F474394

General Info

Members Datasets Scaffolds Average Seq Length
674 255 1348 155

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0250609|Ga0496115_0250609_738_1286
Length 182
Sequence VGPGRPVDRGEIDFNFAWNEVFMTEAGALEAQISQQIVTAMKARDPERTGTLRLIKAALKNKAIEKIGPLTPAEEQQTLATMIKQRRDSIEQFSKGNRPELAAKEAAEIVLIEEFLPKAMDEAGLRTLVAEVVAAHASASGQKPTPKDMGPVIKAVQARLQASGVRAEGRVVSEAVKAALAG

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
172 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
255 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.3
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 2.23
Rhizosphere 94.51
Stem 0
Stem Tuber 0
Unclassified 19.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0250609 3300048918 Bacteria 1458
2 MBSR1b_contig_9392625 2162886012 Bacteria 862
3 rootH2_10077923 3300003320 Bacteria 1899
4 rootH2_10093198 3300003320 Bacteria 2166
5 Ga0065715_10121466 3300005293 Bacteria 2229
6 Ga0065707_10915442 3300005295 Bacteria 562
7 Ga0070658_10000101 3300005327 Bacteria 75550
8 Ga0070658_10004091 3300005327 Bacteria 11947
9 Ga0070658_10034316 3300005327 Bacteria 4082
10 Ga0070658_10104368 3300005327 Bacteria 2345
11 Ga0070658_10215285 3300005327 Unclassified 1623
12 Ga0070658_10389519 3300005327 Bacteria 1196
13 Ga0070683_100000042 3300005329 Bacteria 115507
14 Ga0070683_100008847 3300005329 Bacteria 8569
15 Ga0070683_100063445 3300005329 Unclassified 3436
16 Ga0070683_100514807 3300005329 Unclassified 1143
17 Ga0070683_100562950 3300005329 Bacteria 1090
18 Ga0070690_100327132 3300005330 Bacteria 1106
19 Ga0070690_100859403 3300005330 Bacteria 707
20 Ga0070670_100000164 3300005331 Bacteria 60394
21 Ga0070670_100133244 3300005331 Unclassified 2146
22 Ga0068869_100017999 3300005334 Bacteria 4802
23 Ga0068869_100093108 3300005334 Unclassified 2270
24 Ga0068869_100093581 3300005334 Bacteria 2265
25 Ga0068869_100697873 3300005334 Unclassified 865
26 Ga0070666_11112018 3300005335 Unclassified 587
27 Ga0070682_100000007 3300005337 Bacteria 346590
28 Ga0070682_100462033 3300005337 Bacteria 975
29 Ga0068868_100000292 3300005338 Bacteria 33672
30 Ga0068868_100003751 3300005338 Bacteria 10613
31 Ga0068868_100048031 3300005338 Bacteria 3347
32 Ga0068868_100094069 3300005338 Bacteria 2417
33 Ga0068868_100188367 3300005338 Bacteria 1715
34 Ga0070689_100122312 3300005340 Bacteria 2079
35 Ga0070689_100404357 3300005340 Bacteria 1155
36 Ga0070689_101367081 3300005340 Bacteria 639
37 Ga0070687_100117245 3300005343 Bacteria 1517
38 Ga0070687_100650751 3300005343 Bacteria 730
39 Ga0070661_100001493 3300005344 Bacteria 16272
40 Ga0070661_100033708 3300005344 Unclassified 3711
41 Ga0070661_100041792 3300005344 Bacteria 3345
42 Ga0070661_100071609 3300005344 Bacteria 2551
43 Ga0070661_100230495 3300005344 Bacteria 1423
44 Ga0070692_10007072 3300005345 Bacteria 4922
45 Ga0070668_100206620 3300005347 Bacteria 1614
46 Ga0070669_101515657 3300005353 Unclassified 583
47 Ga0070675_100000010 3300005354 Bacteria 243396
48 Ga0070675_100598411 3300005354 Bacteria 1000
49 Ga0070675_100788773 3300005354 Unclassified 868
50 Ga0070675_101304375 3300005354 Bacteria 669
51 Ga0070671_100066164 3300005355 Bacteria 3012
52 Ga0070674_100073875 3300005356 Bacteria 2418
53 Ga0070673_100022917 3300005364 Bacteria 4556
54 Ga0070673_100114532 3300005364 Bacteria 2241
55 Ga0070659_100240017 3300005366 Bacteria 1499
56 Ga0070667_100004122 3300005367 Bacteria 12286
57 Ga0070709_10320064 3300005434 Bacteria 1138
58 Ga0070714_100272311 3300005435 Bacteria 1570
59 Ga0070713_100020466 3300005436 Bacteria 5073
60 Ga0070713_100110776 3300005436 Bacteria 2393
61 Ga0070713_100743250 3300005436 Bacteria 938
62 Ga0070713_100966320 3300005436 Bacteria 821
63 Ga0070713_101676251 3300005436 Bacteria 617
64 Ga0070701_10000615 3300005438 Bacteria 12458
65 Ga0070711_100038343 3300005439 Bacteria 3222
66 Ga0070700_100000001 3300005441 Bacteria 346167
67 Ga0070708_100008564 3300005445 Bacteria 8219
68 Ga0070708_100048147 3300005445 Bacteria 3767
69 Ga0070708_100115569 3300005445 Bacteria 2470
70 Ga0070708_100422747 3300005445 Bacteria 1257
71 Ga0070663_100267588 3300005455 Unclassified 1358
72 Ga0070663_100482758 3300005455 Bacteria 1026
73 Ga0070678_100054496 3300005456 Bacteria 2914
74 Ga0070678_101204443 3300005456 Bacteria 702
75 Ga0070678_101685005 3300005456 Unclassified 596
76 Ga0070662_100068938 3300005457 Bacteria 2601
77 Ga0070681_10480175 3300005458 Bacteria 1156
78 Ga0070681_10530867 3300005458 Unclassified 1090
79 Ga0070681_10640225 3300005458 Bacteria 978
80 Ga0070681_10658363 3300005458 Unclassified 962
81 Ga0070706_100037926 3300005467 Bacteria 4449
82 Ga0070706_100083551 3300005467 Bacteria 2958
83 Ga0070706_100178822 3300005467 Bacteria 1980
84 Ga0070707_100011214 3300005468 Bacteria 8352
85 Ga0070707_100048103 3300005468 Bacteria 4085
86 Ga0070707_100140073 3300005468 Bacteria 2354
87 Ga0070707_100414883 3300005468 Bacteria 1307
88 Ga0070707_101049257 3300005468 Bacteria 781
89 Ga0070698_100033824 3300005471 Bacteria 5295
90 Ga0070698_100225029 3300005471 Bacteria 1809
91 Ga0070698_100258704 3300005471 Bacteria 1673
92 Ga0070699_100146747 3300005518 Bacteria 2085
93 Ga0070699_100210157 3300005518 Bacteria 1732
94 Ga0070699_100308450 3300005518 Bacteria 1420
95 Ga0070679_100007052 3300005530 Bacteria 10483
96 Ga0070679_100096089 3300005530 Unclassified 2951
97 Ga0070679_100178534 3300005530 Unclassified 2096
98 Ga0070679_100841548 3300005530 Bacteria 861
99 Ga0070679_101147436 3300005530 Unclassified 722
100 Ga0070684_100005894 3300005535 Bacteria 9435
101 Ga0070684_100007590 3300005535 Bacteria 8450
102 Ga0070684_100156972 3300005535 Bacteria 2063
103 Ga0070684_100834874 3300005535 Bacteria 862
104 Ga0070697_100384993 3300005536 Bacteria 1215
105 Ga0070697_100906890 3300005536 Bacteria 782
106 Ga0070697_101220373 3300005536 Bacteria 670
107 Ga0068853_100001054 3300005539 Bacteria 19472
108 Ga0068853_100186320 3300005539 Bacteria 1884
109 Ga0068853_100251770 3300005539 Bacteria 1621
110 Ga0068853_100254508 3300005539 Bacteria 1612
111 Ga0068853_100314413 3300005539 Unclassified 1451
112 Ga0068853_100793644 3300005539 Unclassified 906
113 Ga0068853_100878067 3300005539 Unclassified 861
114 Ga0070672_100002792 3300005543 Bacteria 11188
115 Ga0070672_100675392 3300005543 Unclassified 903
116 Ga0070686_100024229 3300005544 Bacteria 3636
117 Ga0070693_100009923 3300005547 Bacteria 4754
118 Ga0070693_100076943 3300005547 Bacteria 1979
119 Ga0070665_100050858 3300005548 Unclassified 4158
120 Ga0070665_100232626 3300005548 Bacteria 1843
121 Ga0070665_100495875 3300005548 Bacteria 1232
122 Ga0070665_100772760 3300005548 Bacteria 974
123 Ga0068855_100002303 3300005563 Bacteria 23607
124 Ga0068855_100003009 3300005563 Bacteria 20607
125 Ga0068855_100007405 3300005563 Bacteria 13288
126 Ga0068855_100041529 3300005563 Bacteria 5451
127 Ga0068855_100417291 3300005563 Bacteria 1468
128 Ga0068855_100767802 3300005563 Bacteria 1027
129 Ga0068855_100874337 3300005563 Unclassified 951
130 Ga0070664_100043699 3300005564 Bacteria 3782
131 Ga0070664_100379336 3300005564 Bacteria 1290
132 Ga0070664_100689439 3300005564 Bacteria 951
133 Ga0070664_101041362 3300005564 Unclassified 770
134 Ga0070664_101235777 3300005564 Bacteria 705
135 Ga0068857_100000669 3300005577 Bacteria 25401
136 Ga0068857_100039832 3300005577 Bacteria 4164
137 Ga0068857_100050164 3300005577 Bacteria 3703
138 Ga0068857_100840311 3300005577 Bacteria 878
139 Ga0068854_100022497 3300005578 Bacteria 4296
140 Ga0068854_100068401 3300005578 Bacteria 2590
141 Ga0068856_100004416 3300005614 Bacteria 14018
142 Ga0068856_100021615 3300005614 Bacteria 6253
143 Ga0068856_100040106 3300005614 Unclassified 4598
144 Ga0068856_100080996 3300005614 Bacteria 3220
145 Ga0068856_100729139 3300005614 Bacteria 1011
146 Ga0068856_101086858 3300005614 Bacteria 817
147 Ga0068856_101571645 3300005614 Bacteria 671
148 Ga0068856_101577282 3300005614 Unclassified 670
149 Ga0068852_100000412 3300005616 Bacteria 28562
150 Ga0068852_100000504 3300005616 Bacteria 25669
151 Ga0068852_100024794 3300005616 Bacteria 4851
152 Ga0068852_100108847 3300005616 Plasmid 2515
153 Ga0068852_100286899 3300005616 Bacteria 1589
154 Ga0068852_100310174 3300005616 Bacteria 1529
155 Ga0068852_100351644 3300005616 Bacteria 1439
156 Ga0068852_100837695 3300005616 Unclassified 935
157 Ga0068859_100001120 3300005617 Bacteria 27379
158 Ga0068859_100264389 3300005617 Unclassified 1812
159 Ga0068859_101164676 3300005617 Bacteria 849
160 Ga0068859_101947263 3300005617 Bacteria 649
161 Ga0068864_100000028 3300005618 Bacteria 227840
162 Ga0068864_100003371 3300005618 Bacteria 13209
163 Ga0068861_100654386 3300005719 Bacteria 971
164 Ga0068851_10006828 3300005834 Bacteria 5226
165 Ga0068851_10012331 3300005834 Unclassified 4026
166 Ga0068851_10092656 3300005834 Bacteria 1593
167 Ga0068863_100012947 3300005841 Bacteria 8045
168 Ga0068863_100746208 3300005841 Bacteria 974
169 Ga0068858_100000351 3300005842 Bacteria 48460
170 Ga0068858_100003224 3300005842 Bacteria 16286
171 Ga0068858_100302610 3300005842 Bacteria 1526
172 Ga0068858_101194394 3300005842 Unclassified 748
173 Ga0068860_100000912 3300005843 Bacteria 32785
174 Ga0068860_101037921 3300005843 Bacteria 838
175 Ga0068862_100055590 3300005844 Bacteria 3390
176 Ga0081540_1090465 3300005983 Bacteria 1347
177 Ga0070717_10001328 3300006028 Bacteria 16958
178 Ga0070717_10556129 3300006028 Bacteria 1039
179 Ga0070717_11253270 3300006028 Bacteria 674
180 Ga0070716_100043154 3300006173 Bacteria 2520
181 Ga0070712_100582590 3300006175 Unclassified 945
182 Ga0097621_100002346 3300006237 Bacteria 12975
183 Ga0097621_100022520 3300006237 Unclassified 4892
184 Ga0097621_100136427 3300006237 Bacteria 2093
185 Ga0068871_100009242 3300006358 Bacteria 7130
186 Ga0068871_100027500 3300006358 Unclassified 4450
187 Ga0068871_100117228 3300006358 Bacteria 2246
188 Ga0068871_100243096 3300006358 Bacteria 1565
189 Ga0068871_100538986 3300006358 Bacteria 1056
190 Ga0075428_100180679 3300006844 Unclassified 2284
191 Ga0075428_100788683 3300006844 Bacteria 1010
192 Ga0075431_100486719 3300006847 Unclassified 1226
193 Ga0075434_100318887 3300006871 Bacteria 1575
194 Ga0075434_100795689 3300006871 Bacteria 962
195 Ga0068865_100044938 3300006881 Bacteria 3025
196 Ga0068865_100143940 3300006881 Bacteria 1800
197 Ga0075436_100345230 3300006914 Bacteria 1072
198 Ga0075436_100559441 3300006914 Bacteria 840
199 Ga0097620_100001120 3300006931 Bacteria 27379
200 Ga0097620_100264381 3300006931 Unclassified 1812
201 Ga0097620_101164547 3300006931 Bacteria 849
202 Ga0097620_101948020 3300006931 Bacteria 649
203 Ga0075435_100000935 3300007076 Bacteria 18423
204 Ga0105244_10008706 3300009036 Bacteria 6315
205 Ga0105250_10323411 3300009092 Bacteria 671
206 Ga0105240_10000001 3300009093 Bacteria 2887840
207 Ga0105240_10001453 3300009093 Bacteria 40511
208 Ga0105240_10002144 3300009093 Bacteria 32229
209 Ga0105240_10002730 3300009093 Bacteria 27998
210 Ga0105240_10004518 3300009093 Bacteria 21152
211 Ga0105240_10014200 3300009093 Bacteria 10877
212 Ga0105240_10015118 3300009093 Bacteria 10505
213 Ga0105240_10091670 3300009093 Bacteria 3712
214 Ga0105240_10103409 3300009093 Bacteria 3461
215 Ga0105240_10120639 3300009093 Bacteria 3157
216 Ga0105240_10453454 3300009093 Bacteria 1434
217 Ga0105240_10763451 3300009093 Bacteria 1050
218 Ga0105240_11521321 3300009093 Unclassified 701
219 Ga0105245_10000055 3300009098 Bacteria 124667
220 Ga0105245_10003399 3300009098 Bacteria 14249
221 Ga0105245_10010188 3300009098 Bacteria 8184
222 Ga0105245_10012963 3300009098 Bacteria 7267
223 Ga0105245_10020802 3300009098 Bacteria 5752
224 Ga0105245_10041877 3300009098 Bacteria 4084
225 Ga0105245_10089012 3300009098 Bacteria 2837
226 Ga0105247_10011709 3300009101 Bacteria 5277
227 Ga0114129_10153532 3300009147 Bacteria 3150
228 Ga0114129_10270242 3300009147 Bacteria 2275
229 Ga0105243_10499585 3300009148 Unclassified 1152
230 Ga0105243_10672872 3300009148 Bacteria 1006
231 Ga0105241_10000033 3300009174 Bacteria 118315
232 Ga0105241_10000610 3300009174 Bacteria 26914
233 Ga0105241_10015747 3300009174 Bacteria 5541
234 Ga0105241_10124077 3300009174 Bacteria 2083
235 Ga0105241_10294154 3300009174 Bacteria 1391
236 Ga0105241_10372109 3300009174 Unclassified 1246
237 Ga0105241_10427062 3300009174 Bacteria 1167
238 Ga0105241_10485435 3300009174 Unclassified 1099
239 Ga0105241_10562975 3300009174 Bacteria 1025
240 Ga0105241_11599507 3300009174 Bacteria 630
241 Ga0105242_10548513 3300009176 Unclassified 1108
242 Ga0105242_11067730 3300009176 Bacteria 819
243 Ga0105248_10034052 3300009177 Bacteria 5694
244 Ga0105248_10286164 3300009177 Unclassified 1856
245 Ga0105237_10003849 3300009545 Bacteria 17651
246 Ga0105237_10003903 3300009545 Bacteria 17480
247 Ga0105237_10102155 3300009545 Unclassified 2859
248 Ga0105237_10597256 3300009545 Bacteria 1111
249 Ga0105238_10000030 3300009551 Bacteria 181972
250 Ga0105238_10000171 3300009551 Bacteria 70810
251 Ga0105238_10001015 3300009551 Bacteria 28667
252 Ga0105238_10026040 3300009551 Bacteria 5962
253 Ga0105238_10041317 3300009551 Unclassified 4670
254 Ga0105238_10059519 3300009551 Bacteria 3826
255 Ga0105238_10166691 3300009551 Bacteria 2179
256 Ga0105238_10659719 3300009551 Bacteria 1056
257 Ga0105238_11945728 3300009551 Bacteria 621
258 Ga0105239_10001391 3300010375 Bacteria 32418
259 Ga0105239_10003628 3300010375 Bacteria 18868
260 Ga0105239_10028548 3300010375 Bacteria 6135
261 Ga0105239_10028853 3300010375 Bacteria 6100
262 Ga0105239_10078685 3300010375 Unclassified 3629
263 Ga0105239_10125058 3300010375 Unclassified 2857
264 Ga0105239_10316293 3300010375 Bacteria 1760
265 Ga0105239_10810476 3300010375 Bacteria 1073
266 Ga0105239_11058448 3300010375 Bacteria 933
267 Ga0105239_11068003 3300010375 Bacteria 929
268 Ga0105246_10000907 3300011119 Bacteria 16987
269 Ga0105246_10012266 3300011119 Bacteria 5343
270 Ga0105246_10338108 3300011119 Bacteria 1229
271 Ga0157373_10292129 3300013100 Bacteria 1156
272 Ga0157371_10075625 3300013102 Bacteria 2385
273 Ga0157371_10354193 3300013102 Unclassified 1069
274 Ga0157370_10001599 3300013104 Bacteria 28002
275 Ga0157370_10095371 3300013104 Bacteria 2791
276 Ga0157370_10102558 3300013104 Bacteria 2679
277 Ga0157370_10176876 3300013104 Bacteria 1983
278 Ga0157370_10232668 3300013104 Bacteria 1705
279 Ga0157370_11705110 3300013104 Bacteria 566
280 Ga0157369_10000242 3300013105 Bacteria 75791
281 Ga0157369_10001577 3300013105 Bacteria 27889
282 Ga0157369_10008591 3300013105 Bacteria 11716
283 Ga0157369_10012455 3300013105 Bacteria 9649
284 Ga0157369_10018678 3300013105 Bacteria 7773
285 Ga0157369_10039891 3300013105 Bacteria 5130
286 Ga0157369_10077004 3300013105 Bacteria 3575
287 Ga0157369_10130555 3300013105 Unclassified 2663
288 Ga0157369_10168869 3300013105 Bacteria 2306
289 Ga0157369_10266931 3300013105 Bacteria 1784
290 Ga0157369_10294234 3300013105 Bacteria 1690
291 Ga0157369_10403980 3300013105 Unclassified 1417
292 Ga0157369_10430399 3300013105 Bacteria 1368
293 Ga0157369_10543845 3300013105 Bacteria 1201
294 Ga0157369_10852531 3300013105 Unclassified 935
295 Ga0157369_10936498 3300013105 Bacteria 888
296 Ga0157374_10000020 3300013296 Bacteria 276902
297 Ga0157374_10023240 3300013296 Bacteria 5542
298 Ga0157374_10026176 3300013296 Bacteria 5246
299 Ga0157374_10051375 3300013296 Bacteria 3836
300 Ga0157374_10062234 3300013296 Unclassified 3497
301 Ga0157374_10129048 3300013296 Unclassified 2445
302 Ga0157374_10296769 3300013296 Unclassified 1598
303 Ga0157374_10322768 3300013296 Bacteria 1530
304 Ga0157378_10003809 3300013297 Bacteria 13354
305 Ga0157378_10007905 3300013297 Bacteria 9277
306 Ga0157378_10016175 3300013297 Bacteria 6532
307 Ga0157378_10016181 3300013297 Bacteria 6532
308 Ga0157378_10021152 3300013297 Bacteria 5722
309 Ga0157378_10024908 3300013297 Bacteria 5270
310 Ga0157378_10073374 3300013297 Bacteria 3077
311 Ga0157378_10133797 3300013297 Bacteria 2297
312 Ga0163162_10009322 3300013306 Bacteria 9544
313 Ga0163162_10105239 3300013306 Unclassified 2916
314 Ga0163162_10519962 3300013306 Unclassified 1320
315 Ga0163162_11466988 3300013306 Bacteria 777
316 Ga0157372_10001952 3300013307 Bacteria 22395
317 Ga0157372_10016926 3300013307 Bacteria 7826
318 Ga0157372_10081580 3300013307 Bacteria 3661
319 Ga0157372_10094168 3300013307 Bacteria 3410
320 Ga0157372_10177352 3300013307 Bacteria 2466
321 Ga0157372_10242172 3300013307 Unclassified 2093
322 Ga0157372_10532486 3300013307 Unclassified 1369
323 Ga0157372_10974633 3300013307 Bacteria 982
324 Ga0157372_11508652 3300013307 Bacteria 774
325 Ga0157372_12441476 3300013307 Bacteria 600
326 Ga0157375_10000005 3300013308 Bacteria 429412
327 Ga0157375_10000010 3300013308 Bacteria 361011
328 Ga0157375_10003027 3300013308 Bacteria 14584
329 Ga0157375_10005008 3300013308 Bacteria 11513
330 Ga0157375_10379434 3300013308 Bacteria 1580
331 Ga0157375_10488769 3300013308 Bacteria 1396
332 Ga0163163_10250095 3300014325 Bacteria 1823
333 Ga0157380_10184238 3300014326 Bacteria 1837
334 Ga0182008_10571236 3300014497 Unclassified 631
335 Ga0157377_10000005 3300014745 Bacteria 426955
336 Ga0157377_10000090 3300014745 Bacteria 66429
337 Ga0157377_10134973 3300014745 Bacteria 1511
338 Ga0157379_10012449 3300014968 Bacteria 7429
339 Ga0157379_10056931 3300014968 Bacteria 3493
340 Ga0157379_12175570 3300014968 Unclassified 551
341 Ga0157376_10000013 3300014969 Bacteria 304287
342 Ga0157376_10101819 3300014969 Bacteria 2511
343 Ga0157376_10125380 3300014969 Bacteria 2283
344 Ga0157376_10141487 3300014969 Unclassified 2159
345 Ga0157376_10186363 3300014969 Unclassified 1900
346 Ga0157376_10361820 3300014969 Unclassified 1392
347 Ga0157376_11168606 3300014969 Unclassified 797
348 Ga0163161_10023000 3300017792 Bacteria 4392
349 Ga0163161_10194301 3300017792 Bacteria 1561
350 Ga0206350_10028588 3300020080 Unclassified 698
351 Ga0213873_10000001 3300021358 Bacteria 1657979
352 Ga0213873_10000239 3300021358 Bacteria 9581
353 Ga0213876_10000002 3300021384 Bacteria 1168769
354 Ga0213876_10000045 3300021384 Bacteria 151827
355 Ga0213876_10003099 3300021384 Bacteria 9616
356 Ga0213876_10047908 3300021384 Bacteria 2259
357 Ga0209233_1004869 3300025261 Bacteria 4521
358 Ga0207656_10008149 3300025321 Unclassified 3847
359 Ga0207656_10039586 3300025321 Bacteria 1994
360 Ga0207656_10050154 3300025321 Unclassified 1801
361 Ga0207655_1046735 3300025728 Bacteria 1794
362 Ga0207710_10005055 3300025900 Bacteria 5716
363 Ga0207680_10265872 3300025903 Bacteria 1188
364 Ga0207680_10735293 3300025903 Bacteria 707
365 Ga0207647_10071061 3300025904 Bacteria 2100
366 Ga0207647_10154053 3300025904 Unclassified 1342
367 Ga0207699_10922828 3300025906 Bacteria 644
368 Ga0207645_10009148 3300025907 Bacteria 6869
369 Ga0207645_10399938 3300025907 Bacteria 924
370 Ga0207705_10000109 3300025909 Bacteria 93256
371 Ga0207705_10041065 3300025909 Bacteria 3318
372 Ga0207705_10045043 3300025909 Unclassified 3171
373 Ga0207705_10101945 3300025909 Bacteria 2112
374 Ga0207705_10159238 3300025909 Bacteria 1695
375 Ga0207705_10959273 3300025909 Bacteria 661
376 Ga0207705_11314992 3300025909 Unclassified 552
377 Ga0207684_10093003 3300025910 Bacteria 2570
378 Ga0207654_10000368 3300025911 Bacteria 26431
379 Ga0207654_10001586 3300025911 Bacteria 11945
380 Ga0207654_10004565 3300025911 Bacteria 6993
381 Ga0207654_10300227 3300025911 Unclassified 1092
382 Ga0207707_10552270 3300025912 Unclassified 978
383 Ga0207707_11409950 3300025912 Unclassified 555
384 Ga0207695_10000001 3300025913 Bacteria 2888630
385 Ga0207695_10000030 3300025913 Bacteria 533735
386 Ga0207695_10000259 3300025913 Bacteria 133796
387 Ga0207695_10000537 3300025913 Bacteria 79113
388 Ga0207695_10000877 3300025913 Bacteria 54740
389 Ga0207695_10002346 3300025913 Bacteria 28121
390 Ga0207695_10035688 3300025913 Bacteria 5387
391 Ga0207695_10063181 3300025913 Bacteria 3818
392 Ga0207695_10212622 3300025913 Unclassified 1844
393 Ga0207695_10539891 3300025913 Bacteria 1047
394 Ga0207695_11725218 3300025913 Unclassified 507
395 Ga0207671_10001200 3300025914 Bacteria 30806
396 Ga0207671_10003815 3300025914 Bacteria 14757
397 Ga0207671_10132837 3300025914 Unclassified 1912
398 Ga0207671_10301090 3300025914 Bacteria 1267
399 Ga0207671_10394484 3300025914 Unclassified 1100
400 Ga0207693_10510757 3300025915 Unclassified 938
401 Ga0207660_10470074 3300025917 Unclassified 1018
402 Ga0207662_10021000 3300025918 Bacteria 3727
403 Ga0207662_10232786 3300025918 Bacteria 1204
404 Ga0207657_10570660 3300025919 Unclassified 884
405 Ga0207657_10707725 3300025919 Bacteria 782
406 Ga0207649_10009534 3300025920 Bacteria 5315
407 Ga0207649_10009963 3300025920 Bacteria 5207
408 Ga0207649_10035372 3300025920 Bacteria 3001
409 Ga0207649_10196221 3300025920 Bacteria 1423
410 Ga0207649_10327785 3300025920 Bacteria 1127
411 Ga0207652_10003180 3300025921 Bacteria 13656
412 Ga0207652_10120210 3300025921 Bacteria 2337
413 Ga0207646_10071262 3300025922 Bacteria 3104
414 Ga0207646_10082286 3300025922 Bacteria 2879
415 Ga0207646_10576979 3300025922 Bacteria 1010
416 Ga0207646_10688845 3300025922 Bacteria 914
417 Ga0207646_11023241 3300025922 Unclassified 729
418 Ga0207681_10196128 3300025923 Unclassified 1548
419 Ga0207694_10000002 3300025924 Bacteria 1165763
420 Ga0207694_10000003 3300025924 Bacteria 1165533
421 Ga0207694_10000181 3300025924 Bacteria 65011
422 Ga0207694_10000770 3300025924 Bacteria 28760
423 Ga0207694_10003285 3300025924 Bacteria 12877
424 Ga0207694_10011540 3300025924 Bacteria 6666
425 Ga0207694_10271073 3300025924 Unclassified 1392
426 Ga0207694_10353729 3300025924 Bacteria 1216
427 Ga0207650_10000141 3300025925 Bacteria 87777
428 Ga0207650_10028219 3300025925 Unclassified 4022
429 Ga0207659_10000001 3300025926 Bacteria 660958
430 Ga0207659_11276805 3300025926 Bacteria 631
431 Ga0207687_10000035 3300025927 Bacteria 124800
432 Ga0207687_10000199 3300025927 Bacteria 40591
433 Ga0207687_10000637 3300025927 Bacteria 23691
434 Ga0207687_10070218 3300025927 Bacteria 2500
435 Ga0207700_10015197 3300025928 Bacteria 5067
436 Ga0207700_10237802 3300025928 Bacteria 1551
437 Ga0207700_10762199 3300025928 Bacteria 865
438 Ga0207700_11042614 3300025928 Bacteria 732
439 Ga0207664_10090316 3300025929 Unclassified 2510
440 Ga0207664_10438743 3300025929 Bacteria 1164
441 Ga0207664_11127638 3300025929 Unclassified 701
442 Ga0207644_10001417 3300025931 Bacteria 15450
443 Ga0207690_10086668 3300025932 Bacteria 2201
444 Ga0207706_10069519 3300025933 Bacteria 3097
445 Ga0207709_10593127 3300025935 Unclassified 876
446 Ga0207670_10000785 3300025936 Bacteria 16643
447 Ga0207670_10241013 3300025936 Bacteria 1393
448 Ga0207670_10391947 3300025936 Bacteria 1108
449 Ga0207669_10031420 3300025937 Bacteria 2967
450 Ga0207704_10043264 3300025938 Bacteria 2658
451 Ga0207704_10491575 3300025938 Bacteria 987
452 Ga0207665_10042185 3300025939 Bacteria 3049
453 Ga0207665_10087456 3300025939 Bacteria 2154
454 Ga0207665_10502831 3300025939 Bacteria 936
455 Ga0207691_10005878 3300025940 Bacteria 11852
456 Ga0207691_10270004 3300025940 Bacteria 1465
457 Ga0207691_10634658 3300025940 Unclassified 903
458 Ga0207711_10025974 3300025941 Bacteria 4912
459 Ga0207711_10077940 3300025941 Unclassified 2890
460 Ga0207689_10002258 3300025942 Bacteria 18059
461 Ga0207689_10156365 3300025942 Bacteria 1879
462 Ga0207689_10344390 3300025942 Unclassified 1238
463 Ga0207689_10486357 3300025942 Bacteria 1033
464 Ga0207661_10000002 3300025944 Bacteria 816104
465 Ga0207661_10056839 3300025944 Bacteria 3143
466 Ga0207661_10384788 3300025944 Bacteria 1270
467 Ga0207679_10039884 3300025945 Unclassified 3357
468 Ga0207679_10208295 3300025945 Bacteria 1638
469 Ga0207679_10565231 3300025945 Bacteria 1022
470 Ga0207667_10002563 3300025949 Bacteria 22609
471 Ga0207667_10003145 3300025949 Bacteria 20433
472 Ga0207667_10004516 3300025949 Bacteria 17053
473 Ga0207667_10047117 3300025949 Bacteria 4564
474 Ga0207667_10054381 3300025949 Bacteria 4211
475 Ga0207667_10267139 3300025949 Unclassified 1749
476 Ga0207667_10360620 3300025949 Unclassified 1482
477 Ga0207667_10387649 3300025949 Unclassified 1423
478 Ga0207667_10558379 3300025949 Unclassified 1157
479 Ga0207667_10830454 3300025949 Bacteria 919
480 Ga0207667_11744505 3300025949 Bacteria 588
481 Ga0207651_10037175 3300025960 Bacteria 3187
482 Ga0207640_10017980 3300025981 Bacteria 4146
483 Ga0207640_10129558 3300025981 Bacteria 1821
484 Ga0207640_10363293 3300025981 Bacteria 1167
485 Ga0207640_10519668 3300025981 Unclassified 995
486 Ga0207658_10000811 3300025986 Bacteria 26164
487 Ga0207658_10101686 3300025986 Bacteria 2253
488 Ga0207677_10000038 3300026023 Bacteria 113012
489 Ga0207677_10000242 3300026023 Bacteria 42196
490 Ga0207677_10000358 3300026023 Bacteria 31943
491 Ga0207677_10423121 3300026023 Bacteria 1135
492 Ga0207677_10676937 3300026023 Bacteria 913
493 Ga0207703_10000543 3300026035 Bacteria 38782
494 Ga0207703_10004751 3300026035 Bacteria 11082
495 Ga0207703_10339674 3300026035 Bacteria 1380
496 Ga0207639_10000048 3300026041 Bacteria 124627
497 Ga0207639_10000101 3300026041 Bacteria 70638
498 Ga0207639_10003654 3300026041 Bacteria 10339
499 Ga0207639_10114089 3300026041 Bacteria 2207
500 Ga0207639_10215434 3300026041 Bacteria 1656
501 Ga0207678_10242598 3300026067 Bacteria 1543
502 Ga0207678_10746571 3300026067 Unclassified 863
503 Ga0207678_11120541 3300026067 Bacteria 697
504 Ga0207708_10000050 3300026075 Bacteria 112028
505 Ga0207702_10002585 3300026078 Bacteria 17020
506 Ga0207702_10003045 3300026078 Bacteria 15578
507 Ga0207702_10032978 3300026078 Bacteria 4323
508 Ga0207702_10043948 3300026078 Bacteria 3753
509 Ga0207702_10101964 3300026078 Unclassified 2535
510 Ga0207702_10117045 3300026078 Bacteria 2379
511 Ga0207702_10892345 3300026078 Bacteria 881
512 Ga0207641_10003995 3300026088 Bacteria 12874
513 Ga0207648_10338905 3300026089 Bacteria 1354
514 Ga0207676_10000002 3300026095 Bacteria 1198607
515 Ga0207676_10001904 3300026095 Bacteria 15235
516 Ga0207674_10001897 3300026116 Bacteria 26616
517 Ga0207674_10002588 3300026116 Bacteria 22783
518 Ga0207674_10064046 3300026116 Bacteria 3709
519 Ga0207674_10082192 3300026116 Bacteria 3223
520 Ga0207675_100018595 3300026118 Bacteria 6483
521 Ga0207683_10000600 3300026121 Bacteria 33247
522 Ga0207683_10538383 3300026121 Bacteria 1079
523 Ga0207683_11120452 3300026121 Unclassified 730
524 Ga0207698_10000263 3300026142 Bacteria 32215
525 Ga0207698_10000268 3300026142 Bacteria 31619
526 Ga0207698_10012627 3300026142 Bacteria 5535
527 Ga0207698_10080346 3300026142 Bacteria 2626
528 Ga0207698_10175551 3300026142 Unclassified 1892
529 Ga0207698_10303619 3300026142 Bacteria 1487
530 Ga0207698_10672091 3300026142 Unclassified 1028
531 Ga0207698_10752575 3300026142 Unclassified 973
532 Ga0207698_11423074 3300026142 Unclassified 708
533 Ga0207698_12461097 3300026142 Unclassified 531
534 Ga0268266_10104052 3300028379 Bacteria 2506
535 Ga0268266_10151837 3300028379 Unclassified 2088
536 Ga0268266_10292986 3300028379 Unclassified 1516
537 Ga0268266_10894892 3300028379 Unclassified 858
538 Ga0268265_10040922 3300028380 Bacteria 3425
539 Ga0268264_10009127 3300028381 Bacteria 8222
540 Ga0265338_10006322 3300028800 Bacteria 15137
541 Ga0265338_10108662 3300028800 Bacteria 2240
542 Ga0265338_10385729 3300028800 Bacteria 1001
543 Ga0307511_10001241 3300030521 Bacteria 26961
544 Ga0265770_1104004 3300030878 Unclassified 581
545 Ga0265332_10273549 3300031238 Unclassified 698
546 Ga0265328_10042435 3300031239 Unclassified 1674
547 Ga0265328_10110817 3300031239 Bacteria 1020
548 Ga0265320_10214541 3300031240 Bacteria 858
549 Ga0265325_10076382 3300031241 Bacteria 1671
550 Ga0265325_10128623 3300031241 Unclassified 1215
551 Ga0265340_10022014 3300031247 Bacteria 3262
552 Ga0265339_10000102 3300031249 Bacteria 68868
553 Ga0265339_10002713 3300031249 Bacteria 12584
554 Ga0265339_10124319 3300031249 Bacteria 1323
555 Ga0265331_10064262 3300031250 Unclassified 1728
556 Ga0265316_10028872 3300031344 Bacteria 4569
557 Ga0265316_10035281 3300031344 Bacteria 4054
558 Ga0265313_10009409 3300031595 Bacteria 6347
559 Ga0265313_10016220 3300031595 Bacteria 4293
560 Ga0265313_10046928 3300031595 Bacteria 2094
561 Ga0265313_10202621 3300031595 Bacteria 825
562 Ga0265314_10010478 3300031711 Bacteria 7727
563 Ga0265342_10003244 3300031712 Bacteria 13487
564 Ga0265342_10029167 3300031712 Bacteria 3429
565 Ga0265342_10033310 3300031712 Bacteria 3169
566 Ga0265342_10123066 3300031712 Bacteria 1459
567 Ga0307416_100111297 3300032002 Bacteria 2414
568 Ga0307416_100740464 3300032002 Bacteria 1075
569 Ga0307416_101633261 3300032002 Bacteria 750
570 Ga0316583_10100578 3300032133 Bacteria 1008
571 Ga0373932_0000038 3300035112 Bacteria 31409
572 Ga0373941_0036024 3300035115 Bacteria 1503
573 Ga0373954_0512120 3300035118 Unclassified 595
574 Ga0373946_0230427 3300035171 Bacteria 897
575 Ga0373955_0155937 3300035172 Bacteria 1345
576 Ga0373924_0413163 3300035410 Unclassified 604
577 Ga0373931_0953694 3300035691 Bacteria 579
578 Ga0373933_0504556 3300035724 Bacteria 793
579 Ga0373937_0005175 3300036401 Bacteria 11126
580 Ga0373937_0310011 3300036401 Bacteria 1493
581 Ga0373937_0369877 3300036401 Unclassified 1359
582 Ga0373937_1633333 3300036401 Unclassified 592
583 Ga0395900_0961712 3300037418 Bacteria 775
584 Ga0395905_0010275 3300037471 Bacteria 9113
585 Ga0395905_0116557 3300037471 Bacteria 2511
586 Ga0436364_0596452 3300037853 Unclassified 1409
587 Ga0395901_1819856 3300038443 Unclassified 558
588 Ga0436365_0119666 3300039437 Bacteria 62588
589 Ga0436365_0407814 3300039437 Bacteria 973
590 Ga0436365_0698156 3300039437 Bacteria 5500
591 Ga0436365_0895411 3300039437 Bacteria 24537
592 Ga0436365_1159326 3300039437 Bacteria 152569
593 Ga0436365_1500666 3300039437 Bacteria 1595
594 Ga0436365_1730877 3300039437 Bacteria 1538
595 Ga0436362_0276211 3300039453 Bacteria 12379
596 Ga0436362_0984254 3300039453 Bacteria 405590
597 Ga0451839_1373062 3300041496 Bacteria 848
598 Ga0451853_2377832 3300041512 Bacteria 650
599 Ga0451577_0091948 3300042876 Bacteria 2709
600 Ga0466966_0072063 3300044684 Bacteria 2164
601 Ga0466966_0408578 3300044684 Bacteria 816
602 Ga0466963_0010611 3300044694 Bacteria 5584
603 Ga0466963_1057141 3300044694 Unclassified 571
604 Ga0451576_0704943 3300045051 Bacteria 1061
605 Ga0466967_0025903 3300045976 Bacteria 4845
606 Ga0466967_0167459 3300045976 Unclassified 2066
607 Ga0495629_0585628 3300046459 Unclassified 747
608 Ga0495580_0039510 3300046472 Bacteria 3376
609 Ga0495620_0016537 3300046515 Bacteria 3698
610 Ga0495652_0140818 3300046529 Bacteria 1897
611 Ga0495640_0600062 3300046533 Unclassified 665
612 Ga0495645_0159740 3300046543 Bacteria 1559
613 Ga0495659_0006379 3300046664 Bacteria 3724
614 Ga0495623_0239180 3300046679 Bacteria 1026
615 Ga0495669_0044969 3300046684 Bacteria 1968
616 Ga0495613_0516954 3300046689 Unclassified 802
617 Ga0495672_0004803 3300047320 Bacteria 10899
618 Ga0495679_030005 3300047446 Bacteria 1769
619 Ga0495684_0345027 3300047471 Unclassified 1059
620 Ga0495686_0000006 3300047472 Bacteria 770778
621 Ga0495686_0001113 3300047472 Bacteria 31863
622 Ga0495686_0001457 3300047472 Bacteria 25789
623 Ga0495686_0032071 3300047472 Bacteria 3402
624 Ga0495686_0171760 3300047472 Bacteria 1260
625 Ga0496100_0144512 3300048903 Unclassified 1690
626 Ga0496100_0506189 3300048903 Bacteria 931
627 Ga0496104_0011203 3300048907 Bacteria 8024
628 Ga0496104_0037784 3300048907 Bacteria 4514
629 Ga0496104_0145247 3300048907 Bacteria 2278
630 Ga0496105_0249429 3300048908 Bacteria 1438
631 Ga0496105_0523837 3300048908 Bacteria 928
632 Ga0496106_1058448 3300048909 Bacteria 637
633 Ga0496109_0573427 3300048912 Bacteria 1064
634 Ga0496111_0737278 3300048914 Unclassified 715
635 Ga0496112_0658875 3300048915 Bacteria 976
636 Ga0496114_0715330 3300048917 Unclassified 877
637 Ga0496115_0012654 3300048918 Bacteria 6359
638 Ga0496115_0068390 3300048918 Bacteria 2875
639 Ga0496120_0212996 3300048923 Bacteria 928
640 Ga0496126_0000085 3300048929 Bacteria 216528
641 Ga0496126_0357839 3300048929 Bacteria 1193
642 Ga0496126_1075815 3300048929 Unclassified 599
643 Ga0495682_0150632 3300049460 Unclassified 830
644 Ga0501031_0046555 3300049568 Bacteria 2828
645 Ga0501032_0001186 3300049569 Bacteria 20875
646 Ga0501033_0013422 3300049570 Bacteria 6239
647 Ga0501034_0005607 3300049571 Bacteria 13671
648 Ga0501036_0013543 3300049572 Bacteria 6780
649 Ga0501037_0003398 3300049573 Bacteria 11576
650 Ga0501037_0395865 3300049573 Bacteria 948
651 Ga0501038_0000661 3300049574 Bacteria 30645
652 Ga0501039_0075517 3300049575 Bacteria 2620
653 Ga0501043_0000632 3300049579 Bacteria 31136
654 Ga0501046_0000036 3300049580 Bacteria 159823
655 Ga0501048_0834131 3300049582 Bacteria 663
656 Ga0501070_0412749 3300049586 Bacteria 1091
657 Ga0501070_0455320 3300049586 Bacteria 1031
658 Ga0501073_0048226 3300049589 Bacteria 2990
659 Ga0501080_0005167 3300049742 Bacteria 11628
660 Ga0501080_0009240 3300049742 Bacteria 8985
661 Ga0501080_1728350 3300049742 Bacteria 527
662 Ga0501035_0003113 3300049822 Bacteria 15938
663 Ga0501035_0779846 3300049822 Bacteria 765
664 Ga0501044_0010234 3300049823 Bacteria 10184
665 nmdc:mga05p37_1788328_c1 3300050507 Unclassified 594
666 nmdc:mga05p37_254011_c1 3300050507 Bacteria 1572
667 nmdc:mga06r32_514_c1 3300050510 Bacteria 33323
668 nmdc:mga0n895_273154_c1 3300050512 Bacteria 1714
669 nmdc:mga0n895_285357_c1 3300050512 Unclassified 1674
670 nmdc:mga0rr50_192_c1 3300050513 Bacteria 33123
671 nmdc:mga08x19_538715_c1 3300050514 Bacteria 826
672 nmdc:mga08x19_840633_c1 3300050514 Bacteria 652
673 Ga0495655_0003860 3300053083 Bacteria 2512
674 2884218591 2884215851 Bacteria 4554841
675 Ga0496115_0250609
676 MBSR1b_contig_9392625
677 rootH2_10077923
678 rootH2_10093198
679 Ga0065715_10121466
680 Ga0065707_10915442
681 Ga0070658_10000101
682 Ga0070658_10004091
683 Ga0070658_10034316
684 Ga0070658_10104368
685 Ga0070658_10215285
686 Ga0070658_10389519
687 Ga0070683_100000042
688 Ga0070683_100008847
689 Ga0070683_100063445
690 Ga0070683_100514807
691 Ga0070683_100562950
692 Ga0070690_100327132
693 Ga0070690_100859403
694 Ga0070670_100000164
695 Ga0070670_100133244
696 Ga0068869_100017999
697 Ga0068869_100093108
698 Ga0068869_100093581
699 Ga0068869_100697873
700 Ga0070666_11112018
701 Ga0070682_100000007
702 Ga0070682_100462033
703 Ga0068868_100000292
704 Ga0068868_100003751
705 Ga0068868_100048031
706 Ga0068868_100094069
707 Ga0068868_100188367
708 Ga0070689_100122312
709 Ga0070689_100404357
710 Ga0070689_101367081
711 Ga0070687_100117245
712 Ga0070687_100650751
713 Ga0070661_100001493
714 Ga0070661_100033708
715 Ga0070661_100041792
716 Ga0070661_100071609
717 Ga0070661_100230495
718 Ga0070692_10007072
719 Ga0070668_100206620
720 Ga0070669_101515657
721 Ga0070675_100000010
722 Ga0070675_100598411
723 Ga0070675_100788773
724 Ga0070675_101304375
725 Ga0070671_100066164
726 Ga0070674_100073875
727 Ga0070673_100022917
728 Ga0070673_100114532
729 Ga0070659_100240017
730 Ga0070667_100004122
731 Ga0070709_10320064
732 Ga0070714_100272311
733 Ga0070713_100020466
734 Ga0070713_100110776
735 Ga0070713_100743250
736 Ga0070713_100966320
737 Ga0070713_101676251
738 Ga0070701_10000615
739 Ga0070711_100038343
740 Ga0070700_100000001
741 Ga0070708_100008564
742 Ga0070708_100048147
743 Ga0070708_100115569
744 Ga0070708_100422747
745 Ga0070663_100267588
746 Ga0070663_100482758
747 Ga0070678_100054496
748 Ga0070678_101204443
749 Ga0070678_101685005
750 Ga0070662_100068938
751 Ga0070681_10480175
752 Ga0070681_10530867
753 Ga0070681_10640225
754 Ga0070681_10658363
755 Ga0070706_100037926
756 Ga0070706_100083551
757 Ga0070706_100178822
758 Ga0070707_100011214
759 Ga0070707_100048103
760 Ga0070707_100140073
761 Ga0070707_100414883
762 Ga0070707_101049257
763 Ga0070698_100033824
764 Ga0070698_100225029
765 Ga0070698_100258704
766 Ga0070699_100146747
767 Ga0070699_100210157
768 Ga0070699_100308450
769 Ga0070679_100007052
770 Ga0070679_100096089
771 Ga0070679_100178534
772 Ga0070679_100841548
773 Ga0070679_101147436
774 Ga0070684_100005894
775 Ga0070684_100007590
776 Ga0070684_100156972
777 Ga0070684_100834874
778 Ga0070697_100384993
779 Ga0070697_100906890
780 Ga0070697_101220373
781 Ga0068853_100001054
782 Ga0068853_100186320
783 Ga0068853_100251770
784 Ga0068853_100254508
785 Ga0068853_100314413
786 Ga0068853_100793644
787 Ga0068853_100878067
788 Ga0070672_100002792
789 Ga0070672_100675392
790 Ga0070686_100024229
791 Ga0070693_100009923
792 Ga0070693_100076943
793 Ga0070665_100050858
794 Ga0070665_100232626
795 Ga0070665_100495875
796 Ga0070665_100772760
797 Ga0068855_100002303
798 Ga0068855_100003009
799 Ga0068855_100007405
800 Ga0068855_100041529
801 Ga0068855_100417291
802 Ga0068855_100767802
803 Ga0068855_100874337
804 Ga0070664_100043699
805 Ga0070664_100379336
806 Ga0070664_100689439
807 Ga0070664_101041362
808 Ga0070664_101235777
809 Ga0068857_100000669
810 Ga0068857_100039832
811 Ga0068857_100050164
812 Ga0068857_100840311
813 Ga0068854_100022497
814 Ga0068854_100068401
815 Ga0068856_100004416
816 Ga0068856_100021615
817 Ga0068856_100040106
818 Ga0068856_100080996
819 Ga0068856_100729139
820 Ga0068856_101086858
821 Ga0068856_101571645
822 Ga0068856_101577282
823 Ga0068852_100000412
824 Ga0068852_100000504
825 Ga0068852_100024794
826 Ga0068852_100108847
827 Ga0068852_100286899
828 Ga0068852_100310174
829 Ga0068852_100351644
830 Ga0068852_100837695
831 Ga0068859_100001120
832 Ga0068859_100264389
833 Ga0068859_101164676
834 Ga0068859_101947263
835 Ga0068864_100000028
836 Ga0068864_100003371
837 Ga0068861_100654386
838 Ga0068851_10006828
839 Ga0068851_10012331
840 Ga0068851_10092656
841 Ga0068863_100012947
842 Ga0068863_100746208
843 Ga0068858_100000351
844 Ga0068858_100003224
845 Ga0068858_100302610
846 Ga0068858_101194394
847 Ga0068860_100000912
848 Ga0068860_101037921
849 Ga0068862_100055590
850 Ga0081540_1090465
851 Ga0070717_10001328
852 Ga0070717_10556129
853 Ga0070717_11253270
854 Ga0070716_100043154
855 Ga0070712_100582590
856 Ga0097621_100002346
857 Ga0097621_100022520
858 Ga0097621_100136427
859 Ga0068871_100009242
860 Ga0068871_100027500
861 Ga0068871_100117228
862 Ga0068871_100243096
863 Ga0068871_100538986
864 Ga0075428_100180679
865 Ga0075428_100788683
866 Ga0075431_100486719
867 Ga0075434_100318887
868 Ga0075434_100795689
869 Ga0068865_100044938
870 Ga0068865_100143940
871 Ga0075436_100345230
872 Ga0075436_100559441
873 Ga0097620_100001120
874 Ga0097620_100264381
875 Ga0097620_101164547
876 Ga0097620_101948020
877 Ga0075435_100000935
878 Ga0105244_10008706
879 Ga0105250_10323411
880 Ga0105240_10000001
881 Ga0105240_10001453
882 Ga0105240_10002144
883 Ga0105240_10002730
884 Ga0105240_10004518
885 Ga0105240_10014200
886 Ga0105240_10015118
887 Ga0105240_10091670
888 Ga0105240_10103409
889 Ga0105240_10120639
890 Ga0105240_10453454
891 Ga0105240_10763451
892 Ga0105240_11521321
893 Ga0105245_10000055
894 Ga0105245_10003399
895 Ga0105245_10010188
896 Ga0105245_10012963
897 Ga0105245_10020802
898 Ga0105245_10041877
899 Ga0105245_10089012
900 Ga0105247_10011709
901 Ga0114129_10153532
902 Ga0114129_10270242
903 Ga0105243_10499585
904 Ga0105243_10672872
905 Ga0105241_10000033
906 Ga0105241_10000610
907 Ga0105241_10015747
908 Ga0105241_10124077
909 Ga0105241_10294154
910 Ga0105241_10372109
911 Ga0105241_10427062
912 Ga0105241_10485435
913 Ga0105241_10562975
914 Ga0105241_11599507
915 Ga0105242_10548513
916 Ga0105242_11067730
917 Ga0105248_10034052
918 Ga0105248_10286164
919 Ga0105237_10003849
920 Ga0105237_10003903
921 Ga0105237_10102155
922 Ga0105237_10597256
923 Ga0105238_10000030
924 Ga0105238_10000171
925 Ga0105238_10001015
926 Ga0105238_10026040
927 Ga0105238_10041317
928 Ga0105238_10059519
929 Ga0105238_10166691
930 Ga0105238_10659719
931 Ga0105238_11945728
932 Ga0105239_10001391
933 Ga0105239_10003628
934 Ga0105239_10028548
935 Ga0105239_10028853
936 Ga0105239_10078685
937 Ga0105239_10125058
938 Ga0105239_10316293
939 Ga0105239_10810476
940 Ga0105239_11058448
941 Ga0105239_11068003
942 Ga0105246_10000907
943 Ga0105246_10012266
944 Ga0105246_10338108
945 Ga0157373_10292129
946 Ga0157371_10075625
947 Ga0157371_10354193
948 Ga0157370_10001599
949 Ga0157370_10095371
950 Ga0157370_10102558
951 Ga0157370_10176876
952 Ga0157370_10232668
953 Ga0157370_11705110
954 Ga0157369_10000242
955 Ga0157369_10001577
956 Ga0157369_10008591
957 Ga0157369_10012455
958 Ga0157369_10018678
959 Ga0157369_10039891
960 Ga0157369_10077004
961 Ga0157369_10130555
962 Ga0157369_10168869
963 Ga0157369_10266931
964 Ga0157369_10294234
965 Ga0157369_10403980
966 Ga0157369_10430399
967 Ga0157369_10543845
968 Ga0157369_10852531
969 Ga0157369_10936498
970 Ga0157374_10000020
971 Ga0157374_10023240
972 Ga0157374_10026176
973 Ga0157374_10051375
974 Ga0157374_10062234
975 Ga0157374_10129048
976 Ga0157374_10296769
977 Ga0157374_10322768
978 Ga0157378_10003809
979 Ga0157378_10007905
980 Ga0157378_10016175
981 Ga0157378_10016181
982 Ga0157378_10021152
983 Ga0157378_10024908
984 Ga0157378_10073374
985 Ga0157378_10133797
986 Ga0163162_10009322
987 Ga0163162_10105239
988 Ga0163162_10519962
989 Ga0163162_11466988
990 Ga0157372_10001952
991 Ga0157372_10016926
992 Ga0157372_10081580
993 Ga0157372_10094168
994 Ga0157372_10177352
995 Ga0157372_10242172
996 Ga0157372_10532486
997 Ga0157372_10974633
998 Ga0157372_11508652
999 Ga0157372_12441476
1000 Ga0157375_10000005
1001 Ga0157375_10000010
1002 Ga0157375_10003027
1003 Ga0157375_10005008
1004 Ga0157375_10379434
1005 Ga0157375_10488769
1006 Ga0163163_10250095
1007 Ga0157380_10184238
1008 Ga0182008_10571236
1009 Ga0157377_10000005
1010 Ga0157377_10000090
1011 Ga0157377_10134973
1012 Ga0157379_10012449
1013 Ga0157379_10056931
1014 Ga0157379_12175570
1015 Ga0157376_10000013
1016 Ga0157376_10101819
1017 Ga0157376_10125380
1018 Ga0157376_10141487
1019 Ga0157376_10186363
1020 Ga0157376_10361820
1021 Ga0157376_11168606
1022 Ga0163161_10023000
1023 Ga0163161_10194301
1024 Ga0206350_10028588
1025 Ga0213873_10000001
1026 Ga0213873_10000239
1027 Ga0213876_10000002
1028 Ga0213876_10000045
1029 Ga0213876_10003099
1030 Ga0213876_10047908
1031 Ga0209233_1004869
1032 Ga0207656_10008149
1033 Ga0207656_10039586
1034 Ga0207656_10050154
1035 Ga0207655_1046735
1036 Ga0207710_10005055
1037 Ga0207680_10265872
1038 Ga0207680_10735293
1039 Ga0207647_10071061
1040 Ga0207647_10154053
1041 Ga0207699_10922828
1042 Ga0207645_10009148
1043 Ga0207645_10399938
1044 Ga0207705_10000109
1045 Ga0207705_10041065
1046 Ga0207705_10045043
1047 Ga0207705_10101945
1048 Ga0207705_10159238
1049 Ga0207705_10959273
1050 Ga0207705_11314992
1051 Ga0207684_10093003
1052 Ga0207654_10000368
1053 Ga0207654_10001586
1054 Ga0207654_10004565
1055 Ga0207654_10300227
1056 Ga0207707_10552270
1057 Ga0207707_11409950
1058 Ga0207695_10000001
1059 Ga0207695_10000030
1060 Ga0207695_10000259
1061 Ga0207695_10000537
1062 Ga0207695_10000877
1063 Ga0207695_10002346
1064 Ga0207695_10035688
1065 Ga0207695_10063181
1066 Ga0207695_10212622
1067 Ga0207695_10539891
1068 Ga0207695_11725218
1069 Ga0207671_10001200
1070 Ga0207671_10003815
1071 Ga0207671_10132837
1072 Ga0207671_10301090
1073 Ga0207671_10394484
1074 Ga0207693_10510757
1075 Ga0207660_10470074
1076 Ga0207662_10021000
1077 Ga0207662_10232786
1078 Ga0207657_10570660
1079 Ga0207657_10707725
1080 Ga0207649_10009534
1081 Ga0207649_10009963
1082 Ga0207649_10035372
1083 Ga0207649_10196221
1084 Ga0207649_10327785
1085 Ga0207652_10003180
1086 Ga0207652_10120210
1087 Ga0207646_10071262
1088 Ga0207646_10082286
1089 Ga0207646_10576979
1090 Ga0207646_10688845
1091 Ga0207646_11023241
1092 Ga0207681_10196128
1093 Ga0207694_10000002
1094 Ga0207694_10000003
1095 Ga0207694_10000181
1096 Ga0207694_10000770
1097 Ga0207694_10003285
1098 Ga0207694_10011540
1099 Ga0207694_10271073
1100 Ga0207694_10353729
1101 Ga0207650_10000141
1102 Ga0207650_10028219
1103 Ga0207659_10000001
1104 Ga0207659_11276805
1105 Ga0207687_10000035
1106 Ga0207687_10000199
1107 Ga0207687_10000637
1108 Ga0207687_10070218
1109 Ga0207700_10015197
1110 Ga0207700_10237802
1111 Ga0207700_10762199
1112 Ga0207700_11042614
1113 Ga0207664_10090316
1114 Ga0207664_10438743
1115 Ga0207664_11127638
1116 Ga0207644_10001417
1117 Ga0207690_10086668
1118 Ga0207706_10069519
1119 Ga0207709_10593127
1120 Ga0207670_10000785
1121 Ga0207670_10241013
1122 Ga0207670_10391947
1123 Ga0207669_10031420
1124 Ga0207704_10043264
1125 Ga0207704_10491575
1126 Ga0207665_10042185
1127 Ga0207665_10087456
1128 Ga0207665_10502831
1129 Ga0207691_10005878
1130 Ga0207691_10270004
1131 Ga0207691_10634658
1132 Ga0207711_10025974
1133 Ga0207711_10077940
1134 Ga0207689_10002258
1135 Ga0207689_10156365
1136 Ga0207689_10344390
1137 Ga0207689_10486357
1138 Ga0207661_10000002
1139 Ga0207661_10056839
1140 Ga0207661_10384788
1141 Ga0207679_10039884
1142 Ga0207679_10208295
1143 Ga0207679_10565231
1144 Ga0207667_10002563
1145 Ga0207667_10003145
1146 Ga0207667_10004516
1147 Ga0207667_10047117
1148 Ga0207667_10054381
1149 Ga0207667_10267139
1150 Ga0207667_10360620
1151 Ga0207667_10387649
1152 Ga0207667_10558379
1153 Ga0207667_10830454
1154 Ga0207667_11744505
1155 Ga0207651_10037175
1156 Ga0207640_10017980
1157 Ga0207640_10129558
1158 Ga0207640_10363293
1159 Ga0207640_10519668
1160 Ga0207658_10000811
1161 Ga0207658_10101686
1162 Ga0207677_10000038
1163 Ga0207677_10000242
1164 Ga0207677_10000358
1165 Ga0207677_10423121
1166 Ga0207677_10676937
1167 Ga0207703_10000543
1168 Ga0207703_10004751
1169 Ga0207703_10339674
1170 Ga0207639_10000048
1171 Ga0207639_10000101
1172 Ga0207639_10003654
1173 Ga0207639_10114089
1174 Ga0207639_10215434
1175 Ga0207678_10242598
1176 Ga0207678_10746571
1177 Ga0207678_11120541
1178 Ga0207708_10000050
1179 Ga0207702_10002585
1180 Ga0207702_10003045
1181 Ga0207702_10032978
1182 Ga0207702_10043948
1183 Ga0207702_10101964
1184 Ga0207702_10117045
1185 Ga0207702_10892345
1186 Ga0207641_10003995
1187 Ga0207648_10338905
1188 Ga0207676_10000002
1189 Ga0207676_10001904
1190 Ga0207674_10001897
1191 Ga0207674_10002588
1192 Ga0207674_10064046
1193 Ga0207674_10082192
1194 Ga0207675_100018595
1195 Ga0207683_10000600
1196 Ga0207683_10538383
1197 Ga0207683_11120452
1198 Ga0207698_10000263
1199 Ga0207698_10000268
1200 Ga0207698_10012627
1201 Ga0207698_10080346
1202 Ga0207698_10175551
1203 Ga0207698_10303619
1204 Ga0207698_10672091
1205 Ga0207698_10752575
1206 Ga0207698_11423074
1207 Ga0207698_12461097
1208 Ga0268266_10104052
1209 Ga0268266_10151837
1210 Ga0268266_10292986
1211 Ga0268266_10894892
1212 Ga0268265_10040922
1213 Ga0268264_10009127
1214 Ga0265338_10006322
1215 Ga0265338_10108662
1216 Ga0265338_10385729
1217 Ga0307511_10001241
1218 Ga0265770_1104004
1219 Ga0265332_10273549
1220 Ga0265328_10042435
1221 Ga0265328_10110817
1222 Ga0265320_10214541
1223 Ga0265325_10076382
1224 Ga0265325_10128623
1225 Ga0265340_10022014
1226 Ga0265339_10000102
1227 Ga0265339_10002713
1228 Ga0265339_10124319
1229 Ga0265331_10064262
1230 Ga0265316_10028872
1231 Ga0265316_10035281
1232 Ga0265313_10009409
1233 Ga0265313_10016220
1234 Ga0265313_10046928
1235 Ga0265313_10202621
1236 Ga0265314_10010478
1237 Ga0265342_10003244
1238 Ga0265342_10029167
1239 Ga0265342_10033310
1240 Ga0265342_10123066
1241 Ga0307416_100111297
1242 Ga0307416_100740464
1243 Ga0307416_101633261
1244 Ga0316583_10100578
1245 Ga0373932_0000038
1246 Ga0373941_0036024
1247 Ga0373954_0512120
1248 Ga0373946_0230427
1249 Ga0373955_0155937
1250 Ga0373924_0413163
1251 Ga0373931_0953694
1252 Ga0373933_0504556
1253 Ga0373937_0005175
1254 Ga0373937_0310011
1255 Ga0373937_0369877
1256 Ga0373937_1633333
1257 Ga0395900_0961712
1258 Ga0395905_0010275
1259 Ga0395905_0116557
1260 Ga0436364_0596452
1261 Ga0395901_1819856
1262 Ga0436365_0119666
1263 Ga0436365_0407814
1264 Ga0436365_0698156
1265 Ga0436365_0895411
1266 Ga0436365_1159326
1267 Ga0436365_1500666
1268 Ga0436365_1730877
1269 Ga0436362_0276211
1270 Ga0436362_0984254
1271 Ga0451839_1373062
1272 Ga0451853_2377832
1273 Ga0451577_0091948
1274 Ga0466966_0072063
1275 Ga0466966_0408578
1276 Ga0466963_0010611
1277 Ga0466963_1057141
1278 Ga0451576_0704943
1279 Ga0466967_0025903
1280 Ga0466967_0167459
1281 Ga0495629_0585628
1282 Ga0495580_0039510
1283 Ga0495620_0016537
1284 Ga0495652_0140818
1285 Ga0495640_0600062
1286 Ga0495645_0159740
1287 Ga0495659_0006379
1288 Ga0495623_0239180
1289 Ga0495669_0044969
1290 Ga0495613_0516954
1291 Ga0495672_0004803
1292 Ga0495679_030005
1293 Ga0495684_0345027
1294 Ga0495686_0000006
1295 Ga0495686_0001113
1296 Ga0495686_0001457
1297 Ga0495686_0032071
1298 Ga0495686_0171760
1299 Ga0496100_0144512
1300 Ga0496100_0506189
1301 Ga0496104_0011203
1302 Ga0496104_0037784
1303 Ga0496104_0145247
1304 Ga0496105_0249429
1305 Ga0496105_0523837
1306 Ga0496106_1058448
1307 Ga0496109_0573427
1308 Ga0496111_0737278
1309 Ga0496112_0658875
1310 Ga0496114_0715330
1311 Ga0496115_0012654
1312 Ga0496115_0068390
1313 Ga0496120_0212996
1314 Ga0496126_0000085
1315 Ga0496126_0357839
1316 Ga0496126_1075815
1317 Ga0495682_0150632
1318 Ga0501031_0046555
1319 Ga0501032_0001186
1320 Ga0501033_0013422
1321 Ga0501034_0005607
1322 Ga0501036_0013543
1323 Ga0501037_0003398
1324 Ga0501037_0395865
1325 Ga0501038_0000661
1326 Ga0501039_0075517
1327 Ga0501043_0000632
1328 Ga0501046_0000036
1329 Ga0501048_0834131
1330 Ga0501070_0412749
1331 Ga0501070_0455320
1332 Ga0501073_0048226
1333 Ga0501080_0005167
1334 Ga0501080_0009240
1335 Ga0501080_1728350
1336 Ga0501035_0003113
1337 Ga0501035_0779846
1338 Ga0501044_0010234
1339 nmdc:mga05p37_1788328_c1
1340 nmdc:mga05p37_254011_c1
1341 nmdc:mga06r32_514_c1
1342 nmdc:mga0n895_273154_c1
1343 nmdc:mga0n895_285357_c1
1344 nmdc:mga0rr50_192_c1
1345 nmdc:mga08x19_538715_c1
1346 nmdc:mga08x19_840633_c1
1347 Ga0495655_0003860
1348 2884218591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

30

180

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7741 1 148
8q9t-assembly1.cif.gz_A cryoem structure of a s. cerevisiae ski238 complex bound to rna 0.6419 24 88
2c41-assembly1.cif.gz_C x-ray structure of dps from thermosynechococcus elongatus 0.6392 22 90
3sjr-assembly2.cif.gz_C crystal structure of conserved unkown function protein cv_1783 from chromobacterium violaceum atcc 12472 0.6058 9 89
8e0m-assembly3.cif.gz_G homotrimeric variant of tctrp9, bgl15 0.5451 5 91
ID Description Score Start End Superfamily
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9754 3 91 1.10.1510.10
2yxyA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Hypothetical protein YfhH domain 0.955 51 91 1.10.287.880
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.949 4 91 1.10.1510.10
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.935 92 148 1.10.10.410
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9341 3 91 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A6J4UCE8-F1-model_v4 Transamidase GatB domain protein 0.9677 4 148 GO:0016884
AF-A0A2A5HPX5-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9526 1 147 GO:0016740
GO:0016884
AF-A0A2G9YFJ0-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9493 4 147 GO:0016740
GO:0016884
AF-A0A0G0BG76-F1-model_v4 GatB/Yqey domain protein 0.9488 1 148 GO:0016884
AF-A0A250X199-F1-model_v4 Altered inheritance of mitochondria protein 41 0.9456 4 147 GO:0016884

Map