | Ga0157369_10045584 | 3300013105 | Bacteria | 4767 |
| 115 | Ga0157378_10052710 | 3300013297 | Bacteria | 3620 |
| 116 | Ga0157378_10737134 | 3300013297 | Bacteria | 1007 |
| 117 | Ga0163162_10024709 | 3300013306 | Bacteria | 5934 |
| 118 | Ga0157372_10894500 | 3300013307 | Bacteria | 1030 |
| 119 | Ga0163163_10442330 | 3300014325 | Bacteria | 1360 |
| 120 | Ga0157380_10007892 | 3300014326 | Bacteria | 7574 |
| 121 | Ga0182008_10006908 | 3300014497 | Bacteria | 6304 |
| 122 | Ga0182008_10007128 | 3300014497 | Bacteria | 6190 |
| 123 | Ga0182008_10022934 | 3300014497 | Bacteria | 3194 |
| 124 | Ga0182008_10048041 | 3300014497 | Bacteria | 2120 |
| 125 | Ga0157377_10358254 | 3300014745 | Bacteria | 981 |
| 126 | Ga0157379_10029779 | 3300014968 | Bacteria | 4854 |
| 127 | Ga0157376_10670611 | 3300014969 | Bacteria | 1039 |
| 128 | Ga0182006_1002060 | 3300015261 | Bacteria | 11273 |
| 129 | Ga0182006_1021259 | 3300015261 | Bacteria | 2708 |
| 130 | Ga0182006_1023940 | 3300015261 | Bacteria | 2525 |
| 131 | Ga0182006_1046082 | 3300015261 | Bacteria | 1695 |
| 132 | Ga0182007_10000471 | 3300015262 | Bacteria | 24311 |
| 133 | Ga0182007_10003572 | 3300015262 | Bacteria | 7315 |
| 134 | Ga0182007_10004652 | 3300015262 | Bacteria | 6195 |
| 135 | Ga0182007_10026824 | 3300015262 | Bacteria | 1992 |
| 136 | Ga0182005_1000151 | 3300015265 | Bacteria | 48745 |
| 137 | Ga0182005_1000341 | 3300015265 | Bacteria | 27029 |
| 138 | Ga0182005_1018141 | 3300015265 | Bacteria | 1945 |
| 139 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 140 | Ga0213872_10000360 | 3300021361 | Bacteria | 38318 |
| 141 | Ga0213872_10005698 | 3300021361 | Bacteria | 6343 |
| 142 | Ga0213875_10014875 | 3300021388 | Bacteria | 3792 |
| 143 | Ga0209435_100109 | 3300025206 | Bacteria | 32283 |
| 144 | Ga0209435_100890 | 3300025206 | Bacteria | 4569 |
| 145 | Ga0209760_100002 | 3300025207 | Bacteria | 274743 |
| 146 | Ga0209760_101315 | 3300025207 | Bacteria | 2696 |
| 147 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 148 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 149 | Ga0209784_100018 | 3300025224 | Bacteria | 456816 |
| 150 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 151 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 152 | Ga0209566_100016 | 3300025225 | Bacteria | 456824 |
| 153 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 154 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 155 | Ga0209674_100030 | 3300025226 | Bacteria | 456824 |
| 156 | Ga0209147_100060 | 3300025229 | Bacteria | 249588 |
| 157 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 158 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 159 | Ga0209563_100034 | 3300025230 | Bacteria | 456824 |
| 160 | Ga0207427_100009 | 3300025231 | Bacteria | 663036 |
| 161 | Ga0207427_100232 | 3300025231 | Bacteria | 46074 |
| 162 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 163 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 164 | Ga0209437_100081 | 3300025233 | Bacteria | 271072 |
| 165 | Ga0209258_100141 | 3300025242 | Bacteria | 166385 |
| 166 | Ga0209646_1000101 | 3300025246 | Bacteria | 164503 |
| 167 | Ga0209646_1000176 | 3300025246 | Bacteria | 81901 |
| 168 | Ga0209026_1000264 | 3300025250 | Bacteria | 64186 |
| 169 | Ga0209026_1008395 | 3300025250 | Bacteria | 2162 |
| 170 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 171 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 172 | Ga0209677_100019 | 3300025253 | Bacteria | 456824 |
| 173 | Ga0209759_1000264 | 3300025256 | Bacteria | 75893 |
| 174 | Ga0209759_1000296 | 3300025256 | Bacteria | 68965 |
| 175 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 176 | Ga0209233_1002373 | 3300025261 | Bacteria | 6983 |
| 177 | Ga0209455_1007786 | 3300025272 | Bacteria | 2984 |
| 178 | Ga0209676_1000020 | 3300025292 | Bacteria | 617256 |
| 179 | Ga0209676_1002238 | 3300025292 | Bacteria | 14283 |
| 180 | Ga0209050_1000013 | 3300025298 | Bacteria | 811408 |
| 181 | Ga0209051_1000007 | 3300025303 | Bacteria | 811408 |
| 182 | Ga0209257_1002079 | 3300025304 | Bacteria | 21094 |
| 183 | Ga0207697_10009917 | 3300025315 | Bacteria | 4092 |
| 184 | Ga0207656_10092937 | 3300025321 | Bacteria | 1372 |
| 185 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 186 | Ga0207696_1000004 | 3300025711 | Bacteria | 671626 |
| 187 | Ga0207696_1000169 | 3300025711 | Bacteria | 103182 |
| 188 | Ga0207655_1000011 | 3300025728 | Bacteria | 643321 |
| 189 | Ga0207655_1000149 | 3300025728 | Bacteria | 129937 |
| 190 | Ga0207655_1001337 | 3300025728 | Bacteria | 23216 |
| 191 | Ga0207655_1002650 | 3300025728 | Bacteria | 14127 |
| 192 | Ga0207655_1037529 | 3300025728 | Bacteria | 2133 |
| 193 | Ga0207713_1000024 | 3300025735 | Bacteria | 339156 |
| 194 | Ga0207713_1000026 | 3300025735 | Bacteria | 319032 |
| 195 | Ga0207713_1000027 | 3300025735 | Bacteria | 312621 |
| 196 | Ga0207713_1000060 | 3300025735 | Bacteria | 213145 |
| 197 | Ga0207713_1002927 | 3300025735 | Bacteria | 11951 |
| 198 | Ga0207713_1034337 | 3300025735 | Bacteria | 2204 |
| 199 | Ga0207713_1075990 | 3300025735 | Bacteria | 1223 |
| 200 | Ga0207642_10002399 | 3300025899 | Bacteria | 5833 |
| 201 | Ga0207710_10000140 | 3300025900 | Bacteria | 83223 |
| 202 | Ga0207688_10047958 | 3300025901 | Bacteria | 2386 |
| 203 | Ga0207645_10005429 | 3300025907 | Bacteria | 9243 |
| 204 | Ga0207643_10054002 | 3300025908 | Bacteria | 2283 |
| 205 | Ga0207684_10134450 | 3300025910 | Bacteria | 2123 |
| 206 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 207 | Ga0207695_10000719 | 3300025913 | Bacteria | 64361 |
| 208 | Ga0207695_10003386 | 3300025913 | Bacteria | 22534 |
| 209 | Ga0207695_10038779 | 3300025913 | Bacteria | 5124 |
| 210 | Ga0207695_10814049 | 3300025913 | Bacteria | 814 |
| 211 | Ga0207695_10827877 | 3300025913 | Bacteria | 806 |
| 212 | Ga0207671_10014094 | 3300025914 | Bacteria | 6336 |
| 213 | Ga0207660_10184503 | 3300025917 | Bacteria | 1622 |
| 214 | Ga0207662_10012698 | 3300025918 | Bacteria | 4694 |
| 215 | Ga0207694_10000147 | 3300025924 | Bacteria | 72638 |
| 216 | Ga0207694_10003504 | 3300025924 | Bacteria | 12469 |
| 217 | Ga0207650_10000426 | 3300025925 | Bacteria | 37126 |
| 218 | Ga0207650_10008535 | 3300025925 | Bacteria | 6995 |
| 219 | Ga0207659_10098983 | 3300025926 | Bacteria | 2194 |
| 220 | Ga0207644_10104930 | 3300025931 | Bacteria | 2128 |
| 221 | Ga0207706_10143923 | 3300025933 | Bacteria | 2097 |
| 222 | Ga0207686_10292086 | 3300025934 | Bacteria | 1207 |
| 223 | Ga0207709_10022089 | 3300025935 | Bacteria | 3607 |
| 224 | Ga0207709_10102116 | 3300025935 | Bacteria | 1898 |
| 225 | Ga0207669_10026605 | 3300025937 | Bacteria | 3150 |
| 226 | Ga0207704_10133532 | 3300025938 | Bacteria | 1723 |
| 227 | Ga0207711_10283285 | 3300025941 | Bacteria | 1526 |
| 228 | Ga0207689_10091514 | 3300025942 | Bacteria | 2499 |
| 229 | Ga0207679_10329748 | 3300025945 | Bacteria | 1324 |
| 230 | Ga0207667_10000053 | 3300025949 | Bacteria | 226712 |
| 231 | Ga0207667_10014432 | 3300025949 | Bacteria | 9007 |
| 232 | Ga0207668_10088515 | 3300025972 | Bacteria | 2268 |
| 233 | Ga0207708_10007364 | 3300026075 | Bacteria | 8133 |
| 234 | Ga0207702_10012304 | 3300026078 | Bacteria | 7123 |
| 235 | Ga0207641_10014333 | 3300026088 | Bacteria | 6496 |
| 236 | Ga0207648_10006414 | 3300026089 | Bacteria | 11693 |
| 237 | Ga0207676_10106490 | 3300026095 | Bacteria | 2336 |
| 238 | Ga0207675_100048538 | 3300026118 | Bacteria | 3962 |
| 239 | Ga0207683_10132331 | 3300026121 | Bacteria | 2244 |
| 240 | Ga0207698_10003252 | 3300026142 | Bacteria | 9762 |
| 241 | Ga0207698_10503972 | 3300026142 | Bacteria | 1178 |
| 242 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 243 | Ga0209281_1001466 | 3300027111 | Bacteria | 13754 |
| 244 | Ga0209371_1000348 | 3300027312 | Bacteria | 50540 |
| 245 | Ga0307515_10000040 | 3300028794 | Bacteria | 322704 |
| 246 | Ga0307515_10031174 | 3300028794 | Bacteria | 8901 |
| 247 | Ga0268256_1000134 | 3300030500 | Bacteria | 102725 |
| 248 | Ga0265328_10000378 | 3300031239 | Bacteria | 20768 |
| 249 | Ga0265328_10006693 | 3300031239 | Bacteria | 4854 |
| 250 | Ga0265320_10060938 | 3300031240 | Bacteria | 1800 |
| 251 | Ga0265329_10005220 | 3300031242 | Bacteria | 5280 |
| 252 | Ga0265331_10008145 | 3300031250 | Bacteria | 5983 |
| 253 | Ga0265316_10044913 | 3300031344 | Bacteria | 3511 |
| 254 | Ga0265314_10004765 | 3300031711 | Bacteria | 12429 |
| 255 | Ga0307405_10140607 | 3300031731 | Bacteria | 1682 |
| 256 | Ga0307405_10257292 | 3300031731 | Bacteria | 1302 |
| 257 | Ga0307413_10071959 | 3300031824 | Bacteria | 2181 |
| 258 | Ga0307406_10067539 | 3300031901 | Bacteria | 2331 |
| 259 | Ga0307407_10060650 | 3300031903 | Bacteria | 2208 |
| 260 | Ga0307412_10005141 | 3300031911 | Bacteria | 7326 |
| 261 | Ga0307412_10140940 | 3300031911 | Bacteria | 1765 |
| 262 | Ga0307409_100538079 | 3300031995 | Bacteria | 1144 |
| 263 | Ga0307416_100063453 | 3300032002 | Bacteria | 3025 |
| 264 | Ga0307416_100629067 | 3300032002 | Bacteria | 1156 |
| 265 | Ga0307411_10007450 | 3300032005 | Bacteria | 5576 |
| 266 | Ga0307411_10109452 | 3300032005 | Bacteria | 1973 |
| 267 | Ga0436364_0266477 | 3300037853 | Bacteria | 1087 |
| 268 | Ga0436364_0714820 | 3300037853 | Bacteria | 4974 |
| 269 | Ga0436364_1535370 | 3300037853 | Bacteria | 953 |
| 270 | Ga0436365_0916090 | 3300039437 | Bacteria | 1114 |
| 271 | Ga0436361_0376772 | 3300039447 | Bacteria | 8066 |
| 272 | Ga0436361_0409139 | 3300039447 | Bacteria | 31464 |
| 273 | Ga0436361_0659952 | 3300039447 | Bacteria | 1671 |
| 274 | Ga0436363_0254040 | 3300039450 | Bacteria | 1198 |
| 275 | Ga0439438_001380 | 3300041405 | Bacteria | 10711 |
| 276 | Ga0439447_006742 | 3300041407 | Bacteria | 3694 |
| 277 | Ga0439466_0000495 | 3300041411 | Bacteria | 14922 |
| 278 | Ga0439466_0028715 | 3300041411 | Bacteria | 1918 |
| 279 | Ga0439466_0051780 | 3300041411 | Bacteria | 1343 |
| 280 | Ga0439432_014263 | 3300042006 | Bacteria | 2691 |
| 281 | Ga0439451_000047 | 3300042009 | Bacteria | 24088 |
| 282 | Ga0439451_000377 | 3300042009 | Bacteria | 8626 |
| 283 | Ga0439451_002515 | 3300042009 | Bacteria | 3725 |
| 284 | Ga0439452_000043 | 3300042010 | Bacteria | 132609 |
| 285 | Ga0439452_000605 | 3300042010 | Bacteria | 18365 |
| 286 | Ga0439452_001052 | 3300042010 | Bacteria | 12186 |
| 287 | Ga0439456_000335 | 3300042013 | Bacteria | 10659 |
| 288 | Ga0439456_001538 | 3300042013 | Bacteria | 4649 |
| 289 | Ga0439463_000294 | 3300042016 | Bacteria | 13843 |
| 290 | Ga0439463_007569 | 3300042016 | Bacteria | 2678 |
| 291 | Ga0450911_006623 | 3300042115 | Bacteria | 1716 |
| 292 | Ga0450900_000128 | 3300042136 | Bacteria | 4434 |
| 293 | Ga0450902_004091 | 3300042137 | Bacteria | 2162 |
| 294 | Ga0450904_000487 | 3300042139 | Bacteria | 7796 |
| 295 | Ga0450906_000010 | 3300042145 | Bacteria | 39195 |
| 296 | Ga0450907_005684 | 3300042146 | Bacteria | 2099 |
| 297 | Ga0439460_0000060 | 3300042461 | Bacteria | 16086 |
| 298 | Ga0451576_0133593 | 3300045051 | Bacteria | 2587 |
| 299 | Ga0495617_000642 | 3300046452 | Bacteria | 17510 |
| 300 | Ga0495617_041529 | 3300046452 | Bacteria | 1537 |
| 301 | Ga0495627_000018 | 3300046453 | Bacteria | 315125 |
| 302 | Ga0495627_000380 | 3300046453 | Bacteria | 40821 |
| 303 | Ga0495627_005333 | 3300046453 | Bacteria | 5204 |
| 304 | Ga0495627_037220 | 3300046453 | Bacteria | 1509 |
| 305 | Ga0495592_0001072 | 3300046454 | Bacteria | 18925 |
| 306 | Ga0495603_0002989 | 3300046455 | Bacteria | 10004 |
| 307 | Ga0495591_000041 | 3300046458 | Bacteria | 155639 |
| 308 | Ga0495591_000189 | 3300046458 | Bacteria | 63919 |
| 309 | Ga0495591_000234 | 3300046458 | Bacteria | 54016 |
| 310 | Ga0495591_005709 | 3300046458 | Bacteria | 5680 |
| 311 | Ga0495591_016739 | 3300046458 | Bacteria | 2539 |
| 312 | Ga0495591_024088 | 3300046458 | Bacteria | 1935 |
| 313 | Ga0495638_0030846 | 3300046460 | Bacteria | 3447 |
| 314 | Ga0495651_0013562 | 3300046462 | Bacteria | 6301 |
| 315 | Ga0495653_0001089 | 3300046463 | Bacteria | 20969 |
| 316 | Ga0495653_0008898 | 3300046463 | Bacteria | 8210 |
| 317 | Ga0495650_0000034 | 3300046471 | Bacteria | 410132 |
| 318 | Ga0495650_0000309 | 3300046471 | Bacteria | 88068 |
| 319 | Ga0495650_0000780 | 3300046471 | Bacteria | 39115 |
| 320 | Ga0495650_0003367 | 3300046471 | Bacteria | 11722 |
| 321 | Ga0495650_0024507 | 3300046471 | Bacteria | 2847 |
| 322 | Ga0495580_0044817 | 3300046472 | Bacteria | 3144 |
| 323 | Ga0495580_0570184 | 3300046472 | Bacteria | 750 |
| 324 | Ga0495605_0000045 | 3300046474 | Bacteria | 176155 |
| 325 | Ga0495605_0000090 | 3300046474 | Bacteria | 116120 |
| 326 | Ga0495605_0000124 | 3300046474 | Bacteria | 101623 |
| 327 | Ga0495605_0000589 | 3300046474 | Bacteria | 29051 |
| 328 | Ga0495605_0000705 | 3300046474 | Bacteria | 24816 |
| 329 | Ga0495605_0000722 | 3300046474 | Bacteria | 24319 |
| 330 | Ga0495605_0023604 | 3300046474 | Bacteria | 3230 |
| 331 | Ga0495605_0034801 | 3300046474 | Bacteria | 2549 |
| 332 | Ga0495605_0100361 | 3300046474 | Bacteria | 1331 |
| 333 | Ga0495605_0218911 | 3300046474 | Bacteria | 823 |
| 334 | Ga0495584_0002628 | 3300046491 | Bacteria | 10131 |
| 335 | Ga0495584_0008800 | 3300046491 | Bacteria | 5220 |
| 336 | Ga0495584_0009488 | 3300046491 | Bacteria | 5010 |
| 337 | Ga0495585_0001433 | 3300046492 | Bacteria | 18714 |
| 338 | Ga0495585_0002260 | 3300046492 | Bacteria | 13931 |
| 339 | Ga0495594_0000711 | 3300046499 | Bacteria | 17137 |
| 340 | Ga0495596_0013213 | 3300046500 | Bacteria | 3509 |
| 341 | Ga0495596_0068391 | 3300046500 | Bacteria | 1380 |
| 342 | Ga0495607_0000070 | 3300046501 | Bacteria | 100876 |
| 343 | Ga0495607_0000106 | 3300046501 | Bacteria | 88081 |
| 344 | Ga0495607_0000284 | 3300046501 | Bacteria | 54384 |
| 345 | Ga0495607_0000369 | 3300046501 | Bacteria | 46319 |
| 346 | Ga0495607_0005884 | 3300046501 | Bacteria | 8710 |
| 347 | Ga0495607_0006909 | 3300046501 | Bacteria | 7912 |
| 348 | Ga0495607_0012639 | 3300046501 | Bacteria | 5563 |
| 349 | Ga0495607_0021888 | 3300046501 | Bacteria | 4020 |
| 350 | Ga0495607_0081953 | 3300046501 | Bacteria | 1771 |
| 351 | Ga0495607_0083646 | 3300046501 | Bacteria | 1747 |
| 352 | Ga0495583_0000101 | 3300046506 | Bacteria | 144916 |
| 353 | Ga0495583_0000765 | 3300046506 | Bacteria | 40365 |
| 354 | Ga0495583_0001353 | 3300046506 | Bacteria | 25396 |
| 355 | Ga0495583_0002114 | 3300046506 | Bacteria | 17839 |
| 356 | Ga0495583_0002459 | 3300046506 | Bacteria | 15815 |
| 357 | Ga0495583_0056234 | 3300046506 | Bacteria | 1775 |
| 358 | Ga0495606_0000042 | 3300046507 | Bacteria | 215099 |
| 359 | Ga0495606_0000081 | 3300046507 | Bacteria | 160491 |
| 360 | Ga0495606_0000098 | 3300046507 | Bacteria | 151131 |
| 361 | Ga0495606_0000410 | 3300046507 | Bacteria | 72184 |
| 362 | Ga0495606_0000529 | 3300046507 | Bacteria | 61769 |
| 363 | Ga0495606_0001296 | 3300046507 | Bacteria | 34490 |
| 364 | Ga0495606_0003477 | 3300046507 | Bacteria | 16691 |
| 365 | Ga0495606_0063602 | 3300046507 | Bacteria | 2352 |
| 366 | Ga0495606_0097138 | 3300046507 | Bacteria | 1801 |
| 367 | Ga0495608_0001962 | 3300046511 | Bacteria | 14737 |
| 368 | Ga0495610_0012980 | 3300046512 | Bacteria | 4977 |
| 369 | Ga0495616_0046339 | 3300046513 | Bacteria | 2195 |
| 370 | Ga0495618_0003306 | 3300046514 | Bacteria | 10083 |
| 371 | Ga0495620_0000001 | 3300046515 | Bacteria | 386508 |
| 372 | Ga0495620_0001049 | 3300046515 | Bacteria | 16939 |
| 373 | Ga0495620_0001966 | 3300046515 | Bacteria | 12033 |
| 374 | Ga0495620_0049954 | 3300046515 | Bacteria | 1786 |
| 375 | Ga0495628_0001529 | 3300046516 | Bacteria | 21206 |
| 376 | Ga0495631_0001230 | 3300046518 | Bacteria | 15793 |
| 377 | Ga0495631_0001306 | 3300046518 | Bacteria | 15273 |
| 378 | Ga0495631_0005658 | 3300046518 | Bacteria | 6519 |
| 379 | Ga0495631_0009509 | 3300046518 | Bacteria | 4854 |
| 380 | Ga0495631_0032501 | 3300046518 | Bacteria | 2352 |
| 381 | Ga0495631_0094113 | 3300046518 | Bacteria | 1290 |
| 382 | Ga0495632_0002280 | 3300046519 | Bacteria | 14783 |
| 383 | Ga0495632_0016439 | 3300046519 | Bacteria | 4116 |
| 384 | Ga0495632_0041865 | 3300046519 | Bacteria | 2299 |
| 385 | Ga0495632_0055118 | 3300046519 | Bacteria | 1946 |
| 386 | Ga0495637_0000023 | 3300046520 | Bacteria | 172407 |
| 387 | Ga0495637_0000486 | 3300046520 | Bacteria | 28876 |
| 388 | Ga0495637_0001685 | 3300046520 | Bacteria | 12767 |
| 389 | Ga0495637_0005119 | 3300046520 | Bacteria | 6725 |
| 390 | Ga0495637_0014831 | 3300046520 | Bacteria | 3671 |
| 391 | Ga0495637_0055348 | 3300046520 | Bacteria | 1645 |
| 392 | Ga0495637_0067755 | 3300046520 | Bacteria | 1448 |
| 393 | Ga0495643_0000721 | 3300046522 | Bacteria | 37800 |
| 394 | Ga0495643_0019767 | 3300046522 | Bacteria | 3894 |
| 395 | Ga0495643_0058000 | 3300046522 | Bacteria | 2061 |
| 396 | Ga0495643_0092214 | 3300046522 | Bacteria | 1561 |
| 397 | Ga0495644_0000910 | 3300046523 | Bacteria | 12254 |
| 398 | Ga0495644_0002392 | 3300046523 | Bacteria | 7489 |
| 399 | Ga0495648_0003650 | 3300046524 | Bacteria | 13464 |
| 400 | Ga0495648_0004913 | 3300046524 | Bacteria | 11245 |
| 401 | Ga0495648_0010650 | 3300046524 | Bacteria | 6987 |
| 402 | Ga0495666_0035332 | 3300046526 | Bacteria | 2437 |
| 403 | Ga0495652_0007377 | 3300046529 | Bacteria | 10136 |
| 404 | Ga0495654_0000179 | 3300046530 | Bacteria | 62287 |
| 405 | Ga0495654_0002585 | 3300046530 | Bacteria | 11561 |
| 406 | Ga0495654_0004579 | 3300046530 | Bacteria | 8167 |
| 407 | Ga0495654_0007597 | 3300046530 | Bacteria | 6041 |
| 408 | Ga0495654_0010116 | 3300046530 | Bacteria | 5145 |
| 409 | Ga0495654_0049717 | 3300046530 | Bacteria | 2052 |
| 410 | Ga0495654_0059994 | 3300046530 | Bacteria | 1829 |
| 411 | Ga0495609_0000011 | 3300046538 | Bacteria | 334377 |
| 412 | Ga0495609_0000012 | 3300046538 | Bacteria | 333994 |
| 413 | Ga0495609_0000145 | 3300046538 | Bacteria | 73765 |
| 414 | Ga0495609_0004096 | 3300046538 | Bacteria | 8110 |
| 415 | Ga0495609_0006406 | 3300046538 | Bacteria | 6009 |
| 416 | Ga0495597_0000004 | 3300046542 | Bacteria | 307496 |
| 417 | Ga0495597_0003740 | 3300046542 | Bacteria | 8677 |
| 418 | Ga0495645_0108653 | 3300046543 | Bacteria | 1964 |
| 419 | Ga0495645_0130468 | 3300046543 | Bacteria | 1762 |
| 420 | Ga0495622_0004276 | 3300046557 | Bacteria | 6646 |
| 421 | Ga0495622_0072380 | 3300046557 | Bacteria | 1590 |
| 422 | Ga0495622_0114117 | 3300046557 | Bacteria | 1236 |
| 423 | Ga0495633_0000016 | 3300046558 | Bacteria | 250457 |
| 424 | Ga0495633_0000367 | 3300046558 | Bacteria | 48597 |
| 425 | Ga0495633_0009020 | 3300046558 | Bacteria | 5548 |
| 426 | Ga0495667_0379601 | 3300046559 | Bacteria | 891 |
| 427 | Ga0495668_0050878 | 3300046616 | Bacteria | 2295 |
| 428 | Ga0495668_0082153 | 3300046616 | Bacteria | 1767 |
| 429 | Ga0495634_0077027 | 3300046642 | Bacteria | 2188 |
| 430 | Ga0495611_0001082 | 3300046648 | Bacteria | 14368 |
| 431 | Ga0495611_0001380 | 3300046648 | Bacteria | 12184 |
| 432 | Ga0495611_0055885 | 3300046648 | Bacteria | 1786 |
| 433 | Ga0495625_0000010 | 3300046660 | Bacteria | 381775 |
| 434 | Ga0495625_0000108 | 3300046660 | Bacteria | 125604 |
| 435 | Ga0495635_0032032 | 3300046663 | Bacteria | 3649 |
| 436 | Ga0495661_0000004 | 3300046665 | Bacteria | 555340 |
| 437 | Ga0495661_0000010 | 3300046665 | Bacteria | 284261 |
| 438 | Ga0495661_0000018 | 3300046665 | Bacteria | 200787 |
| 439 | Ga0495661_0000020 | 3300046665 | Bacteria | 196901 |
| 440 | Ga0495661_0088125 | 3300046665 | Bacteria | 1772 |
| 441 | Ga0495661_0126149 | 3300046665 | Bacteria | 1408 |
| 442 | Ga0495661_0195530 | 3300046665 | Bacteria | 1062 |
| 443 | Ga0495661_0197514 | 3300046665 | Bacteria | 1055 |
| 444 | Ga0495657_0025488 | 3300046675 | Bacteria | 4198 |
| 445 | Ga0495599_0012638 | 3300046678 | Bacteria | 5206 |
| 446 | Ga0495623_0006756 | 3300046679 | Bacteria | 7466 |
| 447 | Ga0495646_0001802 | 3300046680 | Bacteria | 12853 |
| 448 | Ga0495658_0014570 | 3300046683 | Bacteria | 4021 |
| 449 | Ga0495624_0010937 | 3300046690 | Bacteria | 6254 |
| 450 | Ga0495670_0012175 | 3300046691 | Bacteria | 4230 |
| 451 | Ga0495671_0001070 | 3300046692 | Bacteria | 18925 |
| 452 | Ga0495671_0001369 | 3300046692 | Bacteria | 16544 |
| 453 | Ga0495671_0007179 | 3300046692 | Bacteria | 6374 |
| 454 | Ga0495671_0044115 | 3300046692 | Bacteria | 2236 |
| 455 | Ga0495649_0000027 | 3300046694 | Bacteria | 164157 |
| 456 | Ga0495649_0000083 | 3300046694 | Bacteria | 81883 |
| 457 | Ga0495649_0019663 | 3300046694 | Bacteria | 3793 |
| 458 | Ga0495649_0040948 | 3300046694 | Bacteria | 2534 |
| 459 | Ga0495589_0000002 | 3300046794 | Bacteria | 758846 |
| 460 | Ga0495589_0001428 | 3300046794 | Bacteria | 13797 |
| 461 | Ga0495600_0005526 | 3300046809 | Bacteria | 7626 |
| 462 | Ga0495660_0000004 | 3300046810 | Bacteria | 1003183 |
| 463 | Ga0495660_0000020 | 3300046810 | Bacteria | 304768 |
| 464 | Ga0495660_0000454 | 3300046810 | Bacteria | 34113 |
| 465 | Ga0495660_0000637 | 3300046810 | Bacteria | 27250 |
| 466 | Ga0495660_0007375 | 3300046810 | Bacteria | 6458 |
| 467 | Ga0495660_0031802 | 3300046810 | Bacteria | 2965 |
| 468 | Ga0495660_0087172 | 3300046810 | Bacteria | 1628 |
| 469 | Ga0495604_0013783 | 3300047317 | Bacteria | 6445 |
| 470 | Ga0495604_0034528 | 3300047317 | Bacteria | 4000 |
| 471 | Ga0495672_0000011 | 3300047320 | Bacteria | 535362 |
| 472 | Ga0495672_0003150 | 3300047320 | Bacteria | 14359 |
| 473 | Ga0495672_0007746 | 3300047320 | Bacteria | 8038 |
| 474 | Ga0495672_0016420 | 3300047320 | Bacteria | 4989 |
| 475 | Ga0495672_0036521 | 3300047320 | Bacteria | 3016 |
| 476 | Ga0495672_0061562 | 3300047320 | Bacteria | 2163 |
| 477 | Ga0495672_0069236 | 3300047320 | Bacteria | 2004 |
| 478 | Ga0495672_0111424 | 3300047320 | Bacteria | 1468 |
| 479 | Ga0495676_0000002 | 3300047321 | Bacteria | 373918 |
| 480 | Ga0495683_0000019 | 3300047323 | Bacteria | 183206 |
| 481 | Ga0495683_0000063 | 3300047323 | Bacteria | 113542 |
| 482 | Ga0495683_0000416 | 3300047323 | Bacteria | 34093 |
| 483 | Ga0495683_0042954 | 3300047323 | Bacteria | 2277 |
| 484 | Ga0495683_0092068 | 3300047323 | Bacteria | 1467 |
| 485 | Ga0495687_000579 | 3300047443 | Bacteria | 42952 |
| 486 | Ga0495679_000165 | 3300047446 | Bacteria | 59805 |
| 487 | Ga0495679_000322 | 3300047446 | Bacteria | 38037 |
| 488 | Ga0495673_0000020 | 3300047469 | Bacteria | 548327 |
| 489 | Ga0495673_0000183 | 3300047469 | Bacteria | 101083 |
| 490 | Ga0495673_0000758 | 3300047469 | Bacteria | 30622 |
| 491 | Ga0495673_0001862 | 3300047469 | Bacteria | 15831 |
| 492 | Ga0495673_0004738 | 3300047469 | Bacteria | 8437 |
| 493 | Ga0495673_0010447 | 3300047469 | Bacteria | 5047 |
| 494 | Ga0495673_0014825 | 3300047469 | Bacteria | 4039 |
| 495 | Ga0495673_0019900 | 3300047469 | Bacteria | 3353 |
| 496 | Ga0495673_0022461 | 3300047469 | Bacteria | 3091 |
| 497 | Ga0495673_0055276 | 3300047469 | Bacteria | 1722 |
| 498 | Ga0495673_0062263 | 3300047469 | Bacteria | 1594 |
| 499 | Ga0495673_0089134 | 3300047469 | Bacteria | 1263 |
| 500 | Ga0495681_0000538 | 3300047470 | Bacteria | 29051 |
| 501 | Ga0495681_0001151 | 3300047470 | Bacteria | 20032 |
| 502 | Ga0495681_0050837 | 3300047470 | Bacteria | 1951 |
| 503 | Ga0495686_0055630 | 3300047472 | Bacteria | 2473 |
| 504 | Ga0495686_0142909 | 3300047472 | Bacteria | 1411 |
| 505 | Ga0495602_0025284 | 3300048088 | Bacteria | 5747 |
| 506 | Ga0495626_0000007 | 3300048091 | Bacteria | 276374 |
| 507 | Ga0495626_0000897 | 3300048091 | Bacteria | 26379 |
| 508 | Ga0495626_0039485 | 3300048091 | Bacteria | 2234 |
| 509 | Ga0496102_0782102 | 3300048905 | Bacteria | 877 |
| 510 | Ga0496104_0001712 | 3300048907 | Bacteria | 18944 |
| 511 | Ga0496110_0052219 | 3300048913 | Bacteria | 3593 |
| 512 | Ga0496111_0388315 | 3300048914 | Bacteria | 1032 |
| 513 | Ga0496113_0333225 | 3300048916 | Bacteria | 1217 |
| 514 | Ga0496116_0000023 | 3300048919 | Bacteria | 475792 |
| 515 | Ga0496116_0000083 | 3300048919 | Bacteria | 220955 |
| 516 | Ga0496116_0026142 | 3300048919 | Bacteria | 4275 |
| 517 | Ga0496117_0000463 | 3300048920 | Bacteria | 67832 |
| 518 | Ga0496117_0003404 | 3300048920 | Bacteria | 18517 |
| 519 | Ga0496117_0010690 | 3300048920 | Bacteria | 8307 |
| 520 | Ga0496117_0061188 | 3300048920 | Bacteria | 2590 |
| 521 | Ga0496117_0068768 | 3300048920 | Bacteria | 2389 |
| 522 | Ga0496117_0165761 | 3300048920 | Bacteria | 1289 |
| 523 | Ga0496118_0001450 | 3300048921 | Bacteria | 35711 |
| 524 | Ga0496118_0008485 | 3300048921 | Bacteria | 10608 |
| 525 | Ga0496118_0065412 | 3300048921 | Bacteria | 2661 |
| 526 | Ga0496118_0129287 | 3300048921 | Bacteria | 1626 |
| 527 | Ga0496119_0006664 | 3300048922 | Bacteria | 10622 |
| 528 | Ga0496119_0007198 | 3300048922 | Bacteria | 10077 |
| 529 | Ga0496119_0010183 | 3300048922 | Bacteria | 7938 |
| 530 | Ga0496119_0108605 | 3300048922 | Bacteria | 1544 |
| 531 | Ga0496120_0000052 | 3300048923 | Bacteria | 186071 |
| 532 | Ga0496120_0001403 | 3300048923 | Bacteria | 29166 |
| 533 | Ga0496120_0006927 | 3300048923 | Bacteria | 8551 |
| 534 | Ga0496120_0063720 | 3300048923 | Bacteria | 2050 |
| 535 | Ga0496121_0000824 | 3300048924 | Bacteria | 56559 |
| 536 | Ga0496121_0003602 | 3300048924 | Bacteria | 21867 |
| 537 | Ga0496121_0116803 | 3300048924 | Bacteria | 2023 |
| 538 | Ga0496122_0000135 | 3300048925 | Bacteria | 170955 |
| 539 | Ga0496122_0000146 | 3300048925 | Bacteria | 165614 |
| 540 | Ga0496122_0000167 | 3300048925 | Bacteria | 157130 |
| 541 | Ga0496122_0004158 | 3300048925 | Bacteria | 18262 |
| 542 | Ga0496122_0107291 | 3300048925 | Bacteria | 1846 |
| 543 | Ga0496123_0000004 | 3300048926 | Bacteria | 777230 |
| 544 | Ga0496123_0000127 | 3300048926 | Bacteria | 154927 |
| 545 | Ga0496123_0000475 | 3300048926 | Bacteria | 69749 |
| 546 | Ga0496123_0003312 | 3300048926 | Bacteria | 18247 |
| 547 | Ga0496123_0055389 | 3300048926 | Bacteria | 2602 |
| 548 | Ga0496124_0000017 | 3300048927 | Bacteria | 444389 |
| 549 | Ga0496124_0000140 | 3300048927 | Bacteria | 149743 |
| 550 | Ga0496124_0000292 | 3300048927 | Bacteria | 94018 |
| 551 | Ga0496124_0001314 | 3300048927 | Bacteria | 37530 |
| 552 | Ga0496124_0010375 | 3300048927 | Bacteria | 9441 |
| 553 | Ga0496124_0012407 | 3300048927 | Bacteria | 8414 |
| 554 | Ga0496124_0163452 | 3300048927 | Bacteria | 1733 |
| 555 | Ga0496125_0000131 | 3300048928 | Bacteria | 162607 |
| 556 | Ga0496125_0000195 | 3300048928 | Bacteria | 129495 |
| 557 | Ga0496125_0000896 | 3300048928 | Bacteria | 47203 |
| 558 | Ga0496125_0021687 | 3300048928 | Bacteria | 5980 |
| 559 | Ga0496125_0099143 | 3300048928 | Bacteria | 2153 |
| 560 | Ga0496126_0000300 | 3300048929 | Bacteria | 105128 |
| 561 | Ga0496126_0001270 | 3300048929 | Bacteria | 40566 |
| 562 | Ga0495678_000036 | 3300049459 | Bacteria | 198018 |
| 563 | Ga0495678_000120 | 3300049459 | Bacteria | 91473 |
| 564 | Ga0495678_001857 | 3300049459 | Bacteria | 15449 |
| 565 | Ga0495678_002399 | 3300049459 | Bacteria | 12794 |
| 566 | Ga0495678_005571 | 3300049459 | Bacteria | 6899 |
| 567 | Ga0495678_044875 | 3300049459 | Bacteria | 1746 |
| 568 | Ga0495678_061852 | 3300049459 | Bacteria | 1403 |
| 569 | Ga0495682_0000005 | 3300049460 | Bacteria | 360387 |
| 570 | Ga0495682_0000241 | 3300049460 | Bacteria | 43383 |
| 571 | Ga0495682_0001417 | 3300049460 | Bacteria | 13008 |
| 572 | Ga0495682_0003494 | 3300049460 | Bacteria | 6983 |
| 573 | Ga0501039_0500586 | 3300049575 | Bacteria | 954 |
| 574 | Ga0501035_0604652 | 3300049822 | Bacteria | 893 |
| 575 | nmdc:mga00v17_83208_c1 | 3300050491 | Bacteria | 2001 |
| 576 | nmdc:mga0n895_311442_c1 | 3300050512 | Bacteria | 1595 |
| 577 | nmdc:mga0n895_878473_c1 | 3300050512 | Bacteria | 883 |
| 578 | Ga0495601_0009822 | 3300053077 | Bacteria | 5662 |
| 579 | Ga0500555_003816 | 3300053103 | Bacteria | 4290 |
| 580 | Ga0500618_001248 | 3300053125 | Bacteria | 11889 |
| 581 | Ga0500621_000017 | 3300053126 | Bacteria | 87111 |
| 582 | Ga0500574_003638 | 3300053141 | Bacteria | 2760 |
| 583 | Ga0500616_0074678 | 3300053153 | Bacteria | 1718 |
| 584 | Ga0500636_0008414 | 3300053177 | Bacteria | 5983 |
| 585 | 2506577533 | 2506520007 | Bacteria | 5442880 |
| 586 | 2506582671 | 2506520008 | Bacteria | 5443009 |
| 587 | 2510136388 | 2510065019 | Bacteria | 6903379 |
| 588 | 2511252247 | 2511231003 | Bacteria | 5606035 |
| 589 | 2513568682 | 2513237084 | Bacteria | 7231967 |
| 590 | 2513574457 | 2513237085 | Bacteria | 7695351 |
| 591 | 2553005414 | 2551306416 | Bacteria | 6152985 |
| 592 | 2555261202 | 2554235234 | Bacteria | 5762085 |
| 593 | 2585829745 | 2585427591 | Bacteria | 5482980 |
| 594 | 2585835247 | 2585427592 | Bacteria | 5370892 |
| 595 | 2599330506 | 2599185155 | Bacteria | 5827168 |
| 596 | 2599612201 | 2599185212 | Bacteria | 6765997 |
| 597 | 2599932389 | 2599185300 | Bacteria | 6062622 |
| 598 | 2599970765 | 2599185307 | Bacteria | 6194719 |
| 599 | 2599993103 | 2599185311 | Bacteria | 6354990 |
| 600 | 2600022891 | 2599185316 | Bacteria | 6320029 |
| 601 | 2600028968 | 2599185317 | Bacteria | 6435722 |
| 602 | 2600036724 | 2599185318 | Bacteria | 6961590 |
| 603 | 2600043033 | 2599185319 | Bacteria | 6637840 |
| 604 | 2600057989 | 2599185322 | Bacteria | 6763055 |
| 605 | 2600066319 | 2599185323 | Bacteria | 6688755 |
| 606 | 2600076259 | 2599185325 | Bacteria | 6324919 |
| 607 | 2600358135 | 2600254930 | Bacteria | 6431253 |
| 608 | 2601625072 | 2600255283 | Bacteria | 6061572 |
| 609 | 2656277421 | 2654587920 | Bacteria | 5475511 |
| 610 | 2656279128 | 2654587920 | Bacteria | 5475511 |
| 611 | 2671106985 | 2667528173 | Bacteria | 5375747 |
| 612 | 2671130254 | 2667528176 | Bacteria | 6724917 |
| 613 | 2689444012 | 2687453601 | Bacteria | 5546041 |
| 614 | 2715751410 | 2713897148 | Bacteria | 5883533 |
| 615 | 2738688658 | 2738541271 | Bacteria | 5657310 |
| 616 | 2738744476 | 2738541281 | Bacteria | 5112672 |
| 617 | 2739261439 | 2738543015 | Bacteria | 6750701 |
| 618 | 2739265030 | 2738543016 | Bacteria | 5657564 |
| 619 | 2739353706 | 2738543032 | Bacteria | 5115625 |
| 620 | 2765568344 | 2765235838 | Bacteria | 5445269 |
| 621 | 2774131990 | 2773857672 | Bacteria | 4993178 |
| 622 | 2806061259 | 2802429635 | Bacteria | 7650140 |
| 623 | 2806065677 | 2802429636 | Bacteria | 7597525 |
| 624 | 2807179568 | 2806310673 | Bacteria | 4801221 |
| 625 | 2808979829 | 2808606385 | Bacteria | 6711065 |
| 626 | 2808995549 | 2808606388 | Bacteria | 6706662 |
| 627 | 2819541971 | 2818991436 | Bacteria | 5376622 |
| 628 | 2819594450 | 2818991445 | Bacteria | 4955017 |
| 629 | 2819617780 | 2818991449 | Bacteria | 5518009 |
| 630 | 2826585216 | 2826581358 | Bacteria | 5963467 |
| 631 | 2839094766 | 2839094727 | Bacteria | 5534556 |
| 632 | 2842700068 | 2842698319 | Bacteria | 5190321 |
| 633 | 2842818824 | 2842815866 | Bacteria | 5947510 |
| 634 | 2842834971 | 2842832357 | Bacteria | 5959113 |
| 635 | 2842853582 | 2842849001 | Bacteria | 5924277 |
| 636 | 2842858544 | 2842854478 | Bacteria | 6143501 |
| 637 | 2852614606 | 2852612431 | Bacteria | 6885235 |
| 638 | 2852667656 | 2852667396 | Bacteria | 6885555 |
| 639 | 2855736457 | 2855730933 | Bacteria | 7047938 |
| 640 | 2855773394 | 2855767633 | Bacteria | 7049357 |
| 641 | 2869553387 | 2869551831 | Bacteria | 5474685 |
| 642 | 2884814170 | 2884811622 | Bacteria | 5552861 |
| 643 | 2884840874 | 2884836552 | Bacteria | 5219991 |
| 644 | 2884857530 | 2884852848 | Bacteria | 5221161 |
| 645 | 2888368061 | 2888366609 | Bacteria | 5155009 |
| 646 | 2896158470 | 2896154374 | Bacteria | 5221518 |
| 647 | 2904440039 | 2904439833 | Bacteria | 5931679 |
| 648 | 2904475910 | 2904474040 | Bacteria | 5504324 |
| 649 | 2904505349 | 2904504865 | Bacteria | 5152820 |
| 650 | 2904531010 | 2904530477 | Bacteria | 5876334 |
| 651 | 2904587344 | 2904584206 | Bacteria | 6028872 |
| 652 | 2904592621 | 2904589729 | Bacteria | 6113573 |
| 653 | 2904604597 | 2904601388 | Bacteria | 5884906 |
| 654 | 2919047263 | 2919046199 | Bacteria | 5567169 |
| 655 | 2919082418 | 2919079590 | Bacteria | 5946433 |
| 656 | 2919111346 | 2919108558 | Bacteria | 5897419 |
| 657 | 2919128711 | 2919125081 | Bacteria | 5385106 |
| 658 | 2919152079 | 2919150387 | Bacteria | 5500879 |
| 659 | 2919482282 | 2919481497 | Bacteria | 6907839 |
| 660 | 2919489222 | 2919487758 | Bacteria | 5929766 |
| 661 | 2923515894 | 2923510766 | Bacteria | 5926163 |
| 662 | 2923588491 | 2923586266 | Bacteria | 6565975 |
| 663 | 2927144748 | 2927143783 | Bacteria | 5504251 |
| 664 | 2928133341 | 2928130867 | Bacteria | 5467269 |
| 665 | 2931375443 | 2931369376 | Bacteria | 6847892 |
| 666 | 2969307727 | 2969304461 | Bacteria | 6601805 |
| 667 | 2971822809 | 2971820967 | Bacteria | 5823634 |
| 668 | 2974291065 | 2974289157 | Bacteria | 6080362 |
| 669 | 2984503523 | 2984499530 | Bacteria | 5020881 |
| 670 | 640937027 | 640753048 | Bacteria | 5495657 |
| 671 | 8002060801 | 8002060224 | Bacteria | 4026565 |
| 672 | 8015394875 | 8015394850 | Bacteria | 5064660 |
| 673 | 8018154112 | 8018150411 | Bacteria | 5549903 |
| 674 | 8056168518 | 8056166840 | Bacteria | 5820959 |
| 675 | Ga0495650_0000018 | |||
| 676 | SwRhRL2b_contig_2097597 | |||
| 677 | SwRhRL2b_contig_2326806 | |||
| 678 | MRS1b_contig_117389 | |||
| 679 | JGI25155J39150_1000511 | |||
| 680 | JGI25156J39149_1000320 | |||
| 681 | JGI25156J39149_1009833 | |||
| 682 | JGI25162J39368_1000002 | |||
| 683 | JGI25162J39368_1000079 | |||
| 684 | JGI25154J39366_1000264 | |||
| 685 | JGI25154J39366_1000967 | |||
| 686 | JGI25157J39369_1001592 | |||
| 687 | JGI25163J39215_1000003 | |||
| 688 | JGI25164J39214_1000041 | |||
| 689 | JGI25165J46597_1000135 | |||
| 690 | rootH1_10015053 | |||
| 691 | Ga0055538_1000003 | |||
| 692 | Ga0055538_1000055 | |||
| 693 | Ga0055539_1000003 | |||
| 694 | Ga0055539_1000080 | |||
| 695 | Ga0055539_1000390 | |||
| 696 | Ga0055533_1000005 | |||
| 697 | Ga0055533_1000086 | |||
| 698 | Ga0055533_1000382 | |||
| 699 | Ga0055532_1000089 | |||
| 700 | Ga0055525_1000005 | |||
| 701 | Ga0055525_1000114 | |||
| 702 | Ga0055525_1000545 | |||
| 703 | Ga0055535_1013818 | |||
| 704 | Ga0055536_1000072 | |||
| 705 | Ga0055530_10000016 | |||
| 706 | Ga0055540_1000048 | |||
| 707 | Ga0055541_1000003 | |||
| 708 | Ga0055541_1000057 | |||
| 709 | Ga0055541_1000276 | |||
| 710 | Ga0065704_10000133 | |||
| 711 | Ga0065704_10070340 | |||
| 712 | Ga0065712_10068515 | |||
| 713 | Ga0065715_10127867 | |||
| 714 | Ga0065715_10161229 | |||
| 715 | Ga0070676_10070085 | |||
| 716 | Ga0070690_100022014 | |||
| 717 | Ga0070670_100000436 | |||
| 718 | Ga0070670_100010016 | |||
| 719 | Ga0070670_100131249 | |||
| 720 | Ga0070677_10011729 | |||
| 721 | Ga0070666_10087490 | |||
| 722 | Ga0070689_100002776 | |||
| 723 | Ga0070671_100044427 | |||
| 724 | Ga0070688_100057321 | |||
| 725 | Ga0070667_100051168 | |||
| 726 | Ga0070709_10285931 | |||
| 727 | Ga0070700_100040185 | |||
| 728 | Ga0070662_100128236 | |||
| 729 | Ga0070681_10018458 | |||
| 730 | Ga0070706_100055789 | |||
| 731 | Ga0070707_100187918 | |||
| 732 | Ga0070699_100666240 | |||
| 733 | Ga0070672_100029387 | |||
| 734 | Ga0070665_100166334 | |||
| 735 | Ga0068855_100000037 | |||
| 736 | Ga0068855_100032073 | |||
| 737 | Ga0068854_100006645 | |||
| 738 | Ga0068856_100027730 | |||
| 739 | Ga0070702_100022041 | |||
| 740 | Ga0068852_100002544 | |||
| 741 | Ga0068870_10157525 | |||
| 742 | Ga0068858_100054240 | |||
| 743 | Ga0068860_100139725 | |||
| 744 | Ga0081455_10000453 | |||
| 745 | Ga0081455_10026391 | |||
| 746 | Ga0070717_10060480 | |||
| 747 | Ga0075434_100122072 | |||
| 748 | Ga0075434_100332867 | |||
| 749 | Ga0075434_100995172 | |||
| 750 | Ga0068865_100289272 | |||
| 751 | Ga0105251_10000016 | |||
| 752 | Ga0105251_10000119 | |||
| 753 | Ga0105251_10003359 | |||
| 754 | Ga0105251_10011487 | |||
| 755 | Ga0105251_10082218 | |||
| 756 | Ga0105251_10110851 | |||
| 757 | Ga0105244_10000190 | |||
| 758 | Ga0105244_10000216 | |||
| 759 | Ga0105244_10000425 | |||
| 760 | Ga0105244_10000450 | |||
| 761 | Ga0105244_10077183 | |||
| 762 | Ga0105250_10000003 | |||
| 763 | Ga0105250_10000265 | |||
| 764 | Ga0105250_10001281 | |||
| 765 | Ga0105240_10001596 | |||
| 766 | Ga0105240_10029133 | |||
| 767 | Ga0105240_10534087 | |||
| 768 | Ga0105240_11173564 | |||
| 769 | Ga0111539_10146112 | |||
| 770 | Ga0105247_10000103 | |||
| 771 | Ga0105243_10005208 | |||
| 772 | Ga0105243_10152383 | |||
| 773 | Ga0105241_10000004 | |||
| 774 | Ga0105242_10045416 | |||
| 775 | Ga0105248_10526428 | |||
| 776 | Ga0105238_10001958 | |||
| 777 | Ga0105238_10004012 | |||
| 778 | Ga0105238_10053378 | |||
| 779 | Ga0105239_10016513 | |||
| 780 | Ga0105246_10037197 | |||
| 781 | Ga0157373_10002585 | |||
| 782 | Ga0157373_10055607 | |||
| 783 | Ga0157371_10001449 | |||
| 784 | Ga0157371_10003951 | |||
| 785 | Ga0157370_10001398 | |||
| 786 | Ga0157370_10003497 | |||
| 787 | Ga0157370_10500792 | |||
| 788 | Ga0157369_10045584 | |||
| 789 | Ga0157378_10052710 | |||
| 790 | Ga0157378_10737134 | |||
| 791 | Ga0163162_10024709 | |||
| 792 | Ga0157372_10894500 | |||
| 793 | Ga0163163_10442330 | |||
| 794 | Ga0157380_10007892 | |||
| 795 | Ga0182008_10006908 | |||
| 796 | Ga0182008_10007128 | |||
| 797 | Ga0182008_10022934 | |||
| 798 | Ga0182008_10048041 | |||
| 799 | Ga0157377_10358254 | |||
| 800 | Ga0157379_10029779 | |||
| 801 | Ga0157376_10670611 | |||
| 802 | Ga0182006_1002060 | |||
| 803 | Ga0182006_1021259 | |||
| 804 | Ga0182006_1023940 | |||
| 805 | Ga0182006_1046082 | |||
| 806 | Ga0182007_10000471 | |||
| 807 | Ga0182007_10003572 | |||
| 808 | Ga0182007_10004652 | |||
| 809 | Ga0182007_10026824 | |||
| 810 | Ga0182005_1000151 | |||
| 811 | Ga0182005_1000341 | |||
| 812 | Ga0182005_1018141 | |||
| 813 | Ga0163161_10000001 | |||
| 814 | Ga0213872_10000360 | |||
| 815 | Ga0213872_10005698 | |||
| 816 | Ga0213875_10014875 | |||
| 817 | Ga0209435_100109 | |||
| 818 | Ga0209435_100890 | |||
| 819 | Ga0209760_100002 | |||
| 820 | Ga0209760_101315 | |||
| 821 | Ga0209784_100001 | |||
| 822 | Ga0209784_100010 | |||
| 823 | Ga0209784_100018 | |||
| 824 | Ga0209566_100001 | |||
| 825 | Ga0209566_100008 | |||
| 826 | Ga0209566_100016 | |||
| 827 | Ga0209674_100002 | |||
| 828 | Ga0209674_100019 | |||
| 829 | Ga0209674_100030 | |||
| 830 | Ga0209147_100060 | |||
| 831 | Ga0209563_100002 | |||
| 832 | Ga0209563_100021 | |||
| 833 | Ga0209563_100034 | |||
| 834 | Ga0207427_100009 | |||
| 835 | Ga0207427_100232 | |||
| 836 | Ga0209437_100001 | |||
| 837 | Ga0209437_100019 | |||
| 838 | Ga0209437_100081 | |||
| 839 | Ga0209258_100141 | |||
| 840 | Ga0209646_1000101 | |||
| 841 | Ga0209646_1000176 | |||
| 842 | Ga0209026_1000264 | |||
| 843 | Ga0209026_1008395 | |||
| 844 | Ga0209677_100002 | |||
| 845 | Ga0209677_100011 | |||
| 846 | Ga0209677_100019 | |||
| 847 | Ga0209759_1000264 | |||
| 848 | Ga0209759_1000296 | |||
| 849 | Ga0209233_1000025 | |||
| 850 | Ga0209233_1002373 | |||
| 851 | Ga0209455_1007786 | |||
| 852 | Ga0209676_1000020 | |||
| 853 | Ga0209676_1002238 | |||
| 854 | Ga0209050_1000013 | |||
| 855 | Ga0209051_1000007 | |||
| 856 | Ga0209257_1002079 | |||
| 857 | Ga0207697_10009917 | |||
| 858 | Ga0207656_10092937 | |||
| 859 | Ga0207696_1000001 | |||
| 860 | Ga0207696_1000004 | |||
| 861 | Ga0207696_1000169 | |||
| 862 | Ga0207655_1000011 | |||
| 863 | Ga0207655_1000149 | |||
| 864 | Ga0207655_1001337 | |||
| 865 | Ga0207655_1002650 | |||
| 866 | Ga0207655_1037529 | |||
| 867 | Ga0207713_1000024 | |||
| 868 | Ga0207713_1000026 | |||
| 869 | Ga0207713_1000027 | |||
| 870 | Ga0207713_1000060 | |||
| 871 | Ga0207713_1002927 | |||
| 872 | Ga0207713_1034337 | |||
| 873 | Ga0207713_1075990 | |||
| 874 | Ga0207642_10002399 | |||
| 875 | Ga0207710_10000140 | |||
| 876 | Ga0207688_10047958 | |||
| 877 | Ga0207645_10005429 | |||
| 878 | Ga0207643_10054002 | |||
| 879 | Ga0207684_10134450 | |||
| 880 | Ga0207654_10000006 | |||
| 881 | Ga0207695_10000719 | |||
| 882 | Ga0207695_10003386 | |||
| 883 | Ga0207695_10038779 | |||
| 884 | Ga0207695_10814049 | |||
| 885 | Ga0207695_10827877 | |||
| 886 | Ga0207671_10014094 | |||
| 887 | Ga0207660_10184503 | |||
| 888 | Ga0207662_10012698 | |||
| 889 | Ga0207694_10000147 | |||
| 890 | Ga0207694_10003504 | |||
| 891 | Ga0207650_10000426 | |||
| 892 | Ga0207650_10008535 | |||
| 893 | Ga0207659_10098983 | |||
| 894 | Ga0207644_10104930 | |||
| 895 | Ga0207706_10143923 | |||
| 896 | Ga0207686_10292086 | |||
| 897 | Ga0207709_10022089 | |||
| 898 | Ga0207709_10102116 | |||
| 899 | Ga0207669_10026605 | |||
| 900 | Ga0207704_10133532 | |||
| 901 | Ga0207711_10283285 | |||
| 902 | Ga0207689_10091514 | |||
| 903 | Ga0207679_10329748 | |||
| 904 | Ga0207667_10000053 | |||
| 905 | Ga0207667_10014432 | |||
| 906 | Ga0207668_10088515 | |||
| 907 | Ga0207708_10007364 | |||
| 908 | Ga0207702_10012304 | |||
| 909 | Ga0207641_10014333 | |||
| 910 | Ga0207648_10006414 | |||
| 911 | Ga0207676_10106490 | |||
| 912 | Ga0207675_100048538 | |||
| 913 | Ga0207683_10132331 | |||
| 914 | Ga0207698_10003252 | |||
| 915 | Ga0207698_10503972 | |||
| 916 | Ga0209281_1000008 | |||
| 917 | Ga0209281_1001466 | |||
| 918 | Ga0209371_1000348 | |||
| 919 | Ga0307515_10000040 | |||
| 920 | Ga0307515_10031174 | |||
| 921 | Ga0268256_1000134 | |||
| 922 | Ga0265328_10000378 | |||
| 923 | Ga0265328_10006693 | |||
| 924 | Ga0265320_10060938 | |||
| 925 | Ga0265329_10005220 | |||
| 926 | Ga0265331_10008145 | |||
| 927 | Ga0265316_10044913 | |||
| 928 | Ga0265314_10004765 | |||
| 929 | Ga0307405_10140607 | |||
| 930 | Ga0307405_10257292 | |||
| 931 | Ga0307413_10071959 | |||
| 932 | Ga0307406_10067539 | |||
| 933 | Ga0307407_10060650 | |||
| 934 | Ga0307412_10005141 | |||
| 935 | Ga0307412_10140940 | |||
| 936 | Ga0307409_100538079 | |||
| 937 | Ga0307416_100063453 | |||
| 938 | Ga0307416_100629067 | |||
| 939 | Ga0307411_10007450 | |||
| 940 | Ga0307411_10109452 | |||
| 941 | Ga0436364_0266477 | |||
| 942 | Ga0436364_0714820 | |||
| 943 | Ga0436364_1535370 | |||
| 944 | Ga0436365_0916090 | |||
| 945 | Ga0436361_0376772 | |||
| 946 | Ga0436361_0409139 | |||
| 947 | Ga0436361_0659952 | |||
| 948 | Ga0436363_0254040 | |||
| 949 | Ga0439438_001380 | |||
| 950 | Ga0439447_006742 | |||
| 951 | Ga0439466_0000495 | |||
| 952 | Ga0439466_0028715 | |||
| 953 | Ga0439466_0051780 | |||
| 954 | Ga0439432_014263 | |||
| 955 | Ga0439451_000047 | |||
| 956 | Ga0439451_000377 | |||
| 957 | Ga0439451_002515 | |||
| 958 | Ga0439452_000043 | |||
| 959 | Ga0439452_000605 | |||
| 960 | Ga0439452_001052 | |||
| 961 | Ga0439456_000335 | |||
| 962 | Ga0439456_001538 | |||
| 963 | Ga0439463_000294 | |||
| 964 | Ga0439463_007569 | |||
| 965 | Ga0450911_006623 | |||
| 966 | Ga0450900_000128 | |||
| 967 | Ga0450902_004091 | |||
| 968 | Ga0450904_000487 | |||
| 969 | Ga0450906_000010 | |||
| 970 | Ga0450907_005684 | |||
| 971 | Ga0439460_0000060 | |||
| 972 | Ga0451576_0133593 | |||
| 973 | Ga0495617_000642 | |||
| 974 | Ga0495617_041529 | |||
| 975 | Ga0495627_000018 | |||
| 976 | Ga0495627_000380 | |||
| 977 | Ga0495627_005333 | |||
| 978 | Ga0495627_037220 | |||
| 979 | Ga0495592_0001072 | |||
| 980 | Ga0495603_0002989 | |||
| 981 | Ga0495591_000041 | |||
| 982 | Ga0495591_000189 | |||
| 983 | Ga0495591_000234 | |||
| 984 | Ga0495591_005709 | |||
| 985 | Ga0495591_016739 | |||
| 986 | Ga0495591_024088 | |||
| 987 | Ga0495638_0030846 | |||
| 988 | Ga0495651_0013562 | |||
| 989 | Ga0495653_0001089 | |||
| 990 | Ga0495653_0008898 | |||
| 991 | Ga0495650_0000034 | |||
| 992 | Ga0495650_0000309 | |||
| 993 | Ga0495650_0000780 | |||
| 994 | Ga0495650_0003367 | |||
| 995 | Ga0495650_0024507 | |||
| 996 | Ga0495580_0044817 | |||
| 997 | Ga0495580_0570184 | |||
| 998 | Ga0495605_0000045 | |||
| 999 | Ga0495605_0000090 | |||
| 1000 | Ga0495605_0000124 | |||
| 1001 | Ga0495605_0000589 | |||
| 1002 | Ga0495605_0000705 | |||
| 1003 | Ga0495605_0000722 | |||
| 1004 | Ga0495605_0023604 | |||
| 1005 | Ga0495605_0034801 | |||
| 1006 | Ga0495605_0100361 | |||
| 1007 | Ga0495605_0218911 | |||
| 1008 | Ga0495584_0002628 | |||
| 1009 | Ga0495584_0008800 | |||
| 1010 | Ga0495584_0009488 | |||
| 1011 | Ga0495585_0001433 | |||
| 1012 | Ga0495585_0002260 | |||
| 1013 | Ga0495594_0000711 | |||
| 1014 | Ga0495596_0013213 | |||
| 1015 | Ga0495596_0068391 | |||
| 1016 | Ga0495607_0000070 | |||
| 1017 | Ga0495607_0000106 | |||
| 1018 | Ga0495607_0000284 | |||
| 1019 | Ga0495607_0000369 | |||
| 1020 | Ga0495607_0005884 | |||
| 1021 | Ga0495607_0006909 | |||
| 1022 | Ga0495607_0012639 | |||
| 1023 | Ga0495607_0021888 | |||
| 1024 | Ga0495607_0081953 | |||
| 1025 | Ga0495607_0083646 | |||
| 1026 | Ga0495583_0000101 | |||
| 1027 | Ga0495583_0000765 | |||
| 1028 | Ga0495583_0001353 | |||
| 1029 | Ga0495583_0002114 | |||
| 1030 | Ga0495583_0002459 | |||
| 1031 | Ga0495583_0056234 | |||
| 1032 | Ga0495606_0000042 | |||
| 1033 | Ga0495606_0000081 | |||
| 1034 | Ga0495606_0000098 | |||
| 1035 | Ga0495606_0000410 | |||
| 1036 | Ga0495606_0000529 | |||
| 1037 | Ga0495606_0001296 | |||
| 1038 | Ga0495606_0003477 | |||
| 1039 | Ga0495606_0063602 | |||
| 1040 | Ga0495606_0097138 | |||
| 1041 | Ga0495608_0001962 | |||
| 1042 | Ga0495610_0012980 | |||
| 1043 | Ga0495616_0046339 | |||
| 1044 | Ga0495618_0003306 | |||
| 1045 | Ga0495620_0000001 | |||
| 1046 | Ga0495620_0001049 | |||
| 1047 | Ga0495620_0001966 | |||
| 1048 | Ga0495620_0049954 | |||
| 1049 | Ga0495628_0001529 | |||
| 1050 | Ga0495631_0001230 | |||
| 1051 | Ga0495631_0001306 | |||
| 1052 | Ga0495631_0005658 | |||
| 1053 | Ga0495631_0009509 | |||
| 1054 | Ga0495631_0032501 | |||
| 1055 | Ga0495631_0094113 | |||
| 1056 | Ga0495632_0002280 | |||
| 1057 | Ga0495632_0016439 | |||
| 1058 | Ga0495632_0041865 | |||
| 1059 | Ga0495632_0055118 | |||
| 1060 | Ga0495637_0000023 | |||
| 1061 | Ga0495637_0000486 | |||
| 1062 | Ga0495637_0001685 | |||
| 1063 | Ga0495637_0005119 | |||
| 1064 | Ga0495637_0014831 | |||
| 1065 | Ga0495637_0055348 | |||
| 1066 | Ga0495637_0067755 | |||
| 1067 | Ga0495643_0000721 | |||
| 1068 | Ga0495643_0019767 | |||
| 1069 | Ga0495643_0058000 | |||
| 1070 | Ga0495643_0092214 | |||
| 1071 | Ga0495644_0000910 | |||
| 1072 | Ga0495644_0002392 | |||
| 1073 | Ga0495648_0003650 | |||
| 1074 | Ga0495648_0004913 | |||
| 1075 | Ga0495648_0010650 | |||
| 1076 | Ga0495666_0035332 | |||
| 1077 | Ga0495652_0007377 | |||
| 1078 | Ga0495654_0000179 | |||
| 1079 | Ga0495654_0002585 | |||
| 1080 | Ga0495654_0004579 | |||
| 1081 | Ga0495654_0007597 | |||
| 1082 | Ga0495654_0010116 | |||
| 1083 | Ga0495654_0049717 | |||
| 1084 | Ga0495654_0059994 | |||
| 1085 | Ga0495609_0000011 | |||
| 1086 | Ga0495609_0000012 | |||
| 1087 | Ga0495609_0000145 | |||
| 1088 | Ga0495609_0004096 | |||
| 1089 | Ga0495609_0006406 | |||
| 1090 | Ga0495597_0000004 | |||
| 1091 | Ga0495597_0003740 | |||
| 1092 | Ga0495645_0108653 | |||
| 1093 | Ga0495645_0130468 | |||
| 1094 | Ga0495622_0004276 | |||
| 1095 | Ga0495622_0072380 | |||
| 1096 | Ga0495622_0114117 | |||
| 1097 | Ga0495633_0000016 | |||
| 1098 | Ga0495633_0000367 | |||
| 1099 | Ga0495633_0009020 | |||
| 1100 | Ga0495667_0379601 | |||
| 1101 | Ga0495668_0050878 | |||
| 1102 | Ga0495668_0082153 | |||
| 1103 | Ga0495634_0077027 | |||
| 1104 | Ga0495611_0001082 | |||
| 1105 | Ga0495611_0001380 | |||
| 1106 | Ga0495611_0055885 | |||
| 1107 | Ga0495625_0000010 | |||
| 1108 | Ga0495625_0000108 | |||
| 1109 | Ga0495635_0032032 | |||
| 1110 | Ga0495661_0000004 | |||
| 1111 | Ga0495661_0000010 | |||
| 1112 | Ga0495661_0000018 | |||
| 1113 | Ga0495661_0000020 | |||
| 1114 | Ga0495661_0088125 | |||
| 1115 | Ga0495661_0126149 | |||
| 1116 | Ga0495661_0195530 | |||
| 1117 | Ga0495661_0197514 | |||
| 1118 | Ga0495657_0025488 | |||
| 1119 | Ga0495599_0012638 | |||
| 1120 | Ga0495623_0006756 | |||
| 1121 | Ga0495646_0001802 | |||
| 1122 | Ga0495658_0014570 | |||
| 1123 | Ga0495624_0010937 | |||
| 1124 | Ga0495670_0012175 | |||
| 1125 | Ga0495671_0001070 | |||
| 1126 | Ga0495671_0001369 | |||
| 1127 | Ga0495671_0007179 | |||
| 1128 | Ga0495671_0044115 | |||
| 1129 | Ga0495649_0000027 | |||
| 1130 | Ga0495649_0000083 | |||
| 1131 | Ga0495649_0019663 | |||
| 1132 | Ga0495649_0040948 | |||
| 1133 | Ga0495589_0000002 | |||
| 1134 | Ga0495589_0001428 | |||
| 1135 | Ga0495600_0005526 | |||
| 1136 | Ga0495660_0000004 | |||
| 1137 | Ga0495660_0000020 | |||
| 1138 | Ga0495660_0000454 | |||
| 1139 | Ga0495660_0000637 | |||
| 1140 | Ga0495660_0007375 | |||
| 1141 | Ga0495660_0031802 | |||
| 1142 | Ga0495660_0087172 | |||
| 1143 | Ga0495604_0013783 | |||
| 1144 | Ga0495604_0034528 | |||
| 1145 | Ga0495672_0000011 | |||
| 1146 | Ga0495672_0003150 | |||
| 1147 | Ga0495672_0007746 | |||
| 1148 | Ga0495672_0016420 | |||
| 1149 | Ga0495672_0036521 | |||
| 1150 | Ga0495672_0061562 | |||
| 1151 | Ga0495672_0069236 | |||
| 1152 | Ga0495672_0111424 | |||
| 1153 | Ga0495676_0000002 | |||
| 1154 | Ga0495683_0000019 | |||
| 1155 | Ga0495683_0000063 | |||
| 1156 | Ga0495683_0000416 | |||
| 1157 | Ga0495683_0042954 | |||
| 1158 | Ga0495683_0092068 | |||
| 1159 | Ga0495687_000579 | |||
| 1160 | Ga0495679_000165 | |||
| 1161 | Ga0495679_000322 | |||
| 1162 | Ga0495673_0000020 | |||
| 1163 | Ga0495673_0000183 | |||
| 1164 | Ga0495673_0000758 | |||
| 1165 | Ga0495673_0001862 | |||
| 1166 | Ga0495673_0004738 | |||
| 1167 | Ga0495673_0010447 | |||
| 1168 | Ga0495673_0014825 | |||
| 1169 | Ga0495673_0019900 | |||
| 1170 | Ga0495673_0022461 | |||
| 1171 | Ga0495673_0055276 | |||
| 1172 | Ga0495673_0062263 | |||
| 1173 | Ga0495673_0089134 | |||
| 1174 | Ga0495681_0000538 | |||
| 1175 | Ga0495681_0001151 | |||
| 1176 | Ga0495681_0050837 | |||
| 1177 | Ga0495686_0055630 | |||
| 1178 | Ga0495686_0142909 | |||
| 1179 | Ga0495602_0025284 | |||
| 1180 | Ga0495626_0000007 | |||
| 1181 | Ga0495626_0000897 | |||
| 1182 | Ga0495626_0039485 | |||
| 1183 | Ga0496102_0782102 | |||
| 1184 | Ga0496104_0001712 | |||
| 1185 | Ga0496110_0052219 | |||
| 1186 | Ga0496111_0388315 | |||
| 1187 | Ga0496113_0333225 | |||
| 1188 | Ga0496116_0000023 | |||
| 1189 | Ga0496116_0000083 | |||
| 1190 | Ga0496116_0026142 | |||
| 1191 | Ga0496117_0000463 | |||
| 1192 | Ga0496117_0003404 | |||
| 1193 | Ga0496117_0010690 | |||
| 1194 | Ga0496117_0061188 | |||
| 1195 | Ga0496117_0068768 | |||
| 1196 | Ga0496117_0165761 | |||
| 1197 | Ga0496118_0001450 | |||
| 1198 | Ga0496118_0008485 | |||
| 1199 | Ga0496118_0065412 | |||
| 1200 | Ga0496118_0129287 | |||
| 1201 | Ga0496119_0006664 | |||
| 1202 | Ga0496119_0007198 | |||
| 1203 | Ga0496119_0010183 | |||
| 1204 | Ga0496119_0108605 | |||
| 1205 | Ga0496120_0000052 | |||
| 1206 | Ga0496120_0001403 | |||
| 1207 | Ga0496120_0006927 | |||
| 1208 | Ga0496120_0063720 | |||
| 1209 | Ga0496121_0000824 | |||
| 1210 | Ga0496121_0003602 | |||
| 1211 | Ga0496121_0116803 | |||
| 1212 | Ga0496122_0000135 | |||
| 1213 | Ga0496122_0000146 | |||
| 1214 | Ga0496122_0000167 | |||
| 1215 | Ga0496122_0004158 | |||
| 1216 | Ga0496122_0107291 | |||
| 1217 | Ga0496123_0000004 | |||
| 1218 | Ga0496123_0000127 | |||
| 1219 | Ga0496123_0000475 | |||
| 1220 | Ga0496123_0003312 | |||
| 1221 | Ga0496123_0055389 | |||
| 1222 | Ga0496124_0000017 | |||
| 1223 | Ga0496124_0000140 | |||
| 1224 | Ga0496124_0000292 | |||
| 1225 | Ga0496124_0001314 | |||
| 1226 | Ga0496124_0010375 | |||
| 1227 | Ga0496124_0012407 | |||
| 1228 | Ga0496124_0163452 | |||
| 1229 | Ga0496125_0000131 | |||
| 1230 | Ga0496125_0000195 | |||
| 1231 | Ga0496125_0000896 | |||
| 1232 | Ga0496125_0021687 | |||
| 1233 | Ga0496125_0099143 | |||
| 1234 | Ga0496126_0000300 | |||
| 1235 | Ga0496126_0001270 | |||
| 1236 | Ga0495678_000036 | |||
| 1237 | Ga0495678_000120 | |||
| 1238 | Ga0495678_001857 | |||
| 1239 | Ga0495678_002399 | |||
| 1240 | Ga0495678_005571 | |||
| 1241 | Ga0495678_044875 | |||
| 1242 | Ga0495678_061852 | |||
| 1243 | Ga0495682_0000005 | |||
| 1244 | Ga0495682_0000241 | |||
| 1245 | Ga0495682_0001417 | |||
| 1246 | Ga0495682_0003494 | |||
| 1247 | Ga0501039_0500586 | |||
| 1248 | Ga0501035_0604652 | |||
| 1249 | nmdc:mga00v17_83208_c1 | |||
| 1250 | nmdc:mga0n895_311442_c1 | |||
| 1251 | nmdc:mga0n895_878473_c1 | |||
| 1252 | Ga0495601_0009822 | |||
| 1253 | Ga0500555_003816 | |||
| 1254 | Ga0500618_001248 | |||
| 1255 | Ga0500621_000017 | |||
| 1256 | Ga0500574_003638 | |||
| 1257 | Ga0500616_0074678 | |||
| 1258 | Ga0500636_0008414 | |||
| 1259 | 2506577533 | |||
| 1260 | 2506582671 | |||
| 1261 | 2510136388 | |||
| 1262 | 2511252247 | |||
| 1263 | 2513568682 | |||
| 1264 | 2513574457 | |||
| 1265 | 2553005414 | |||
| 1266 | 2555261202 | |||
| 1267 | 2585829745 | |||
| 1268 | 2585835247 | |||
| 1269 | 2599330506 | |||
| 1270 | 2599612201 | |||
| 1271 | 2599932389 | |||
| 1272 | 2599970765 | |||
| 1273 | 2599993103 | |||
| 1274 | 2600022891 | |||
| 1275 | 2600028968 | |||
| 1276 | 2600036724 | |||
| 1277 | 2600043033 | |||
| 1278 | 2600057989 | |||
| 1279 | 2600066319 | |||
| 1280 | 2600076259 | |||
| 1281 | 2600358135 | |||
| 1282 | 2601625072 | |||
| 1283 | 2656277421 | |||
| 1284 | 2656279128 | |||
| 1285 | 2671106985 | |||
| 1286 | 2671130254 | |||
| 1287 | 2689444012 | |||
| 1288 | 2715751410 | |||
| 1289 | 2738688658 | |||
| 1290 | 2738744476 | |||
| 1291 | 2739261439 | |||
| 1292 | 2739265030 | |||
| 1293 | 2739353706 | |||
| 1294 | 2765568344 | |||
| 1295 | 2774131990 | |||
| 1296 | 2806061259 | |||
| 1297 | 2806065677 | |||
| 1298 | 2807179568 | |||
| 1299 | 2808979829 | |||
| 1300 | 2808995549 | |||
| 1301 | 2819541971 | |||
| 1302 | 2819594450 | |||
| 1303 | 2819617780 | |||
| 1304 | 2826585216 | |||
| 1305 | 2839094766 | |||
| 1306 | 2842700068 | |||
| 1307 | 2842818824 | |||
| 1308 | 2842834971 | |||
| 1309 | 2842853582 | |||
| 1310 | 2842858544 | |||
| 1311 | 2852614606 | |||
| 1312 | 2852667656 | |||
| 1313 | 2855736457 | |||
| 1314 | 2855773394 | |||
| 1315 | 2869553387 | |||
| 1316 | 2884814170 | |||
| 1317 | 2884840874 | |||
| 1318 | 2884857530 | |||
| 1319 | 2888368061 | |||
| 1320 | 2896158470 | |||
| 1321 | 2904440039 | |||
| 1322 | 2904475910 | |||
| 1323 | 2904505349 | |||
| 1324 | 2904531010 | |||
| 1325 | 2904587344 | |||
| 1326 | 2904592621 | |||
| 1327 | 2904604597 | |||
| 1328 | 2919047263 | |||
| 1329 | 2919082418 | |||
| 1330 | 2919111346 | |||
| 1331 | 2919128711 | |||
| 1332 | 2919152079 | |||
| 1333 | 2919482282 | |||
| 1334 | 2919489222 | |||
| 1335 | 2923515894 | |||
| 1336 | 2923588491 | |||
| 1337 | 2927144748 | |||
| 1338 | 2928133341 | |||
| 1339 | 2931375443 | |||
| 1340 | 2969307727 | |||
| 1341 | 2971822809 | |||
| 1342 | 2974291065 | |||
| 1343 | 2984503523 | |||
| 1344 | 640937027 | |||
| 1345 | 8002060801 | |||
| 1346 | 8015394875 | |||
| 1347 | 8018154112 | |||
| 1348 | 8056168518 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hc2-assembly1.cif.gz_A-2 | crystal structure of chicken sulfite oxidase mutant tyr 322 phe | 0.9021 | 104 | 247 |
| 2a99-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9008 | 104 | 247 |
| 3r18-assembly1.cif.gz_A-2 | chicken sulfite oxidase double mutant with altered activity and substrate affinity | 0.8995 | 104 | 247 |
| 2xts-assembly1.cif.gz_C | crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus | 0.8977 | 104 | 241 |
| 3hbp-assembly1.cif.gz_A-2 | the crystal structure of c185s mutant of recombinant sulfite oxidase with bound substrate, sulfite, at the active site | 0.8971 | 104 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xtsA01 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8976 | 104 | 241 | 3.90.420.10 |
| af_A0A0R4IKF7_192_441_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8777 | 104 | 252 | 3.90.420.10 |
| 2ca4A01 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.849 | 80 | 252 | 3.90.420.10 |
| af_Q54XJ8_10_262_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8429 | 85 | 247 | 3.90.420.10 |
| af_P96400_291_442_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8374 | 93 | 241 | 3.90.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I4SVQ0-F1-model_v4 | Molybdopterin-dependent oxidoreductase | 0.9707 | 110 | 221 |
|
| AF-A0A537TEQ0-F1-model_v4 | Molybdopterin-binding protein | 0.9635 | 79 | 258 |
|
| AF-A0A537S0D7-F1-model_v4 | Molybdopterin-binding protein | 0.9591 | 48 | 258 |
|
| AF-A0A537ALX2-F1-model_v4 | Molybdopterin-binding protein | 0.9537 | 48 | 258 |
|
| AF-A0A537TEQ0-F1-model_v4 | Molybdopterin-binding protein | 0.948 | 79 | 258 |
|