F474397

General Info

Members Datasets Scaffolds Average Seq Length
674 374 1348 171

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0000022|Ga0501034_0000022_253051_253647
Length 198
Sequence MAFPRPPASRTIFLLHLTDEVSLNMRRLLSVTLTGMATVPFAGPVLAADLNVKVEIPRLNVAEYHKPYVAMWVERADQGPVQTLAVWYDGKLKENEGTKWLKDMRQWWRKAGRDLNMPADGISGATRAPGEHTVSFRDGKNPLGKLPAGDYQLVVEAAREVGGRELVRVPFTWPPQSAQTARARGDHELGGVTVDLKP

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
58 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
87 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
137 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
138 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
148 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
164 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
165 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
166 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
167 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
168 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
172 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
173 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
174 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
175 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
176 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
177 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
178 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
179 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
180 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
219 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
220 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
239 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
263 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
279 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
280 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
281 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
282 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
283 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
284 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
285 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
286 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
287 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
288 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
289 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
290 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
293 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
295 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
300 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
301 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
302 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
303 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
304 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
305 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
306 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
307 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
308 2547132512 Azospira oryzae 6a3 Isolate Unclassified
309 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
310 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
311 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
312 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
313 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
314 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
315 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
316 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
317 2643221611 Acidovorax sp. Root219 Isolate Unclassified
318 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
319 2643221660 Methylibium sp. Root1272 Isolate Unclassified
320 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
321 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
322 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
323 2721755523 Delftia sp. HK171 Isolate Unclassified
324 2734482264 Dyella sp. AD052 Isolate Unclassified
325 2738543009 Luteibacter sp. OK325 Isolate Unclassified
326 2738543012 Acidovorax sp. CF301 Isolate Unclassified
327 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
328 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
329 2816332133 Acidovorax radicis 2721A Isolate Unclassified
330 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
331 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
332 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
333 2831864461 Roseateles noduli HZ7 Isolate Nodule
334 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
335 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
336 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
337 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
338 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
339 2849560528 Caulobacter zeae 410 Isolate Unclassified
340 2851153111 Caulobacter radicis 736 Isolate Unclassified
341 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
342 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
343 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
344 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
345 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
346 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
347 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
348 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
349 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
350 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
351 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
352 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
353 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
354 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
355 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
356 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
357 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
358 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
359 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
360 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
361 2919085039 Luteibacter sp. 1214 Isolate Unclassified
362 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
363 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
364 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
365 2941471342 Luteibacter sp. 621 Isolate Unclassified
366 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
367 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
368 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
369 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
370 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
371 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
372 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
373 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
374 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.87
Metatranscriptomes 0
Isolates 11.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.29
Nodule 2.97
Rhizoplane 1.63
Rhizosphere 57.57
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0000022 3300049571 Bacteria 264441
2 JGI24736J21556_1002736 3300001904 Bacteria 3085
3 JGI24740J21852_10009636 3300001979 Bacteria 3769
4 JGI24735J21928_10033649 3300002067 Bacteria 1513
5 JGI25156J39149_1000112 3300002705 Bacteria 59192
6 JGI25156J39149_1000128 3300002705 Bacteria 56012
7 JGI25156J39149_1002904 3300002705 Bacteria 5855
8 JGI25162J39368_1004893 3300002737 Bacteria 2871
9 JGI25154J39366_1000125 3300002738 Bacteria 61587
10 JGI25154J39366_1000143 3300002738 Bacteria 56016
11 JGI25154J39366_1000228 3300002738 Bacteria 37567
12 JGI25157J39369_1000134 3300002741 Bacteria 61613
13 JGI25157J39369_1020182 3300002741 Bacteria 797
14 JGI25151J46595_10003380 3300003187 Bacteria 8833
15 JGI25151J46595_10021364 3300003187 Bacteria 2710
16 JGI25151J46595_10075606 3300003187 Bacteria 998
17 rootH2_10006506 3300003320 Bacteria 13860
18 rootH2_10225852 3300003320 Bacteria 1130
19 rootL2_10000651 3300003322 Bacteria 23314
20 rootH1_10078092 3300003323 Bacteria 1889
21 rootH1_10194283 3300003323 Bacteria 1452
22 Ga0055533_1006056 3300003756 Bacteria 1841
23 Ga0055532_1000101 3300003758 Bacteria 92881
24 Ga0055535_1006661 3300003761 Bacteria 2307
25 Ga0055526_1000535 3300003771 Bacteria 30070
26 Ga0055526_1004129 3300003771 Bacteria 8858
27 Ga0055526_1004782 3300003771 Bacteria 8019
28 Ga0055526_1039208 3300003771 Bacteria 1209
29 Ga0055537_1002025 3300003773 Bacteria 7205
30 Ga0055524_1000007 3300003775 Bacteria 298766
31 Ga0055524_1016574 3300003775 Bacteria 2636
32 Ga0055524_1031489 3300003775 Bacteria 1524
33 Ga0055536_1000078 3300003781 Bacteria 83510
34 Ga0055534_1000733 3300003784 Bacteria 15839
35 Ga0055534_1002174 3300003784 Bacteria 7000
36 Ga0055530_10001592 3300003791 Bacteria 16245
37 Ga0055540_1000042 3300003792 Bacteria 156410
38 Ga0055531_10001613 3300003794 Bacteria 16357
39 Ga0055531_10001667 3300003794 Bacteria 16000
40 Ga0055543_1003956 3300004625 Bacteria 4177
41 Ga0055543_1006647 3300004625 Bacteria 2762
42 Ga0065165_1000079 3300005262 Bacteria 162095
43 Ga0065165_1000405 3300005262 Bacteria 69154
44 Ga0065165_1000482 3300005262 Bacteria 61748
45 Ga0065165_1016998 3300005262 Bacteria 2699
46 Ga0065714_10254944 3300005288 Bacteria 758
47 Ga0065704_10080515 3300005289 Bacteria 3933
48 Ga0065704_10099871 3300005289 Bacteria 2294
49 Ga0070670_100146194 3300005331 Bacteria 2045
50 Ga0070666_10000018 3300005335 Bacteria 187218
51 Ga0070674_100371103 3300005356 Bacteria 1161
52 Ga0070674_100624546 3300005356 Bacteria 913
53 Ga0070667_100168040 3300005367 Bacteria 1935
54 Ga0070694_100430287 3300005444 Bacteria 1038
55 Ga0070678_100532907 3300005456 Bacteria 1040
56 Ga0070662_100086628 3300005457 Bacteria 2343
57 Ga0068853_101029177 3300005539 Bacteria 793
58 Ga0070665_100031056 3300005548 Bacteria 5376
59 Ga0068855_100119522 3300005563 Bacteria 3017
60 Ga0068855_100470313 3300005563 Bacteria 1370
61 Ga0068857_100146157 3300005577 Bacteria 2139
62 Ga0068854_101093607 3300005578 Bacteria 710
63 Ga0068856_100637915 3300005614 Bacteria 1086
64 Ga0068852_100043837 3300005616 Bacteria 3796
65 Ga0068861_100022802 3300005719 Bacteria 4513
66 Ga0068851_10685095 3300005834 Bacteria 630
67 Ga0068870_10638682 3300005840 Bacteria 728
68 Ga0068863_101393182 3300005841 Bacteria 709
69 Ga0068858_100179544 3300005842 Bacteria 1998
70 Ga0068858_100247571 3300005842 Bacteria 1693
71 Ga0068860_100232117 3300005843 Bacteria 1793
72 Ga0068860_100945086 3300005843 Bacteria 879
73 Ga0068862_100267778 3300005844 Bacteria 1562
74 Ga0068862_100619448 3300005844 Bacteria 1041
75 Ga0075365_10002161 3300006038 Bacteria 9457
76 Ga0075368_10085527 3300006042 Bacteria 1286
77 Ga0075368_10237850 3300006042 Bacteria 776
78 Ga0075363_100022892 3300006048 Bacteria 3162
79 Ga0075363_100333590 3300006048 Bacteria 884
80 Ga0075363_100408099 3300006048 Bacteria 799
81 Ga0075364_10099340 3300006051 Bacteria 1937
82 Ga0075367_10011481 3300006178 Bacteria 4690
83 Ga0075367_10075075 3300006178 Bacteria 2039
84 Ga0075367_10370936 3300006178 Bacteria 904
85 Ga0075366_10068254 3300006195 Bacteria 2115
86 Ga0075366_10139572 3300006195 Bacteria 1465
87 Ga0075366_10139853 3300006195 Bacteria 1463
88 Ga0075366_10331776 3300006195 Bacteria 932
89 Ga0075370_10005249 3300006353 Bacteria 6413
90 Ga0075370_10005703 3300006353 Bacteria 6212
91 Ga0075370_10021246 3300006353 Bacteria 3556
92 Ga0075430_100216334 3300006846 Bacteria 1590
93 Ga0075430_100280271 3300006846 Bacteria 1379
94 Ga0099824_1031132 3300006942 Bacteria 2059
95 Ga0099823_1000002 3300006944 Bacteria 212272
96 Ga0079104_1000002 3300006946 Bacteria 514469
97 Ga0079104_1000012 3300006946 Bacteria 355143
98 Ga0099826_10000009 3300006948 Bacteria 336081
99 Ga0099826_10000052 3300006948 Bacteria 73156
100 Ga0105251_10010122 3300009011 Bacteria 5500
101 Ga0105251_10399583 3300009011 Bacteria 632
102 Ga0105244_10106922 3300009036 Bacteria 1364
103 Ga0105244_10183947 3300009036 Bacteria 990
104 Ga0105244_10275385 3300009036 Bacteria 781
105 Ga0105240_10001934 3300009093 Bacteria 34352
106 Ga0105240_10168317 3300009093 Bacteria 2597
107 Ga0105247_10128799 3300009101 Bacteria 1648
108 Ga0105243_10005055 3300009148 Bacteria 10350
109 Ga0105242_10280134 3300009176 Bacteria 1514
110 Ga0105248_10038811 3300009177 Bacteria 5331
111 Ga0105237_10000797 3300009545 Bacteria 43129
112 Ga0105238_10000319 3300009551 Bacteria 52428
113 Ga0105238_10004630 3300009551 Bacteria 13621
114 Ga0105238_10017899 3300009551 Bacteria 7204
115 Ga0105249_10020688 3300009553 Bacteria 5884
116 Ga0105239_10087577 3300010375 Bacteria 3433
117 Ga0105239_10515226 3300010375 Bacteria 1360
118 Ga0157319_1000007 3300012497 Bacteria 318528
119 Ga0157373_10153065 3300013100 Bacteria 1622
120 Ga0157370_10005446 3300013104 Bacteria 14278
121 Ga0157369_10000580 3300013105 Bacteria 47824
122 Ga0163162_10030575 3300013306 Bacteria 5336
123 Ga0163162_10033887 3300013306 Bacteria 5078
124 Ga0157375_10442276 3300013308 Bacteria 1466
125 Ga0157380_10090734 3300014326 Bacteria 2521
126 Ga0182008_10002417 3300014497 Bacteria 11719
127 Ga0182008_10008058 3300014497 Bacteria 5773
128 Ga0157379_10754203 3300014968 Bacteria 916
129 Ga0157376_10461978 3300014969 Bacteria 1240
130 Ga0182006_1000002 3300015261 Bacteria 887990
131 Ga0182006_1000031 3300015261 Bacteria 240055
132 Ga0182006_1000847 3300015261 Bacteria 20577
133 Ga0182006_1001950 3300015261 Bacteria 11702
134 Ga0182006_1071161 3300015261 Bacteria 1289
135 Ga0182007_10001827 3300015262 Bacteria 11105
136 Ga0182007_10002777 3300015262 Bacteria 8548
137 Ga0182007_10020516 3300015262 Bacteria 2361
138 Ga0182007_10029289 3300015262 Bacteria 1886
139 Ga0182007_10055108 3300015262 Bacteria 1307
140 Ga0182005_1000029 3300015265 Bacteria 214132
141 Ga0182005_1000352 3300015265 Bacteria 26091
142 Ga0182005_1000434 3300015265 Bacteria 22191
143 Ga0163161_10004612 3300017792 Bacteria 9591
144 Ga0163161_10637301 3300017792 Bacteria 882
145 Ga0163161_10647303 3300017792 Bacteria 875
146 Ga0209435_100016 3300025206 Bacteria 305566
147 Ga0209435_100101 3300025206 Bacteria 35039
148 Ga0209674_101336 3300025226 Bacteria 6759
149 Ga0209147_100023 3300025229 Bacteria 437803
150 Ga0209147_103555 3300025229 Bacteria 2967
151 Ga0209437_100166 3300025233 Bacteria 144787
152 Ga0209258_100345 3300025242 Bacteria 67870
153 Ga0209646_1000033 3300025246 Bacteria 369507
154 Ga0209646_1000093 3300025246 Bacteria 183840
155 Ga0209026_1000031 3300025250 Bacteria 325747
156 Ga0209026_1000870 3300025250 Bacteria 15779
157 Ga0209148_1008635 3300025254 Bacteria 2037
158 Ga0209759_1000227 3300025256 Bacteria 84278
159 Ga0209759_1000346 3300025256 Bacteria 60977
160 Ga0209565_1000094 3300025263 Bacteria 134853
161 Ga0209565_1004914 3300025263 Bacteria 3983
162 Ga0209455_1010811 3300025272 Bacteria 2293
163 Ga0209673_1006810 3300025273 Bacteria 5426
164 Ga0209673_1023583 3300025273 Bacteria 2090
165 Ga0209675_1000087 3300025291 Bacteria 147632
166 Ga0209675_1001508 3300025291 Bacteria 13319
167 Ga0209675_1004217 3300025291 Bacteria 6491
168 Ga0209675_1013469 3300025291 Bacteria 2552
169 Ga0209675_1028130 3300025291 Bacteria 1371
170 Ga0209676_1000176 3300025292 Bacteria 152347
171 Ga0209025_1000046 3300025294 Bacteria 348962
172 Ga0209025_1000123 3300025294 Bacteria 204125
173 Ga0209025_1000764 3300025294 Bacteria 53509
174 Ga0209025_1008843 3300025294 Bacteria 7147
175 Ga0209025_1057007 3300025294 Bacteria 1497
176 Ga0209564_1000030 3300025295 Bacteria 503296
177 Ga0209564_1000166 3300025295 Bacteria 160208
178 Ga0209564_1001192 3300025295 Bacteria 29807
179 Ga0209564_1001289 3300025295 Bacteria 27413
180 Ga0209758_1014801 3300025297 Bacteria 4109
181 Ga0209050_1001487 3300025298 Bacteria 24916
182 Ga0209050_1002014 3300025298 Bacteria 18937
183 Ga0209256_1000005 3300025299 Bacteria 1315082
184 Ga0209256_1000030 3300025299 Bacteria 414828
185 Ga0209256_1000432 3300025299 Bacteria 65073
186 Ga0209256_1000960 3300025299 Bacteria 34857
187 Ga0209256_1001426 3300025299 Bacteria 24827
188 Ga0209256_1002066 3300025299 Bacteria 17690
189 Ga0209256_1034134 3300025299 Bacteria 1359
190 Ga0207426_1024982 3300025302 Bacteria 2019
191 Ga0209051_1000004 3300025303 Bacteria 1155596
192 Ga0209051_1001383 3300025303 Bacteria 20933
193 Ga0209051_1009602 3300025303 Bacteria 4968
194 Ga0209051_1027983 3300025303 Bacteria 2236
195 Ga0209051_1035742 3300025303 Bacteria 1844
196 Ga0209257_1000063 3300025304 Bacteria 359089
197 Ga0209257_1002063 3300025304 Bacteria 21217
198 Ga0209257_1002789 3300025304 Bacteria 16469
199 Ga0207713_1017282 3300025735 Bacteria 3625
200 Ga0207642_10065029 3300025899 Bacteria 1712
201 Ga0207710_10002899 3300025900 Bacteria 7799
202 Ga0207710_10350156 3300025900 Bacteria 752
203 Ga0207688_10075061 3300025901 Bacteria 1924
204 Ga0207680_10000002 3300025903 Bacteria 1018646
205 Ga0207647_10000008 3300025904 Bacteria 192602
206 Ga0207645_10652017 3300025907 Bacteria 715
207 Ga0207705_10007929 3300025909 Bacteria 7794
208 Ga0207695_10001378 3300025913 Bacteria 41129
209 Ga0207695_10002689 3300025913 Bacteria 25925
210 Ga0207695_10018810 3300025913 Bacteria 7971
211 Ga0207671_10008460 3300025914 Bacteria 8723
212 Ga0207649_10085238 3300025920 Bacteria 2056
213 Ga0207649_10124763 3300025920 Bacteria 1741
214 Ga0207694_10000388 3300025924 Bacteria 40972
215 Ga0207694_10002955 3300025924 Bacteria 13648
216 Ga0207650_10086097 3300025925 Bacteria 2392
217 Ga0207706_10331995 3300025933 Bacteria 1323
218 Ga0207709_10000015 3300025935 Bacteria 493221
219 Ga0207669_10349706 3300025937 Bacteria 1141
220 Ga0207711_10016483 3300025941 Bacteria 6139
221 Ga0207667_10056339 3300025949 Bacteria 4129
222 Ga0207667_10131976 3300025949 Bacteria 2573
223 Ga0207667_10691320 3300025949 Bacteria 1023
224 Ga0207712_10258726 3300025961 Bacteria 1410
225 Ga0207668_10005187 3300025972 Bacteria 7663
226 Ga0207640_10004825 3300025981 Bacteria 7325
227 Ga0207658_10627118 3300025986 Bacteria 967
228 Ga0207703_10259667 3300026035 Bacteria 1570
229 Ga0207678_10297556 3300026067 Bacteria 1386
230 Ga0207674_10274526 3300026116 Bacteria 1633
231 Ga0207674_10300170 3300026116 Bacteria 1555
232 Ga0207675_100035947 3300026118 Bacteria 4621
233 Ga0207675_101297181 3300026118 Bacteria 749
234 Ga0207683_10523963 3300026121 Bacteria 1095
235 Ga0207698_10003707 3300026142 Bacteria 9237
236 Ga0209281_1000007 3300027111 Bacteria 938265
237 Ga0209281_1000039 3300027111 Bacteria 355150
238 Ga0209389_1002519 3300027296 Bacteria 14139
239 Ga0209371_1030596 3300027312 Bacteria 1178
240 Ga0209970_1008497 3300027614 Bacteria 1682
241 Ga0209983_1005646 3300027665 Bacteria 2580
242 Ga0209282_1000001 3300027666 Bacteria 2450367
243 Ga0209282_1000017 3300027666 Bacteria 191482
244 Ga0268266_10000004 3300028379 Bacteria 1495817
245 Ga0268266_10240152 3300028379 Bacteria 1672
246 Ga0268265_10669325 3300028380 Bacteria 1000
247 Ga0268264_10207611 3300028381 Bacteria 1796
248 Ga0268264_10918440 3300028381 Bacteria 879
249 Ga0307517_10206855 3300028786 Bacteria 1216
250 Ga0307515_10000567 3300028794 Bacteria 87086
251 Ga0307515_10001764 3300028794 Bacteria 48206
252 Ga0307515_10006103 3300028794 Bacteria 24230
253 Ga0307515_10032674 3300028794 Bacteria 8606
254 Ga0268256_1009564 3300030500 Bacteria 3201
255 Ga0307512_10021151 3300030522 Bacteria 5870
256 Ga0265332_10000010 3300031238 Bacteria 289041
257 Ga0307513_10002614 3300031456 Bacteria 24859
258 Ga0307513_10023800 3300031456 Bacteria 7146
259 Ga0307513_10359277 3300031456 Bacteria 1202
260 Ga0307509_10022947 3300031507 Bacteria 7018
261 Ga0307408_100015990 3300031548 Bacteria 5003
262 Ga0307408_100029014 3300031548 Bacteria 3829
263 Ga0307408_100943449 3300031548 Bacteria 792
264 Ga0307508_10000133 3300031616 Bacteria 87867
265 Ga0307508_10079502 3300031616 Bacteria 2860
266 Ga0307514_10004805 3300031649 Bacteria 12315
267 Ga0307516_10000253 3300031730 Bacteria 68852
268 Ga0307516_10013972 3300031730 Bacteria 8521
269 Ga0307412_10000608 3300031911 Bacteria 21074
270 Ga0307412_10768968 3300031911 Bacteria 833
271 Ga0307416_101788959 3300032002 Bacteria 718
272 Ga0307414_10009304 3300032004 Bacteria 5635
273 Ga0307411_10107837 3300032005 Bacteria 1986
274 Ga0307507_10029260 3300033179 Bacteria 5846
275 Ga0307510_10001599 3300033180 Bacteria 25051
276 Ga0395905_0219689 3300037471 Bacteria 1778
277 Ga0400483_135774 3300039062 Bacteria 2260
278 Ga0400483_241741 3300039062 Bacteria 8426
279 Ga0439436_0000022 3300041404 Bacteria 60408
280 Ga0451795_0071722 3300041456 Bacteria 802
281 Ga0451835_0702106 3300041492 Bacteria 1312
282 Ga0451845_0298471 3300041501 Bacteria 675
283 Ga0451843_1377075 3300041509 Bacteria 879
284 Ga0451853_1603597 3300041512 Bacteria 1472
285 Ga0439445_0004322 3300042004 Bacteria 3215
286 Ga0450890_002465 3300042127 Bacteria 2546
287 Ga0450892_000837 3300042130 Bacteria 3378
288 Ga0450889_000111 3300042144 Bacteria 8052
289 Ga0450906_041829 3300042145 Bacteria 809
290 Ga0450908_000261 3300042184 Bacteria 10417
291 Ga0439459_0000041 3300042438 Bacteria 10569
292 Ga0450916_000906 3300042530 Bacteria 2825
293 Ga0450893_0044706 3300042532 Bacteria 818
294 Ga0439440_0035434 3300042993 Bacteria 1197
295 Ga0466982_0000049 3300044672 Bacteria 36295
296 Ga0466963_0006616 3300044694 Bacteria 6875
297 Ga0466968_0013434 3300044735 Bacteria 3221
298 Ga0466968_0119663 3300044735 Bacteria 1190
299 Ga0466957_0013309 3300044842 Bacteria 4772
300 Ga0466957_0026700 3300044842 Bacteria 3427
301 Ga0466967_0451957 3300045976 Bacteria 1256
302 Ga0495617_000120 3300046452 Bacteria 52244
303 Ga0495617_000348 3300046452 Bacteria 25506
304 Ga0495590_0107430 3300046457 Bacteria 994
305 Ga0495638_0000564 3300046460 Bacteria 42120
306 Ga0495650_0000011 3300046471 Bacteria 615329
307 Ga0495650_0000637 3300046471 Bacteria 46877
308 Ga0495650_0004416 3300046471 Bacteria 9650
309 Ga0495650_0005076 3300046471 Bacteria 8711
310 Ga0495650_0013995 3300046471 Bacteria 4207
311 Ga0495605_0028815 3300046474 Bacteria 2863
312 Ga0495584_0000688 3300046491 Bacteria 22464
313 Ga0495584_0006451 3300046491 Bacteria 6139
314 Ga0495585_0006964 3300046492 Bacteria 6961
315 Ga0495596_0000070 3300046500 Bacteria 75962
316 Ga0495607_0000090 3300046501 Bacteria 94252
317 Ga0495607_0000244 3300046501 Bacteria 58158
318 Ga0495607_0058090 3300046501 Bacteria 2214
319 Ga0495583_0014440 3300046506 Bacteria 4357
320 Ga0495606_0000218 3300046507 Bacteria 101645
321 Ga0495606_0001182 3300046507 Bacteria 36798
322 Ga0495606_0004271 3300046507 Bacteria 14422
323 Ga0495606_0052282 3300046507 Bacteria 2658
324 Ga0495606_0070176 3300046507 Bacteria 2210
325 Ga0495606_0141397 3300046507 Bacteria 1421
326 Ga0495610_0000277 3300046512 Bacteria 53626
327 Ga0495610_0001156 3300046512 Bacteria 24006
328 Ga0495610_0035249 3300046512 Bacteria 2571
329 Ga0495610_0142818 3300046512 Bacteria 1028
330 Ga0495616_0000006 3300046513 Bacteria 234766
331 Ga0495616_0001909 3300046513 Bacteria 14059
332 Ga0495616_0041065 3300046513 Bacteria 2361
333 Ga0495616_0065467 3300046513 Bacteria 1770
334 Ga0495620_0000806 3300046515 Bacteria 19267
335 Ga0495620_0009092 3300046515 Bacteria 5301
336 Ga0495631_0000820 3300046518 Bacteria 19864
337 Ga0495631_0014388 3300046518 Bacteria 3819
338 Ga0495632_0010885 3300046519 Bacteria 5347
339 Ga0495632_0025389 3300046519 Bacteria 3134
340 Ga0495637_0008754 3300046520 Bacteria 4959
341 Ga0495637_0104759 3300046520 Bacteria 1102
342 Ga0495643_0079344 3300046522 Bacteria 1711
343 Ga0495648_0000334 3300046524 Bacteria 51958
344 Ga0495648_0002324 3300046524 Bacteria 17692
345 Ga0495609_0008576 3300046538 Bacteria 4995
346 Ga0495609_0013246 3300046538 Bacteria 3899
347 Ga0495633_0000305 3300046558 Bacteria 55923
348 Ga0495633_0060118 3300046558 Bacteria 1781
349 Ga0495656_0025926 3300046615 Bacteria 2329
350 Ga0495668_0002024 3300046616 Bacteria 17702
351 Ga0495611_0000001 3300046648 Bacteria 2628469
352 Ga0495611_0000126 3300046648 Bacteria 53596
353 Ga0495625_0000200 3300046660 Bacteria 95445
354 Ga0495625_0000452 3300046660 Bacteria 61641
355 Ga0495625_0001333 3300046660 Bacteria 30655
356 Ga0495625_0004350 3300046660 Bacteria 13456
357 Ga0495625_0050598 3300046660 Bacteria 2981
358 Ga0495625_0184572 3300046660 Bacteria 1385
359 Ga0495625_0398243 3300046660 Bacteria 861
360 Ga0495661_0040309 3300046665 Bacteria 2897
361 Ga0495670_0000526 3300046691 Bacteria 18161
362 Ga0495670_0013489 3300046691 Bacteria 4020
363 Ga0495670_0028409 3300046691 Bacteria 2773
364 Ga0495670_0029855 3300046691 Bacteria 2708
365 Ga0495670_0142427 3300046691 Bacteria 1254
366 Ga0495671_0000457 3300046692 Bacteria 32058
367 Ga0495671_0001886 3300046692 Bacteria 13464
368 Ga0495649_0077961 3300046694 Bacteria 1773
369 Ga0495589_0000008 3300046794 Bacteria 266071
370 Ga0495589_0188993 3300046794 Bacteria 975
371 Ga0495660_0000129 3300046810 Bacteria 83044
372 Ga0495660_0046730 3300046810 Bacteria 2373
373 Ga0495672_0010016 3300047320 Bacteria 6794
374 Ga0495672_0169397 3300047320 Bacteria 1115
375 Ga0495683_0004255 3300047323 Bacteria 8171
376 Ga0495683_0038508 3300047323 Bacteria 2421
377 Ga0495679_000004 3300047446 Bacteria 748056
378 Ga0495685_130051 3300047447 Bacteria 823
379 Ga0495673_0000004 3300047469 Bacteria 1354526
380 Ga0495673_0000041 3300047469 Bacteria 296723
381 Ga0495673_0002539 3300047469 Bacteria 12740
382 Ga0495673_0002704 3300047469 Bacteria 12187
383 Ga0495673_0017017 3300047469 Bacteria 3703
384 Ga0495686_0000108 3300047472 Bacteria 173579
385 Ga0495686_0001764 3300047472 Bacteria 22143
386 Ga0495686_0001911 3300047472 Bacteria 20803
387 Ga0495686_0003220 3300047472 Bacteria 14363
388 Ga0495686_0008150 3300047472 Bacteria 7742
389 Ga0495686_0008342 3300047472 Bacteria 7614
390 Ga0495686_0099252 3300047472 Bacteria 1758
391 Ga0496100_0026786 3300048903 Bacteria 3538
392 Ga0496101_0000399 3300048904 Bacteria 28414
393 Ga0496103_0262270 3300048906 Bacteria 1112
394 Ga0496104_0071049 3300048907 Bacteria 3310
395 Ga0496106_0000716 3300048909 Bacteria 23870
396 Ga0496106_0017532 3300048909 Bacteria 5300
397 Ga0496106_0256073 3300048909 Bacteria 1400
398 Ga0496108_0623598 3300048911 Bacteria 939
399 Ga0496109_0726429 3300048912 Bacteria 931
400 Ga0496116_0002058 3300048919 Bacteria 21537
401 Ga0496116_0008775 3300048919 Bacteria 8720
402 Ga0496116_0025209 3300048919 Bacteria 4376
403 Ga0496117_0181931 3300048920 Bacteria 1207
404 Ga0496118_0002248 3300048921 Bacteria 26506
405 Ga0496118_0005121 3300048921 Bacteria 15059
406 Ga0496118_0107005 3300048921 Bacteria 1869
407 Ga0496121_0001451 3300048924 Bacteria 40023
408 Ga0496121_0001490 3300048924 Bacteria 39440
409 Ga0496121_0001516 3300048924 Bacteria 38982
410 Ga0496121_0003074 3300048924 Bacteria 24167
411 Ga0496121_0003543 3300048924 Bacteria 22104
412 Ga0496121_0003558 3300048924 Bacteria 22042
413 Ga0496121_0006246 3300048924 Bacteria 14921
414 Ga0496121_0007024 3300048924 Bacteria 13676
415 Ga0496121_0041800 3300048924 Bacteria 4000
416 Ga0496121_0187554 3300048924 Bacteria 1486
417 Ga0496121_0373194 3300048924 Bacteria 943
418 Ga0496121_0479508 3300048924 Bacteria 795
419 Ga0496121_0491153 3300048924 Bacteria 782
420 Ga0496122_0000457 3300048925 Bacteria 84895
421 Ga0496122_0003366 3300048925 Bacteria 21050
422 Ga0496122_0024752 3300048925 Bacteria 5243
423 Ga0496122_0081987 3300048925 Bacteria 2242
424 Ga0496123_0000208 3300048926 Bacteria 119807
425 Ga0496123_0000321 3300048926 Bacteria 91682
426 Ga0496123_0009893 3300048926 Bacteria 8510
427 Ga0496123_0018167 3300048926 Bacteria 5611
428 Ga0496124_0061266 3300048927 Bacteria 3154
429 Ga0496124_0497181 3300048927 Bacteria 819
430 Ga0496125_0000383 3300048928 Bacteria 82288
431 Ga0496125_0000464 3300048928 Bacteria 72660
432 Ga0496125_0000895 3300048928 Bacteria 47230
433 Ga0496125_0022596 3300048928 Bacteria 5835
434 Ga0496125_0026144 3300048928 Bacteria 5330
435 Ga0496125_0070787 3300048928 Bacteria 2728
436 Ga0496125_0122306 3300048928 Bacteria 1853
437 Ga0496126_0041831 3300048929 Bacteria 4237
438 Ga0496126_0078991 3300048929 Bacteria 2914
439 Ga0496126_0124680 3300048929 Bacteria 2231
440 Ga0495678_000158 3300049459 Bacteria 81058
441 Ga0495678_002113 3300049459 Bacteria 14106
442 Ga0495682_0099187 3300049460 Bacteria 1045
443 Ga0501031_0017131 3300049568 Bacteria 4707
444 Ga0501031_0183257 3300049568 Bacteria 1367
445 Ga0501032_0004311 3300049569 Bacteria 10743
446 Ga0501032_0010978 3300049569 Bacteria 6512
447 Ga0501032_0049118 3300049569 Bacteria 2847
448 Ga0501032_0052223 3300049569 Bacteria 2754
449 Ga0501032_0103190 3300049569 Bacteria 1889
450 Ga0501032_0116257 3300049569 Bacteria 1768
451 Ga0501032_0373060 3300049569 Bacteria 918
452 Ga0501032_0472475 3300049569 Bacteria 802
453 Ga0501033_0002865 3300049570 Bacteria 14457
454 Ga0501033_0019681 3300049570 Bacteria 5101
455 Ga0501033_0143108 3300049570 Bacteria 1728
456 Ga0501033_0301935 3300049570 Bacteria 1127
457 Ga0501034_0018904 3300049571 Bacteria 7058
458 Ga0501034_0119174 3300049571 Bacteria 2626
459 Ga0501034_0157958 3300049571 Bacteria 2240
460 Ga0501034_0176224 3300049571 Bacteria 2104
461 Ga0501034_0252758 3300049571 Bacteria 1707
462 Ga0501034_0613893 3300049571 Bacteria 992
463 Ga0501037_0036881 3300049573 Bacteria 3603
464 Ga0501037_0075571 3300049573 Bacteria 2446
465 Ga0501037_0084107 3300049573 Bacteria 2304
466 Ga0501037_0174191 3300049573 Bacteria 1528
467 Ga0501037_0468634 3300049573 Bacteria 857
468 Ga0501037_0575971 3300049573 Bacteria 758
469 Ga0501038_0002561 3300049574 Bacteria 16947
470 Ga0501038_0018512 3300049574 Bacteria 6289
471 Ga0501038_0089050 3300049574 Bacteria 2589
472 Ga0501038_0238408 3300049574 Bacteria 1445
473 Ga0501038_0341273 3300049574 Bacteria 1168
474 Ga0501038_0548399 3300049574 Bacteria 879
475 Ga0501039_0084323 3300049575 Bacteria 2474
476 Ga0501039_0679554 3300049575 Bacteria 805
477 Ga0501041_0093338 3300049577 Bacteria 1859
478 Ga0501041_0518490 3300049577 Bacteria 759
479 Ga0501042_0094635 3300049578 Bacteria 2145
480 Ga0501042_0270722 3300049578 Bacteria 1226
481 Ga0501042_0345132 3300049578 Bacteria 1076
482 Ga0501043_0004021 3300049579 Bacteria 12023
483 Ga0501043_0006326 3300049579 Bacteria 9511
484 Ga0501043_0008232 3300049579 Bacteria 8217
485 Ga0501043_0058129 3300049579 Bacteria 3036
486 Ga0501043_0447856 3300049579 Bacteria 970
487 Ga0501046_0004507 3300049580 Bacteria 12624
488 Ga0501046_0024950 3300049580 Bacteria 4898
489 Ga0501046_0131335 3300049580 Bacteria 1899
490 Ga0501047_0015107 3300049581 Bacteria 7350
491 Ga0501047_0138822 3300049581 Bacteria 2309
492 Ga0501047_0252343 3300049581 Bacteria 1612
493 Ga0501047_0496691 3300049581 Bacteria 1047
494 Ga0501048_0000242 3300049582 Bacteria 36361
495 Ga0501048_0002764 3300049582 Bacteria 13390
496 Ga0501048_0018626 3300049582 Bacteria 5104
497 Ga0501048_0133662 3300049582 Bacteria 1753
498 Ga0501048_0328349 3300049582 Bacteria 1090
499 Ga0501067_0017043 3300049583 Bacteria 4014
500 Ga0501068_0012032 3300049584 Bacteria 4895
501 Ga0501068_0081837 3300049584 Bacteria 1982
502 Ga0501069_0002591 3300049585 Bacteria 9222
503 Ga0501069_0010383 3300049585 Bacteria 4926
504 Ga0501070_0072382 3300049586 Bacteria 2853
505 Ga0501070_0118692 3300049586 Bacteria 2186
506 Ga0501070_0172217 3300049586 Bacteria 1783
507 Ga0501070_0340859 3300049586 Bacteria 1217
508 Ga0501071_0017627 3300049587 Bacteria 4929
509 Ga0501071_0084923 3300049587 Bacteria 2321
510 Ga0501071_0137270 3300049587 Bacteria 1820
511 Ga0501071_0209604 3300049587 Bacteria 1465
512 Ga0501072_0137161 3300049588 Bacteria 1950
513 Ga0501072_0270162 3300049588 Bacteria 1353
514 Ga0501072_0305176 3300049588 Bacteria 1265
515 Ga0501072_1097386 3300049588 Unclassified 619
516 Ga0501072_1229879 3300049588 Bacteria 581
517 Ga0501073_0005616 3300049589 Bacteria 9386
518 Ga0501073_0100195 3300049589 Bacteria 2011
519 Ga0501073_0579753 3300049589 Bacteria 775
520 Ga0501074_0014464 3300049590 Bacteria 5741
521 Ga0501074_0081907 3300049590 Bacteria 2314
522 Ga0501076_0037628 3300049592 Bacteria 3796
523 Ga0501076_0111145 3300049592 Bacteria 2215
524 Ga0501076_0220220 3300049592 Unclassified 1551
525 Ga0501076_0566841 3300049592 Bacteria 936
526 Ga0501077_0052620 3300049593 Bacteria 2586
527 Ga0501077_0285170 3300049593 Bacteria 1051
528 Ga0501077_0519480 3300049593 Unclassified 764
529 Ga0501222_026102 3300049662 Bacteria 793
530 Ga0501252_001571 3300049682 Bacteria 2133
531 Ga0501079_0023113 3300049741 Bacteria 4773
532 Ga0501079_0069026 3300049741 Bacteria 2728
533 Ga0501079_0158069 3300049741 Bacteria 1767
534 Ga0501080_0010116 3300049742 Bacteria 8626
535 Ga0501081_0212576 3300049743 Bacteria 1405
536 Ga0501081_0230736 3300049743 Unclassified 1348
537 Ga0501083_0010676 3300049744 Bacteria 6461
538 Ga0501083_0025162 3300049744 Bacteria 4121
539 Ga0501035_0006400 3300049822 Bacteria 11071
540 Ga0501035_0049703 3300049822 Bacteria 3757
541 Ga0501035_0204001 3300049822 Bacteria 1694
542 Ga0501035_0204488 3300049822 Bacteria 1692
543 Ga0501035_0513142 3300049822 Bacteria 985
544 Ga0501044_0017194 3300049823 Bacteria 7760
545 Ga0501044_0035158 3300049823 Bacteria 5248
546 Ga0501044_0217989 3300049823 Bacteria 1860
547 Ga0501044_0265141 3300049823 Bacteria 1655
548 Ga0501044_0688543 3300049823 Bacteria 908
549 Ga0501044_0730636 3300049823 Bacteria 873
550 Ga0501044_1291197 3300049823 Bacteria 596
551 Ga0501045_0006386 3300049824 Bacteria 8162
552 Ga0501045_0275481 3300049824 Bacteria 1252
553 Ga0501045_0560148 3300049824 Bacteria 847
554 nmdc:mga03n38_2045_c1 3300050490 Bacteria 6085
555 nmdc:mga00v17_79234_c1 3300050491 Bacteria 2048
556 nmdc:mga0yw44_22853_c1 3300050492 Bacteria 3514
557 nmdc:mga0k408_132915_c1 3300050493 Bacteria 1477
558 nmdc:mga0k408_55401_c1 3300050493 Bacteria 2299
559 nmdc:mga0k408_555277_c1 3300050493 Bacteria 679
560 nmdc:mga06z11_31637_c1 3300050494 Bacteria 2573
561 nmdc:mga06z11_667789_c1 3300050494 Bacteria 633
562 nmdc:mga07m45_13111_c1 3300050496 Bacteria 4389
563 nmdc:mga07m45_158420_c1 3300050496 Bacteria 1314
564 nmdc:mga07m45_3159_c1 3300050496 Bacteria 7903
565 nmdc:mga0qj67_207741_c1 3300050509 Bacteria 1590
566 nmdc:mga0sz30_5297_c1 3300050516 Bacteria 4725
567 Ga0500578_0098036 3300053086 Bacteria 1857
568 Ga0500643_000140 3300053087 Bacteria 72592
569 Ga0500643_021222 3300053087 Bacteria 2108
570 Ga0500641_0011118 3300053096 Bacteria 3263
571 Ga0500555_000327 3300053103 Bacteria 20441
572 Ga0500555_001522 3300053103 Bacteria 7017
573 Ga0500562_000540 3300053108 Bacteria 9171
574 Ga0500562_002502 3300053108 Bacteria 4589
575 Ga0500562_016650 3300053108 Bacteria 1891
576 Ga0500595_032373 3300053119 Bacteria 1746
577 Ga0500618_058314 3300053125 Bacteria 869
578 Ga0500652_237911 3300053131 Bacteria 726
579 Ga0500658_0034983 3300053134 Bacteria 1986
580 Ga0500564_000419 3300053138 Bacteria 12247
581 Ga0500568_0026007 3300053139 Bacteria 2461
582 Ga0500568_0210067 3300053139 Bacteria 712
583 Ga0500577_0000146 3300053142 Bacteria 17264
584 Ga0500616_0000401 3300053153 Bacteria 59226
585 Ga0500616_0024213 3300053153 Bacteria 3376
586 Ga0500616_0105441 3300053153 Bacteria 1370
587 Ga0500622_0001772 3300053156 Bacteria 16534
588 Ga0500622_0002557 3300053156 Bacteria 13029
589 Ga0500622_0175562 3300053156 Bacteria 994
590 Ga0500633_0003370 3300053160 Bacteria 3476
591 Ga0500645_001108 3300053730 Bacteria 14718
592 Ga0500645_001192 3300053730 Bacteria 13818
593 Ga0500645_002572 3300053730 Bacteria 7982
594 Ga0500587_000148 3300053739 Bacteria 6734
595 Ga0501084_0073006 3300054114 Bacteria 2873
596 Ga0501082_0029927 3300060353 Bacteria 4691
597 Ga0501082_0275186 3300060353 Bacteria 1465
598 Ga0466962_0434926 3300061719 Bacteria 660
599 Ga0530510_0123119 3300061734 Bacteria 1905
600 2501085369 2501025502 Bacteria 9641094
601 2511090791 2510917013 Bacteria 9951648
602 2511251075 2511231003 Bacteria 5606035
603 2511385381 2511231026 Bacteria 5225445
604 2513954676 2513237150 Bacteria 6553639
605 2514043561 2513237165 Bacteria 6771773
606 2521557650 2521172590 Bacteria 5047645
607 2524612385 2524023250 Bacteria 5457705
608 2548846432 2547132512 Bacteria 3416496
609 2550692528 2548876994 Bacteria 4904866
610 2553002767 2551306416 Bacteria 6152985
611 2574429434 2574179768 Bacteria 4907129
612 2585147631 2582581279 Bacteria 4980720
613 2587757815 2585428062 Bacteria 6842168
614 2595447148 2593339238 Bacteria 4182970
615 2601667208 2600255292 Bacteria 6300551
616 2644000454 2643221598 Bacteria 4578346
617 2644074410 2643221611 Bacteria 6820941
618 2644084771 2643221614 Bacteria 4260023
619 2644339421 2643221660 Bacteria 4208257
620 2644342323 2643221661 Bacteria 4267604
621 2644365623 2643221666 Bacteria 4265935
622 2721026190 2718218334 Bacteria 4765486
623 2722882435 2721755523 Bacteria 6430384
624 2735833839 2734482264 Unclassified 5014763
625 2739228827 2738543009 Bacteria 4944499
626 2739241504 2738543012 Bacteria 7115078
627 2739610108 2739367655 Bacteria 4051151
628 2765570181 2765235838 Bacteria 5445269
629 2816473668 2816332133 Bacteria 7249298
630 2819566482 2818991440 Bacteria 4774720
631 2819591508 2818991445 Bacteria 4955017
632 2819615208 2818991449 Bacteria 5518009
633 2831865407 2831864461 Bacteria 6502356
634 2834645966 2834641062 Bacteria 5559922
635 2839096877 2839094727 Bacteria 5534556
636 2839140799 2839138175 Bacteria 6549354
637 2842721137 2842718218 Bacteria 4560148
638 2842920205 2842918807 Bacteria 4289178
639 2849565528 2849560528 Bacteria 5393480
640 2851153242 2851153111 Bacteria 5542585
641 2857552601 2857547612 Bacteria 6179999
642 2883578329 2883577096 Bacteria 4709178
643 2884341816 2884338543 Bacteria 4610696
644 2884816600 2884811622 Bacteria 5552861
645 2884837317 2884836552 Bacteria 5219991
646 2884853608 2884852848 Bacteria 5221161
647 2885081535 2885080285 Bacteria 6355622
648 2886849552 2886848708 Bacteria 5632523
649 2887380726 2887375801 Bacteria 5334027
650 2891637311 2891633521 Bacteria 4602265
651 2894025510 2894023352 Bacteria 5167372
652 2896155275 2896154374 Bacteria 5221518
653 2904441611 2904439833 Bacteria 5931679
654 2904467139 2904463128 Bacteria 4775606
655 2904531467 2904530477 Bacteria 5876334
656 2904586894 2904584206 Bacteria 6028872
657 2904593073 2904589729 Bacteria 6113573
658 2904603089 2904601388 Bacteria 5884906
659 2919050915 2919046199 Bacteria 5567169
660 2919083898 2919079590 Bacteria 5946433
661 2919087424 2919085039 Bacteria 4532964
662 2923510847 2923510766 Bacteria 5926163
663 2932414916 2932410948 Bacteria 6312192
664 2932419602 2932416698 Bacteria 6315112
665 2941475414 2941471342 Bacteria 5018624
666 2953995499 2953994433 Bacteria 4303959
667 2974324036 2974320154 Bacteria 4571377
668 2990198559 2990196909 Bacteria 4054280
669 3000865907 3000865235 Bacteria 3106258
670 640486957 640427133 Bacteria 4567418
671 643598823 643348564 Bacteria 8839022
672 644752226 644736347 Bacteria 6476522
673 651174832 651053060 Bacteria 4689946
674 8003402737 8003400568 Bacteria 5535898
675 Ga0501034_0000022
676 JGI24736J21556_1002736
677 JGI24740J21852_10009636
678 JGI24735J21928_10033649
679 JGI25156J39149_1000112
680 JGI25156J39149_1000128
681 JGI25156J39149_1002904
682 JGI25162J39368_1004893
683 JGI25154J39366_1000125
684 JGI25154J39366_1000143
685 JGI25154J39366_1000228
686 JGI25157J39369_1000134
687 JGI25157J39369_1020182
688 JGI25151J46595_10003380
689 JGI25151J46595_10021364
690 JGI25151J46595_10075606
691 rootH2_10006506
692 rootH2_10225852
693 rootL2_10000651
694 rootH1_10078092
695 rootH1_10194283
696 Ga0055533_1006056
697 Ga0055532_1000101
698 Ga0055535_1006661
699 Ga0055526_1000535
700 Ga0055526_1004129
701 Ga0055526_1004782
702 Ga0055526_1039208
703 Ga0055537_1002025
704 Ga0055524_1000007
705 Ga0055524_1016574
706 Ga0055524_1031489
707 Ga0055536_1000078
708 Ga0055534_1000733
709 Ga0055534_1002174
710 Ga0055530_10001592
711 Ga0055540_1000042
712 Ga0055531_10001613
713 Ga0055531_10001667
714 Ga0055543_1003956
715 Ga0055543_1006647
716 Ga0065165_1000079
717 Ga0065165_1000405
718 Ga0065165_1000482
719 Ga0065165_1016998
720 Ga0065714_10254944
721 Ga0065704_10080515
722 Ga0065704_10099871
723 Ga0070670_100146194
724 Ga0070666_10000018
725 Ga0070674_100371103
726 Ga0070674_100624546
727 Ga0070667_100168040
728 Ga0070694_100430287
729 Ga0070678_100532907
730 Ga0070662_100086628
731 Ga0068853_101029177
732 Ga0070665_100031056
733 Ga0068855_100119522
734 Ga0068855_100470313
735 Ga0068857_100146157
736 Ga0068854_101093607
737 Ga0068856_100637915
738 Ga0068852_100043837
739 Ga0068861_100022802
740 Ga0068851_10685095
741 Ga0068870_10638682
742 Ga0068863_101393182
743 Ga0068858_100179544
744 Ga0068858_100247571
745 Ga0068860_100232117
746 Ga0068860_100945086
747 Ga0068862_100267778
748 Ga0068862_100619448
749 Ga0075365_10002161
750 Ga0075368_10085527
751 Ga0075368_10237850
752 Ga0075363_100022892
753 Ga0075363_100333590
754 Ga0075363_100408099
755 Ga0075364_10099340
756 Ga0075367_10011481
757 Ga0075367_10075075
758 Ga0075367_10370936
759 Ga0075366_10068254
760 Ga0075366_10139572
761 Ga0075366_10139853
762 Ga0075366_10331776
763 Ga0075370_10005249
764 Ga0075370_10005703
765 Ga0075370_10021246
766 Ga0075430_100216334
767 Ga0075430_100280271
768 Ga0099824_1031132
769 Ga0099823_1000002
770 Ga0079104_1000002
771 Ga0079104_1000012
772 Ga0099826_10000009
773 Ga0099826_10000052
774 Ga0105251_10010122
775 Ga0105251_10399583
776 Ga0105244_10106922
777 Ga0105244_10183947
778 Ga0105244_10275385
779 Ga0105240_10001934
780 Ga0105240_10168317
781 Ga0105247_10128799
782 Ga0105243_10005055
783 Ga0105242_10280134
784 Ga0105248_10038811
785 Ga0105237_10000797
786 Ga0105238_10000319
787 Ga0105238_10004630
788 Ga0105238_10017899
789 Ga0105249_10020688
790 Ga0105239_10087577
791 Ga0105239_10515226
792 Ga0157319_1000007
793 Ga0157373_10153065
794 Ga0157370_10005446
795 Ga0157369_10000580
796 Ga0163162_10030575
797 Ga0163162_10033887
798 Ga0157375_10442276
799 Ga0157380_10090734
800 Ga0182008_10002417
801 Ga0182008_10008058
802 Ga0157379_10754203
803 Ga0157376_10461978
804 Ga0182006_1000002
805 Ga0182006_1000031
806 Ga0182006_1000847
807 Ga0182006_1001950
808 Ga0182006_1071161
809 Ga0182007_10001827
810 Ga0182007_10002777
811 Ga0182007_10020516
812 Ga0182007_10029289
813 Ga0182007_10055108
814 Ga0182005_1000029
815 Ga0182005_1000352
816 Ga0182005_1000434
817 Ga0163161_10004612
818 Ga0163161_10637301
819 Ga0163161_10647303
820 Ga0209435_100016
821 Ga0209435_100101
822 Ga0209674_101336
823 Ga0209147_100023
824 Ga0209147_103555
825 Ga0209437_100166
826 Ga0209258_100345
827 Ga0209646_1000033
828 Ga0209646_1000093
829 Ga0209026_1000031
830 Ga0209026_1000870
831 Ga0209148_1008635
832 Ga0209759_1000227
833 Ga0209759_1000346
834 Ga0209565_1000094
835 Ga0209565_1004914
836 Ga0209455_1010811
837 Ga0209673_1006810
838 Ga0209673_1023583
839 Ga0209675_1000087
840 Ga0209675_1001508
841 Ga0209675_1004217
842 Ga0209675_1013469
843 Ga0209675_1028130
844 Ga0209676_1000176
845 Ga0209025_1000046
846 Ga0209025_1000123
847 Ga0209025_1000764
848 Ga0209025_1008843
849 Ga0209025_1057007
850 Ga0209564_1000030
851 Ga0209564_1000166
852 Ga0209564_1001192
853 Ga0209564_1001289
854 Ga0209758_1014801
855 Ga0209050_1001487
856 Ga0209050_1002014
857 Ga0209256_1000005
858 Ga0209256_1000030
859 Ga0209256_1000432
860 Ga0209256_1000960
861 Ga0209256_1001426
862 Ga0209256_1002066
863 Ga0209256_1034134
864 Ga0207426_1024982
865 Ga0209051_1000004
866 Ga0209051_1001383
867 Ga0209051_1009602
868 Ga0209051_1027983
869 Ga0209051_1035742
870 Ga0209257_1000063
871 Ga0209257_1002063
872 Ga0209257_1002789
873 Ga0207713_1017282
874 Ga0207642_10065029
875 Ga0207710_10002899
876 Ga0207710_10350156
877 Ga0207688_10075061
878 Ga0207680_10000002
879 Ga0207647_10000008
880 Ga0207645_10652017
881 Ga0207705_10007929
882 Ga0207695_10001378
883 Ga0207695_10002689
884 Ga0207695_10018810
885 Ga0207671_10008460
886 Ga0207649_10085238
887 Ga0207649_10124763
888 Ga0207694_10000388
889 Ga0207694_10002955
890 Ga0207650_10086097
891 Ga0207706_10331995
892 Ga0207709_10000015
893 Ga0207669_10349706
894 Ga0207711_10016483
895 Ga0207667_10056339
896 Ga0207667_10131976
897 Ga0207667_10691320
898 Ga0207712_10258726
899 Ga0207668_10005187
900 Ga0207640_10004825
901 Ga0207658_10627118
902 Ga0207703_10259667
903 Ga0207678_10297556
904 Ga0207674_10274526
905 Ga0207674_10300170
906 Ga0207675_100035947
907 Ga0207675_101297181
908 Ga0207683_10523963
909 Ga0207698_10003707
910 Ga0209281_1000007
911 Ga0209281_1000039
912 Ga0209389_1002519
913 Ga0209371_1030596
914 Ga0209970_1008497
915 Ga0209983_1005646
916 Ga0209282_1000001
917 Ga0209282_1000017
918 Ga0268266_10000004
919 Ga0268266_10240152
920 Ga0268265_10669325
921 Ga0268264_10207611
922 Ga0268264_10918440
923 Ga0307517_10206855
924 Ga0307515_10000567
925 Ga0307515_10001764
926 Ga0307515_10006103
927 Ga0307515_10032674
928 Ga0268256_1009564
929 Ga0307512_10021151
930 Ga0265332_10000010
931 Ga0307513_10002614
932 Ga0307513_10023800
933 Ga0307513_10359277
934 Ga0307509_10022947
935 Ga0307408_100015990
936 Ga0307408_100029014
937 Ga0307408_100943449
938 Ga0307508_10000133
939 Ga0307508_10079502
940 Ga0307514_10004805
941 Ga0307516_10000253
942 Ga0307516_10013972
943 Ga0307412_10000608
944 Ga0307412_10768968
945 Ga0307416_101788959
946 Ga0307414_10009304
947 Ga0307411_10107837
948 Ga0307507_10029260
949 Ga0307510_10001599
950 Ga0395905_0219689
951 Ga0400483_135774
952 Ga0400483_241741
953 Ga0439436_0000022
954 Ga0451795_0071722
955 Ga0451835_0702106
956 Ga0451845_0298471
957 Ga0451843_1377075
958 Ga0451853_1603597
959 Ga0439445_0004322
960 Ga0450890_002465
961 Ga0450892_000837
962 Ga0450889_000111
963 Ga0450906_041829
964 Ga0450908_000261
965 Ga0439459_0000041
966 Ga0450916_000906
967 Ga0450893_0044706
968 Ga0439440_0035434
969 Ga0466982_0000049
970 Ga0466963_0006616
971 Ga0466968_0013434
972 Ga0466968_0119663
973 Ga0466957_0013309
974 Ga0466957_0026700
975 Ga0466967_0451957
976 Ga0495617_000120
977 Ga0495617_000348
978 Ga0495590_0107430
979 Ga0495638_0000564
980 Ga0495650_0000011
981 Ga0495650_0000637
982 Ga0495650_0004416
983 Ga0495650_0005076
984 Ga0495650_0013995
985 Ga0495605_0028815
986 Ga0495584_0000688
987 Ga0495584_0006451
988 Ga0495585_0006964
989 Ga0495596_0000070
990 Ga0495607_0000090
991 Ga0495607_0000244
992 Ga0495607_0058090
993 Ga0495583_0014440
994 Ga0495606_0000218
995 Ga0495606_0001182
996 Ga0495606_0004271
997 Ga0495606_0052282
998 Ga0495606_0070176
999 Ga0495606_0141397
1000 Ga0495610_0000277
1001 Ga0495610_0001156
1002 Ga0495610_0035249
1003 Ga0495610_0142818
1004 Ga0495616_0000006
1005 Ga0495616_0001909
1006 Ga0495616_0041065
1007 Ga0495616_0065467
1008 Ga0495620_0000806
1009 Ga0495620_0009092
1010 Ga0495631_0000820
1011 Ga0495631_0014388
1012 Ga0495632_0010885
1013 Ga0495632_0025389
1014 Ga0495637_0008754
1015 Ga0495637_0104759
1016 Ga0495643_0079344
1017 Ga0495648_0000334
1018 Ga0495648_0002324
1019 Ga0495609_0008576
1020 Ga0495609_0013246
1021 Ga0495633_0000305
1022 Ga0495633_0060118
1023 Ga0495656_0025926
1024 Ga0495668_0002024
1025 Ga0495611_0000001
1026 Ga0495611_0000126
1027 Ga0495625_0000200
1028 Ga0495625_0000452
1029 Ga0495625_0001333
1030 Ga0495625_0004350
1031 Ga0495625_0050598
1032 Ga0495625_0184572
1033 Ga0495625_0398243
1034 Ga0495661_0040309
1035 Ga0495670_0000526
1036 Ga0495670_0013489
1037 Ga0495670_0028409
1038 Ga0495670_0029855
1039 Ga0495670_0142427
1040 Ga0495671_0000457
1041 Ga0495671_0001886
1042 Ga0495649_0077961
1043 Ga0495589_0000008
1044 Ga0495589_0188993
1045 Ga0495660_0000129
1046 Ga0495660_0046730
1047 Ga0495672_0010016
1048 Ga0495672_0169397
1049 Ga0495683_0004255
1050 Ga0495683_0038508
1051 Ga0495679_000004
1052 Ga0495685_130051
1053 Ga0495673_0000004
1054 Ga0495673_0000041
1055 Ga0495673_0002539
1056 Ga0495673_0002704
1057 Ga0495673_0017017
1058 Ga0495686_0000108
1059 Ga0495686_0001764
1060 Ga0495686_0001911
1061 Ga0495686_0003220
1062 Ga0495686_0008150
1063 Ga0495686_0008342
1064 Ga0495686_0099252
1065 Ga0496100_0026786
1066 Ga0496101_0000399
1067 Ga0496103_0262270
1068 Ga0496104_0071049
1069 Ga0496106_0000716
1070 Ga0496106_0017532
1071 Ga0496106_0256073
1072 Ga0496108_0623598
1073 Ga0496109_0726429
1074 Ga0496116_0002058
1075 Ga0496116_0008775
1076 Ga0496116_0025209
1077 Ga0496117_0181931
1078 Ga0496118_0002248
1079 Ga0496118_0005121
1080 Ga0496118_0107005
1081 Ga0496121_0001451
1082 Ga0496121_0001490
1083 Ga0496121_0001516
1084 Ga0496121_0003074
1085 Ga0496121_0003543
1086 Ga0496121_0003558
1087 Ga0496121_0006246
1088 Ga0496121_0007024
1089 Ga0496121_0041800
1090 Ga0496121_0187554
1091 Ga0496121_0373194
1092 Ga0496121_0479508
1093 Ga0496121_0491153
1094 Ga0496122_0000457
1095 Ga0496122_0003366
1096 Ga0496122_0024752
1097 Ga0496122_0081987
1098 Ga0496123_0000208
1099 Ga0496123_0000321
1100 Ga0496123_0009893
1101 Ga0496123_0018167
1102 Ga0496124_0061266
1103 Ga0496124_0497181
1104 Ga0496125_0000383
1105 Ga0496125_0000464
1106 Ga0496125_0000895
1107 Ga0496125_0022596
1108 Ga0496125_0026144
1109 Ga0496125_0070787
1110 Ga0496125_0122306
1111 Ga0496126_0041831
1112 Ga0496126_0078991
1113 Ga0496126_0124680
1114 Ga0495678_000158
1115 Ga0495678_002113
1116 Ga0495682_0099187
1117 Ga0501031_0017131
1118 Ga0501031_0183257
1119 Ga0501032_0004311
1120 Ga0501032_0010978
1121 Ga0501032_0049118
1122 Ga0501032_0052223
1123 Ga0501032_0103190
1124 Ga0501032_0116257
1125 Ga0501032_0373060
1126 Ga0501032_0472475
1127 Ga0501033_0002865
1128 Ga0501033_0019681
1129 Ga0501033_0143108
1130 Ga0501033_0301935
1131 Ga0501034_0018904
1132 Ga0501034_0119174
1133 Ga0501034_0157958
1134 Ga0501034_0176224
1135 Ga0501034_0252758
1136 Ga0501034_0613893
1137 Ga0501037_0036881
1138 Ga0501037_0075571
1139 Ga0501037_0084107
1140 Ga0501037_0174191
1141 Ga0501037_0468634
1142 Ga0501037_0575971
1143 Ga0501038_0002561
1144 Ga0501038_0018512
1145 Ga0501038_0089050
1146 Ga0501038_0238408
1147 Ga0501038_0341273
1148 Ga0501038_0548399
1149 Ga0501039_0084323
1150 Ga0501039_0679554
1151 Ga0501041_0093338
1152 Ga0501041_0518490
1153 Ga0501042_0094635
1154 Ga0501042_0270722
1155 Ga0501042_0345132
1156 Ga0501043_0004021
1157 Ga0501043_0006326
1158 Ga0501043_0008232
1159 Ga0501043_0058129
1160 Ga0501043_0447856
1161 Ga0501046_0004507
1162 Ga0501046_0024950
1163 Ga0501046_0131335
1164 Ga0501047_0015107
1165 Ga0501047_0138822
1166 Ga0501047_0252343
1167 Ga0501047_0496691
1168 Ga0501048_0000242
1169 Ga0501048_0002764
1170 Ga0501048_0018626
1171 Ga0501048_0133662
1172 Ga0501048_0328349
1173 Ga0501067_0017043
1174 Ga0501068_0012032
1175 Ga0501068_0081837
1176 Ga0501069_0002591
1177 Ga0501069_0010383
1178 Ga0501070_0072382
1179 Ga0501070_0118692
1180 Ga0501070_0172217
1181 Ga0501070_0340859
1182 Ga0501071_0017627
1183 Ga0501071_0084923
1184 Ga0501071_0137270
1185 Ga0501071_0209604
1186 Ga0501072_0137161
1187 Ga0501072_0270162
1188 Ga0501072_0305176
1189 Ga0501072_1097386
1190 Ga0501072_1229879
1191 Ga0501073_0005616
1192 Ga0501073_0100195
1193 Ga0501073_0579753
1194 Ga0501074_0014464
1195 Ga0501074_0081907
1196 Ga0501076_0037628
1197 Ga0501076_0111145
1198 Ga0501076_0220220
1199 Ga0501076_0566841
1200 Ga0501077_0052620
1201 Ga0501077_0285170
1202 Ga0501077_0519480
1203 Ga0501222_026102
1204 Ga0501252_001571
1205 Ga0501079_0023113
1206 Ga0501079_0069026
1207 Ga0501079_0158069
1208 Ga0501080_0010116
1209 Ga0501081_0212576
1210 Ga0501081_0230736
1211 Ga0501083_0010676
1212 Ga0501083_0025162
1213 Ga0501035_0006400
1214 Ga0501035_0049703
1215 Ga0501035_0204001
1216 Ga0501035_0204488
1217 Ga0501035_0513142
1218 Ga0501044_0017194
1219 Ga0501044_0035158
1220 Ga0501044_0217989
1221 Ga0501044_0265141
1222 Ga0501044_0688543
1223 Ga0501044_0730636
1224 Ga0501044_1291197
1225 Ga0501045_0006386
1226 Ga0501045_0275481
1227 Ga0501045_0560148
1228 nmdc:mga03n38_2045_c1
1229 nmdc:mga00v17_79234_c1
1230 nmdc:mga0yw44_22853_c1
1231 nmdc:mga0k408_132915_c1
1232 nmdc:mga0k408_55401_c1
1233 nmdc:mga0k408_555277_c1
1234 nmdc:mga06z11_31637_c1
1235 nmdc:mga06z11_667789_c1
1236 nmdc:mga07m45_13111_c1
1237 nmdc:mga07m45_158420_c1
1238 nmdc:mga07m45_3159_c1
1239 nmdc:mga0qj67_207741_c1
1240 nmdc:mga0sz30_5297_c1
1241 Ga0500578_0098036
1242 Ga0500643_000140
1243 Ga0500643_021222
1244 Ga0500641_0011118
1245 Ga0500555_000327
1246 Ga0500555_001522
1247 Ga0500562_000540
1248 Ga0500562_002502
1249 Ga0500562_016650
1250 Ga0500595_032373
1251 Ga0500618_058314
1252 Ga0500652_237911
1253 Ga0500658_0034983
1254 Ga0500564_000419
1255 Ga0500568_0026007
1256 Ga0500568_0210067
1257 Ga0500577_0000146
1258 Ga0500616_0000401
1259 Ga0500616_0024213
1260 Ga0500616_0105441
1261 Ga0500622_0001772
1262 Ga0500622_0002557
1263 Ga0500622_0175562
1264 Ga0500633_0003370
1265 Ga0500645_001108
1266 Ga0500645_001192
1267 Ga0500645_002572
1268 Ga0500587_000148
1269 Ga0501084_0073006
1270 Ga0501082_0029927
1271 Ga0501082_0275186
1272 Ga0466962_0434926
1273 Ga0530510_0123119
1274 2501085369
1275 2511090791
1276 2511251075
1277 2511385381
1278 2513954676
1279 2514043561
1280 2521557650
1281 2524612385
1282 2548846432
1283 2550692528
1284 2553002767
1285 2574429434
1286 2585147631
1287 2587757815
1288 2595447148
1289 2601667208
1290 2644000454
1291 2644074410
1292 2644084771
1293 2644339421
1294 2644342323
1295 2644365623
1296 2721026190
1297 2722882435
1298 2735833839
1299 2739228827
1300 2739241504
1301 2739610108
1302 2765570181
1303 2816473668
1304 2819566482
1305 2819591508
1306 2819615208
1307 2831865407
1308 2834645966
1309 2839096877
1310 2839140799
1311 2842721137
1312 2842920205
1313 2849565528
1314 2851153242
1315 2857552601
1316 2883578329
1317 2884341816
1318 2884816600
1319 2884837317
1320 2884853608
1321 2885081535
1322 2886849552
1323 2887380726
1324 2891637311
1325 2894025510
1326 2896155275
1327 2904441611
1328 2904467139
1329 2904531467
1330 2904586894
1331 2904593073
1332 2904603089
1333 2919050915
1334 2919083898
1335 2919087424
1336 2923510847
1337 2932414916
1338 2932419602
1339 2941475414
1340 2953995499
1341 2974324036
1342 2990198559
1343 3000865907
1344 640486957
1345 643598823
1346 644752226
1347 651174832
1348 8003402737

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10029

DUF2271

Predicted periplasmic protein (DUF2271)

49

191

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qpx-assembly1.cif.gz_B crystal structures of self-capping papd chaperone homodimers 0.6198 17 144
1l4i-assembly1.cif.gz_B crystal structure of the periplasmic chaperone sfae 0.5996 16 141
1qpx-assembly1.cif.gz_A crystal structures of self-capping papd chaperone homodimers 0.5942 20 143
8df2-assembly1.cif.gz_D the structure of the 'alt' construct of the amuc_1438 glycopeptidase 0.5926 20 141
1qpp-assembly1.cif.gz_A crystal structures of self capping papd chaperone homodimers 0.5825 20 143
ID Description Score Start End Superfamily
af_A0A2R8QCE4_151_241_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6892 115 147 2.60.40.10
af_Q4DCG3_704_863_2.60.120.430 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding lectin 0.6852 17 143 2.60.120.430
af_Q8I2V7_318_421_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6839 20 143 2.60.40.10
af_Q7YTU0_40_142_2.60.40.2950 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6726 24 148 2.60.40.2950
af_A0A1D6P2S6_66_166_2.60.40.1220 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6558 20 141 2.60.40.1220
ID Description Score Start End GO Terms
AF-A0A645JKP4-F1-model_v4 DUF2271 domain-containing protein 0.9875 43 169
AF-A0A645JKP4-F1-model_v4 DUF2271 domain-containing protein 0.9724 43 169
AF-A0A3D0T1E3-F1-model_v4 DUF2271 domain-containing protein 0.9484 20 169
AF-A0A1Y0EPB1-F1-model_v4 DUF2271 domain-containing protein 0.945 1 169
AF-A0A519IXS3-F1-model_v4 DUF2271 domain-containing protein 0.9447 18 169

Map