F474452

General Info

Members Datasets Scaffolds Average Seq Length
675 348 1350 380

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0091477|Ga0495603_0091477_35_1264
Length 409
Sequence MKAANETEEFRTCTNRSNQQREVAMQNRQRAEARVKSLTFGALITFSALAASLSANVAQAAAVKDYGKQGEPIELVIGYQPYYTESWSGVIMRDKKFYEKYLPKGSNVSFQVGLQGAIIVNGMLAGKVDIGYVGDMPGIVSTSHPEVRDIRIVSVLGLGYDQCNVFLVRTDAPKFSSSEDALKWLDGKTVAVPKGSCTDRFAQAVFKAKNLKPSEYLNQSIEVITSGFRAKKLDAAVIWEPTASRLVQEGLARRVASGASVNERDGGFMVMPQALIEQRPDVVKAWLQAELDAALFFADSKNAMEIAKMALGQTTGFQEKSLWASAFGSTPKAEGGTDVRIDLAFGFTPEALDLIKKASAFLVEIKSIPSEIRPEAVQPQFAADILKARGLTAPIGQVKAQPDSAYAGN

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
204 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
205 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
206 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
210 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
211 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
212 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
215 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
219 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
225 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
226 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
227 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
247 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
248 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
249 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
279 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
280 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
281 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
313 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
316 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
317 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
318 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
319 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
326 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
327 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
328 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
329 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
330 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
333 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
334 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
339 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
340 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
341 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
342 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
343 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
344 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
347 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
348 2643221660 Methylibium sp. Root1272 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.3
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0
Rhizoplane 5.48
Rhizosphere 90.81
Stem 0
Stem Tuber 0
Unclassified 6.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0091477 3300046455 Bacteria 1778
2 rootH2_10302989 3300003320 Bacteria 1950
3 rootH1_10043315 3300003323 Bacteria 6477
4 rootH1_10214354 3300003323 Bacteria 2468
5 Ga0055540_1018557 3300003792 Bacteria 1903
6 Ga0058861_11893010 3300004800 Bacteria 1366
7 Ga0065707_10100189 3300005295 Unclassified 2948
8 Ga0065707_10131035 3300005295 Unclassified 1920
9 Ga0070658_10024042 3300005327 Bacteria 4890
10 Ga0070676_10011048 3300005328 Bacteria 4906
11 Ga0070676_10138562 3300005328 Bacteria 1546
12 Ga0070683_100252753 3300005329 Bacteria 1676
13 Ga0070690_100000203 3300005330 Bacteria 31114
14 Ga0070670_100004185 3300005331 Bacteria 12074
15 Ga0070670_100058690 3300005331 Bacteria 3303
16 Ga0070670_100068593 3300005331 Bacteria 3043
17 Ga0070670_100170470 3300005331 Bacteria 1888
18 Ga0070670_100176971 3300005331 Bacteria 1851
19 Ga0070677_10002513 3300005333 Bacteria 5867
20 Ga0068869_100002662 3300005334 Bacteria 10793
21 Ga0070666_10002242 3300005335 Bacteria 11684
22 Ga0070666_10033366 3300005335 Bacteria 3405
23 Ga0070682_100026568 3300005337 Bacteria 3466
24 Ga0068868_100000697 3300005338 Bacteria 22578
25 Ga0068868_100001118 3300005338 Bacteria 18377
26 Ga0068868_100029096 3300005338 Bacteria 4230
27 Ga0068868_100188311 3300005338 Bacteria 1715
28 Ga0070689_100002785 3300005340 Bacteria 11476
29 Ga0070689_100031061 3300005340 Bacteria 4058
30 Ga0070691_10000395 3300005341 Bacteria 15848
31 Ga0070687_100000070 3300005343 Bacteria 33041
32 Ga0070687_100031533 3300005343 Bacteria 2601
33 Ga0070661_100072726 3300005344 Bacteria 2530
34 Ga0070692_10001807 3300005345 Bacteria 7998
35 Ga0070668_100011125 3300005347 Bacteria 6700
36 Ga0070668_100204486 3300005347 Bacteria 1622
37 Ga0070669_100273513 3300005353 Bacteria 1351
38 Ga0070675_100002323 3300005354 Bacteria 14138
39 Ga0070675_100012761 3300005354 Bacteria 6590
40 Ga0070675_100024288 3300005354 Bacteria 4854
41 Ga0070675_100076625 3300005354 Bacteria 2782
42 Ga0070671_100012811 3300005355 Bacteria 6761
43 Ga0070671_100049982 3300005355 Bacteria 3478
44 Ga0070671_100109453 3300005355 Bacteria 2320
45 Ga0070674_100023581 3300005356 Bacteria 3984
46 Ga0070674_100055161 3300005356 Bacteria 2751
47 Ga0070673_100037185 3300005364 Bacteria 3707
48 Ga0070688_100025835 3300005365 Bacteria 3481
49 Ga0070659_100133209 3300005366 Unclassified 2020
50 Ga0070667_100061630 3300005367 Bacteria 3176
51 Ga0070667_100106600 3300005367 Bacteria 2426
52 Ga0070667_100112069 3300005367 Bacteria 2366
53 Ga0070667_100247610 3300005367 Bacteria 1593
54 Ga0070703_10004770 3300005406 Bacteria 3794
55 Ga0070709_10002448 3300005434 Bacteria 10058
56 Ga0070709_10004334 3300005434 Bacteria 7646
57 Ga0070709_10035288 3300005434 Bacteria 3039
58 Ga0070714_100020303 3300005435 Bacteria 5423
59 Ga0070714_100025083 3300005435 Bacteria 4917
60 Ga0070714_100052345 3300005435 Bacteria 3482
61 Ga0070713_100000923 3300005436 Bacteria 18738
62 Ga0070713_100010653 3300005436 Bacteria 6654
63 Ga0070713_100225505 3300005436 Bacteria 1701
64 Ga0070710_10007113 3300005437 Bacteria 5407
65 Ga0070710_10008662 3300005437 Bacteria 4956
66 Ga0070701_10029952 3300005438 Bacteria 2689
67 Ga0070711_100001151 3300005439 Bacteria 14210
68 Ga0070711_100017165 3300005439 Bacteria 4606
69 Ga0070711_100019023 3300005439 Bacteria 4397
70 Ga0070705_100000586 3300005440 Bacteria 21191
71 Ga0070705_100012550 3300005440 Bacteria 4310
72 Ga0070705_100112514 3300005440 Bacteria 1742
73 Ga0070700_100012630 3300005441 Bacteria 4721
74 Ga0070694_100000527 3300005444 Bacteria 21062
75 Ga0070708_100018141 3300005445 Bacteria 5887
76 Ga0070708_100044575 3300005445 Bacteria 3901
77 Ga0070708_100164824 3300005445 Bacteria 2067
78 Ga0070708_100345982 3300005445 Bacteria 1401
79 Ga0070663_100011298 3300005455 Bacteria 5599
80 Ga0070678_100008894 3300005456 Bacteria 6046
81 Ga0070678_100011575 3300005456 Bacteria 5448
82 Ga0070678_100050071 3300005456 Bacteria 3019
83 Ga0070662_100038317 3300005457 Bacteria 3405
84 Ga0070662_100046558 3300005457 Bacteria 3116
85 Ga0070662_100189317 3300005457 Bacteria 1626
86 Ga0070681_10007432 3300005458 Bacteria 10713
87 Ga0070681_10009213 3300005458 Bacteria 9703
88 Ga0070681_10078635 3300005458 Bacteria 3255
89 Ga0070681_10097905 3300005458 Bacteria 2880
90 Ga0068867_100000775 3300005459 Bacteria 21581
91 Ga0068867_100010066 3300005459 Bacteria 6664
92 Ga0068867_100030069 3300005459 Bacteria 3917
93 Ga0068867_100051515 3300005459 Bacteria 3036
94 Ga0070685_10134268 3300005466 Bacteria 1550
95 Ga0070706_100017210 3300005467 Bacteria 6675
96 Ga0070706_100293433 3300005467 Unclassified 1517
97 Ga0070698_100010044 3300005471 Bacteria 10109
98 Ga0070698_100135127 3300005471 Bacteria 2421
99 Ga0070699_100032485 3300005518 Bacteria 4507
100 Ga0070699_100047858 3300005518 Bacteria 3700
101 Ga0070679_100001447 3300005530 Bacteria 21006
102 Ga0070684_100025790 3300005535 Bacteria 4943
103 Ga0070697_100052696 3300005536 Bacteria 3306
104 Ga0068853_100034711 3300005539 Bacteria 4282
105 Ga0070672_100046019 3300005543 Bacteria 3379
106 Ga0070672_100281233 3300005543 Bacteria 1407
107 Ga0070686_100000240 3300005544 Bacteria 37313
108 Ga0070695_100000374 3300005545 Bacteria 22964
109 Ga0070695_100006942 3300005545 Bacteria 6707
110 Ga0070693_100000298 3300005547 Bacteria 23135
111 Ga0070665_100014541 3300005548 Bacteria 7897
112 Ga0070665_100068049 3300005548 Bacteria 3570
113 Ga0070704_100000864 3300005549 Bacteria 15175
114 Ga0070704_100002844 3300005549 Bacteria 9810
115 Ga0070704_100018852 3300005549 Archaea 4423
116 Ga0070704_100140095 3300005549 Bacteria 1887
117 Ga0068855_100001747 3300005563 Bacteria 27121
118 Ga0068855_100319710 3300005563 Bacteria 1716
119 Ga0070664_100004970 3300005564 Bacteria 10652
120 Ga0070664_100092159 3300005564 Bacteria 2623
121 Ga0068857_100017390 3300005577 Bacteria 6300
122 Ga0068857_100041592 3300005577 Bacteria 4076
123 Ga0068854_100009390 3300005578 Bacteria 6316
124 Ga0068856_100002249 3300005614 Bacteria 19936
125 Ga0068856_100005249 3300005614 Bacteria 12779
126 Ga0070702_100000032 3300005615 Bacteria 37311
127 Ga0070702_100024741 3300005615 Bacteria 3207
128 Ga0068852_100002813 3300005616 Bacteria 12058
129 Ga0068852_100067800 3300005616 Bacteria 3120
130 Ga0068859_100000445 3300005617 Bacteria 41359
131 Ga0068859_100113554 3300005617 Bacteria 2772
132 Ga0068864_100039066 3300005618 Bacteria 4055
133 Ga0068864_100168726 3300005618 Bacteria 1994
134 Ga0068864_100215329 3300005618 Bacteria 1770
135 Ga0068864_100261518 3300005618 Unclassified 1610
136 Ga0068866_10000116 3300005718 Bacteria 34637
137 Ga0068866_10021608 3300005718 Bacteria 2967
138 Ga0068861_100000246 3300005719 Bacteria 29867
139 Ga0068863_100260158 3300005841 Bacteria 1677
140 Ga0068858_100002515 3300005842 Bacteria 18480
141 Ga0068858_100017399 3300005842 Bacteria 6743
142 Ga0068858_100066134 3300005842 Bacteria 3346
143 Ga0068860_100001848 3300005843 Bacteria 22537
144 Ga0068860_100407095 3300005843 Bacteria 1346
145 Ga0068862_100000668 3300005844 Bacteria 35204
146 Ga0068862_100152255 3300005844 Bacteria 2059
147 Ga0081455_10015177 3300005937 Bacteria 7496
148 Ga0081455_10015762 3300005937 Bacteria 7321
149 Ga0081455_10016172 3300005937 Bacteria 7212
150 Ga0081455_10022859 3300005937 Bacteria 5831
151 Ga0081455_10027664 3300005937 Bacteria 5193
152 Ga0081538_10037910 3300005981 Bacteria 3118
153 Ga0081540_1010843 3300005983 Bacteria 6125
154 Ga0081539_10035222 3300005985 Bacteria 3012
155 Ga0070717_10019653 3300006028 Bacteria 5301
156 Ga0070717_10279259 3300006028 Unclassified 1481
157 Ga0075365_10001073 3300006038 Bacteria 11848
158 Ga0075364_10000041 3300006051 Bacteria 45457
159 Ga0070715_10001568 3300006163 Bacteria 6707
160 Ga0070715_10037174 3300006163 Unclassified 2013
161 Ga0070716_100001516 3300006173 Bacteria 10388
162 Ga0070716_100003729 3300006173 Bacteria 7212
163 Ga0070712_100000185 3300006175 Bacteria 34612
164 Ga0070712_100029032 3300006175 Bacteria 3705
165 Ga0070712_100030172 3300006175 Bacteria 3641
166 Ga0070712_100161043 3300006175 Bacteria 1733
167 Ga0075367_10005237 3300006178 Bacteria 6411
168 Ga0075369_10001677 3300006186 Bacteria 7639
169 Ga0097621_100001462 3300006237 Bacteria 16168
170 Ga0097621_100009440 3300006237 Bacteria 7080
171 Ga0097621_100021742 3300006237 Bacteria 4969
172 Ga0097621_100036516 3300006237 Bacteria 3932
173 Ga0068871_100000271 3300006358 Bacteria 35626
174 Ga0068871_100008770 3300006358 Bacteria 7281
175 Ga0068871_100023194 3300006358 Bacteria 4795
176 Ga0075428_100033779 3300006844 Bacteria 5644
177 Ga0075428_100045813 3300006844 Bacteria 4805
178 Ga0075428_100066796 3300006844 Bacteria 3937
179 Ga0075430_100099997 3300006846 Bacteria 2422
180 Ga0075430_100122456 3300006846 Bacteria 2168
181 Ga0075430_100172708 3300006846 Bacteria 1798
182 Ga0075430_100174141 3300006846 Bacteria 1790
183 Ga0075431_100088797 3300006847 Bacteria 3190
184 Ga0075431_100112391 3300006847 Plasmid 2811
185 Ga0075433_10054300 3300006852 Bacteria 3495
186 Ga0075434_100032733 3300006871 Bacteria 5127
187 Ga0075434_100077043 3300006871 Bacteria 3329
188 Ga0075434_100121216 3300006871 Bacteria 2631
189 Ga0075434_100127546 3300006871 Bacteria 2561
190 Ga0075434_100383971 3300006871 Unclassified 1425
191 Ga0075429_100001221 3300006880 Bacteria 20864
192 Ga0075429_100036373 3300006880 Bacteria 4282
193 Ga0075429_100162342 3300006880 Unclassified 1957
194 Ga0068865_100000421 3300006881 Bacteria 23671
195 Ga0068865_100039873 3300006881 Bacteria 3188
196 Ga0068865_100065599 3300006881 Bacteria 2558
197 Ga0075436_100034698 3300006914 Bacteria 3479
198 Ga0075436_100045192 3300006914 Bacteria 3037
199 Ga0097620_100000445 3300006931 Bacteria 41359
200 Ga0097620_100113554 3300006931 Bacteria 2772
201 Ga0075435_100041754 3300007076 Bacteria 3667
202 Ga0075435_100056191 3300007076 Bacteria 3181
203 Ga0075435_100124096 3300007076 Bacteria 2157
204 Ga0075435_100159912 3300007076 Unclassified 1897
205 Ga0099794_10001342 3300007265 Bacteria 8536
206 Ga0105251_10029212 3300009011 Bacteria 2779
207 Ga0111539_10080484 3300009094 Bacteria 3832
208 Ga0111539_10180056 3300009094 Unclassified 2469
209 Ga0105245_10000464 3300009098 Bacteria 37217
210 Ga0105247_10080101 3300009101 Unclassified 2056
211 Ga0114129_10047869 3300009147 Bacteria 6006
212 Ga0114129_10055815 3300009147 Bacteria 5535
213 Ga0114129_10064694 3300009147 Bacteria 5104
214 Ga0114129_10071066 3300009147 Bacteria 4853
215 Ga0114129_10732202 3300009147 Bacteria 1268
216 Ga0105243_10000963 3300009148 Bacteria 26916
217 Ga0105243_10134587 3300009148 Bacteria 2101
218 Ga0105241_10011829 3300009174 Bacteria 6410
219 Ga0105242_10000689 3300009176 Bacteria 26484
220 Ga0105242_10010686 3300009176 Bacteria 7047
221 Ga0105242_10011041 3300009176 Bacteria 6939
222 Ga0105248_10051170 3300009177 Bacteria 4635
223 Ga0105248_10068855 3300009177 Bacteria 3974
224 Ga0105248_10089658 3300009177 Bacteria 3462
225 Ga0105237_10063673 3300009545 Bacteria 3686
226 Ga0105238_10035123 3300009551 Bacteria 5099
227 Ga0105238_10042323 3300009551 Bacteria 4613
228 Ga0105249_10034159 3300009553 Bacteria 4606
229 Ga0105239_10060676 3300010375 Bacteria 4151
230 Ga0105246_10340863 3300011119 Bacteria 1225
231 Ga0157369_10001331 3300013105 Bacteria 30563
232 Ga0157374_10019448 3300013296 Bacteria 6010
233 Ga0157374_10096485 3300013296 Bacteria 2828
234 Ga0157378_10000816 3300013297 Bacteria 28980
235 Ga0157378_10008421 3300013297 Bacteria 8983
236 Ga0163162_10015939 3300013306 Bacteria 7344
237 Ga0163162_10403330 3300013306 Unclassified 1500
238 Ga0157372_10002054 3300013307 Bacteria 21896
239 Ga0157375_10021525 3300013308 Bacteria 5914
240 Ga0157375_10034410 3300013308 Bacteria 4827
241 Ga0157375_10095822 3300013308 Bacteria 3039
242 Ga0157375_10357084 3300013308 Bacteria 1627
243 Ga0163163_10367562 3300014325 Bacteria 1495
244 Ga0157380_10026662 3300014326 Bacteria 4389
245 Ga0157380_10237273 3300014326 Bacteria 1642
246 Ga0157377_10016292 3300014745 Bacteria 3820
247 Ga0157379_10066667 3300014968 Bacteria 3218
248 Ga0157376_10003015 3300014969 Bacteria 11553
249 Ga0157376_10068124 3300014969 Bacteria 3013
250 Ga0163161_10022566 3300017792 Bacteria 4432
251 Ga0213875_10089874 3300021388 Unclassified 1432
252 Ga0209051_1000843 3300025303 Bacteria 31536
253 Ga0207682_10006284 3300025893 Bacteria 4796
254 Ga0207692_10000698 3300025898 Bacteria 11799
255 Ga0207642_10000116 3300025899 Bacteria 21558
256 Ga0207642_10007668 3300025899 Bacteria 3654
257 Ga0207710_10005335 3300025900 Bacteria 5546
258 Ga0207688_10004733 3300025901 Bacteria 7413
259 Ga0207688_10021140 3300025901 Bacteria 3554
260 Ga0207680_10028842 3300025903 Bacteria 3110
261 Ga0207647_10047203 3300025904 Bacteria 2680
262 Ga0207685_10000799 3300025905 Bacteria 5824
263 Ga0207685_10006832 3300025905 Bacteria 3137
264 Ga0207699_10001488 3300025906 Bacteria 11131
265 Ga0207699_10002688 3300025906 Bacteria 8403
266 Ga0207699_10065674 3300025906 Bacteria 2200
267 Ga0207645_10004977 3300025907 Bacteria 9736
268 Ga0207643_10027987 3300025908 Bacteria 3128
269 Ga0207705_10095937 3300025909 Bacteria 2177
270 Ga0207684_10021823 3300025910 Bacteria 5465
271 Ga0207684_10030752 3300025910 Bacteria 4570
272 Ga0207654_10029447 3300025911 Bacteria 3006
273 Ga0207654_10036785 3300025911 Bacteria 2737
274 Ga0207707_10075102 3300025912 Bacteria 2949
275 Ga0207707_10077788 3300025912 Bacteria 2896
276 Ga0207707_10086096 3300025912 Bacteria 2746
277 Ga0207695_10022429 3300025913 Bacteria 7165
278 Ga0207671_10030726 3300025914 Bacteria 4004
279 Ga0207671_10085634 3300025914 Bacteria 2368
280 Ga0207693_10000280 3300025915 Bacteria 47339
281 Ga0207693_10001609 3300025915 Bacteria 19964
282 Ga0207693_10034325 3300025915 Bacteria 4001
283 Ga0207663_10002244 3300025916 Bacteria 9244
284 Ga0207663_10035708 3300025916 Bacteria 2985
285 Ga0207660_10002745 3300025917 Bacteria 11530
286 Ga0207662_10000088 3300025918 Bacteria 43438
287 Ga0207662_10016954 3300025918 Bacteria 4116
288 Ga0207649_10006375 3300025920 Bacteria 6410
289 Ga0207652_10003045 3300025921 Bacteria 13979
290 Ga0207646_10272665 3300025922 Bacteria 1529
291 Ga0207681_10113777 3300025923 Bacteria 1973
292 Ga0207681_10125293 3300025923 Bacteria 1890
293 Ga0207694_10068435 3300025924 Bacteria 2773
294 Ga0207694_10115487 3300025924 Unclassified 2138
295 Ga0207650_10032541 3300025925 Bacteria 3771
296 Ga0207650_10065209 3300025925 Bacteria 2728
297 Ga0207650_10116064 3300025925 Bacteria 2078
298 Ga0207650_10158367 3300025925 Bacteria 1792
299 Ga0207659_10003323 3300025926 Bacteria 9637
300 Ga0207659_10006995 3300025926 Bacteria 6926
301 Ga0207659_10030546 3300025926 Bacteria 3683
302 Ga0207659_10126904 3300025926 Bacteria 1963
303 Ga0207687_10000349 3300025927 Bacteria 30723
304 Ga0207687_10075317 3300025927 Bacteria 2422
305 Ga0207700_10001216 3300025928 Bacteria 14755
306 Ga0207700_10001949 3300025928 Bacteria 11741
307 Ga0207664_10001209 3300025929 Bacteria 17138
308 Ga0207664_10030843 3300025929 Bacteria 4098
309 Ga0207664_10038791 3300025929 Bacteria 3695
310 Ga0207664_10039819 3300025929 Bacteria 3650
311 Ga0207644_10003123 3300025931 Bacteria 10662
312 Ga0207644_10015796 3300025931 Bacteria 5076
313 Ga0207644_10031183 3300025931 Bacteria 3712
314 Ga0207644_10036022 3300025931 Bacteria 3471
315 Ga0207690_10081335 3300025932 Bacteria 2263
316 Ga0207706_10054860 3300025933 Bacteria 3516
317 Ga0207706_10076346 3300025933 Bacteria 2947
318 Ga0207706_10155684 3300025933 Unclassified 2010
319 Ga0207686_10001742 3300025934 Bacteria 12095
320 Ga0207686_10048011 3300025934 Bacteria 2642
321 Ga0207709_10001394 3300025935 Bacteria 16908
322 Ga0207709_10171858 3300025935 Unclassified 1522
323 Ga0207670_10002102 3300025936 Bacteria 10406
324 Ga0207670_10025778 3300025936 Bacteria 3696
325 Ga0207670_10117916 3300025936 Bacteria 1924
326 Ga0207669_10050591 3300025937 Bacteria 2485
327 Ga0207669_10152410 3300025937 Bacteria 1621
328 Ga0207704_10176726 3300025938 Unclassified 1538
329 Ga0207665_10000223 3300025939 Bacteria 38647
330 Ga0207665_10002070 3300025939 Bacteria 13532
331 Ga0207691_10002229 3300025940 Bacteria 18967
332 Ga0207691_10037211 3300025940 Bacteria 4508
333 Ga0207691_10071015 3300025940 Bacteria 3143
334 Ga0207691_10089392 3300025940 Bacteria 2762
335 Ga0207711_10021061 3300025941 Bacteria 5445
336 Ga0207711_10057241 3300025941 Bacteria 3352
337 Ga0207711_10068689 3300025941 Bacteria 3070
338 Ga0207711_10083097 3300025941 Bacteria 2800
339 Ga0207689_10000079 3300025942 Bacteria 78891
340 Ga0207689_10058393 3300025942 Bacteria 3174
341 Ga0207689_10129763 3300025942 Bacteria 2074
342 Ga0207679_10004969 3300025945 Bacteria 8299
343 Ga0207679_10005906 3300025945 Bacteria 7698
344 Ga0207667_10003261 3300025949 Bacteria 20028
345 Ga0207667_10055873 3300025949 Bacteria 4148
346 Ga0207651_10009979 3300025960 Bacteria 5235
347 Ga0207651_10025288 3300025960 Bacteria 3689
348 Ga0207651_10078582 3300025960 Bacteria 2367
349 Ga0207712_10022939 3300025961 Bacteria 4116
350 Ga0207668_10160172 3300025972 Bacteria 1753
351 Ga0207640_10001480 3300025981 Bacteria 12669
352 Ga0207658_10025598 3300025986 Bacteria 4132
353 Ga0207658_10146569 3300025986 Bacteria 1918
354 Ga0207658_10152689 3300025986 Bacteria 1883
355 Ga0207677_10001090 3300026023 Bacteria 14767
356 Ga0207677_10020964 3300026023 Bacteria 3983
357 Ga0207703_10005469 3300026035 Bacteria 10211
358 Ga0207703_10013825 3300026035 Bacteria 6290
359 Ga0207703_10095801 3300026035 Bacteria 2504
360 Ga0207678_10037099 3300026067 Bacteria 4241
361 Ga0207708_10000326 3300026075 Bacteria 37674
362 Ga0207708_10083797 3300026075 Bacteria 2451
363 Ga0207702_10005592 3300026078 Bacteria 10973
364 Ga0207702_10032786 3300026078 Bacteria 4335
365 Ga0207702_10268235 3300026078 Bacteria 1609
366 Ga0207641_10036381 3300026088 Bacteria 4109
367 Ga0207641_10044708 3300026088 Bacteria 3725
368 Ga0207641_10426658 3300026088 Unclassified 1277
369 Ga0207648_10000071 3300026089 Bacteria 95176
370 Ga0207648_10014240 3300026089 Bacteria 7355
371 Ga0207648_10033642 3300026089 Bacteria 4521
372 Ga0207648_10097605 3300026089 Bacteria 2571
373 Ga0207648_10256350 3300026089 Unclassified 1560
374 Ga0207676_10065449 3300026095 Bacteria 2894
375 Ga0207676_10283841 3300026095 Bacteria 1504
376 Ga0207674_10030865 3300026116 Bacteria 5632
377 Ga0207674_10053185 3300026116 Bacteria 4128
378 Ga0207675_100000040 3300026118 Bacteria 91299
379 Ga0207675_100019931 3300026118 Bacteria 6260
380 Ga0207675_100029665 3300026118 Bacteria 5094
381 Ga0207683_10005122 3300026121 Bacteria 11250
382 Ga0207683_10005345 3300026121 Bacteria 11016
383 Ga0207683_10012990 3300026121 Bacteria 7108
384 Ga0207683_10072160 3300026121 Bacteria 3053
385 Ga0207683_10119565 3300026121 Bacteria 2364
386 Ga0207698_10012247 3300026142 Bacteria 5604
387 Ga0207698_10012768 3300026142 Bacteria 5513
388 Ga0207698_10070206 3300026142 Bacteria 2774
389 Ga0207698_10079948 3300026142 Bacteria 2632
390 Ga0209996_1008039 3300027395 Bacteria 1378
391 Ga0210000_1004200 3300027462 Bacteria 2081
392 Ga0209995_1000813 3300027471 Bacteria 4807
393 Ga0209968_1000908 3300027526 Bacteria 4588
394 Ga0209588_1003017 3300027671 Bacteria 4637
395 Ga0209971_1017332 3300027682 Bacteria 1707
396 Ga0209966_1000011 3300027695 Bacteria 83449
397 Ga0209966_1022502 3300027695 Bacteria 1233
398 Ga0209813_10011779 3300027866 Bacteria 2294
399 Ga0207428_10052517 3300027907 Plasmid 3254
400 Ga0268266_10090465 3300028379 Bacteria 2682
401 Ga0268266_10333321 3300028379 Bacteria 1422
402 Ga0268265_10002113 3300028380 Bacteria 15414
403 Ga0268265_10254589 3300028380 Bacteria 1557
404 Ga0268264_10000527 3300028381 Bacteria 48430
405 Ga0268264_10105269 3300028381 Bacteria 2460
406 Ga0268264_10336262 3300028381 Bacteria 1433
407 Ga0265319_1030112 3300028563 Bacteria 1900
408 Ga0265318_10000392 3300028577 Bacteria 34150
409 Ga0265318_10001252 3300028577 Bacteria 15378
410 Ga0265318_10003873 3300028577 Bacteria 7384
411 Ga0265318_10015190 3300028577 Unclassified 3209
412 Ga0265322_10037162 3300028654 Bacteria 1388
413 Ga0265336_10018923 3300028666 Bacteria 2225
414 Ga0265338_10025744 3300028800 Bacteria 5960
415 Ga0265760_10027209 3300031090 Bacteria 1675
416 Ga0265330_10000900 3300031235 Bacteria 18381
417 Ga0265330_10001096 3300031235 Bacteria 16300
418 Ga0265332_10000362 3300031238 Bacteria 33750
419 Ga0265332_10000671 3300031238 Bacteria 22075
420 Ga0265332_10002472 3300031238 Bacteria 9407
421 Ga0265328_10001141 3300031239 Bacteria 12239
422 Ga0265328_10002164 3300031239 Bacteria 8860
423 Ga0265328_10004804 3300031239 Bacteria 5834
424 Ga0265328_10009651 3300031239 Bacteria 3922
425 Ga0265320_10000221 3300031240 Bacteria 46329
426 Ga0265320_10007236 3300031240 Bacteria 6910
427 Ga0265325_10000004 3300031241 Bacteria 347347
428 Ga0265329_10005195 3300031242 Bacteria 5293
429 Ga0265329_10041870 3300031242 Bacteria 1468
430 Ga0265339_10004491 3300031249 Bacteria 9514
431 Ga0265339_10014115 3300031249 Bacteria 4822
432 Ga0265339_10078749 3300031249 Bacteria 1744
433 Ga0265331_10000378 3300031250 Bacteria 46319
434 Ga0265331_10005482 3300031250 Bacteria 7660
435 Ga0265316_10002329 3300031344 Bacteria 19856
436 Ga0265316_10002908 3300031344 Bacteria 17521
437 Ga0265316_10247474 3300031344 Unclassified 1310
438 Ga0265313_10000196 3300031595 Bacteria 64798
439 Ga0265314_10000455 3300031711 Bacteria 54619
440 Ga0265314_10000555 3300031711 Bacteria 47583
441 Ga0265314_10003642 3300031711 Bacteria 14820
442 Ga0265314_10016082 3300031711 Bacteria 5923
443 Ga0265314_10022097 3300031711 Bacteria 4876
444 Ga0265342_10000058 3300031712 Bacteria 118791
445 Ga0265342_10002058 3300031712 Bacteria 17860
446 Ga0265342_10005768 3300031712 Bacteria 9360
447 Ga0265342_10007313 3300031712 Bacteria 8102
448 Ga0265342_10021408 3300031712 Bacteria 4130
449 Ga0307407_10201856 3300031903 Unclassified 1333
450 Ga0307416_100038312 3300032002 Bacteria 3698
451 Ga0307416_100116594 3300032002 Bacteria 2368
452 Ga0307416_100132674 3300032002 Bacteria 2246
453 Ga0307415_100036307 3300032126 Bacteria 3228
454 Ga0373926_0000062 3300035083 Bacteria 19600
455 Ga0373926_0068948 3300035083 Unclassified 1297
456 Ga0373944_0023226 3300035089 Unclassified 1808
457 Ga0373944_0029538 3300035089 Bacteria 1639
458 Ga0373952_0003140 3300035092 Bacteria 2977
459 Ga0373932_0003432 3300035112 Bacteria 3812
460 Ga0373936_0000882 3300035113 Bacteria 10713
461 Ga0373936_0029462 3300035113 Bacteria 2161
462 Ga0373945_0000333 3300035116 Bacteria 13441
463 Ga0373945_0007590 3300035116 Bacteria 3517
464 Ga0373943_0000050 3300035170 Bacteria 40494
465 Ga0373943_0002684 3300035170 Bacteria 8087
466 Ga0373946_0000768 3300035171 Bacteria 10925
467 Ga0373946_0061570 3300035171 Unclassified 1598
468 Ga0373955_0089297 3300035172 Bacteria 1754
469 Ga0373961_0003382 3300035241 Bacteria 3955
470 Ga0373961_0025578 3300035241 Bacteria 1606
471 Ga0373931_0004397 3300035691 Bacteria 6436
472 Ga0373935_0013138 3300035692 Bacteria 4992
473 Ga0373935_0147543 3300035692 Bacteria 1594
474 Ga0373927_0000373 3300035695 Bacteria 34664
475 Ga0373927_0000912 3300035695 Bacteria 22465
476 Ga0373927_0021667 3300035695 Bacteria 4211
477 Ga0373927_0076467 3300035695 Unclassified 2168
478 Ga0373927_0158907 3300035695 Bacteria 1481
479 Ga0373947_0000146 3300035725 Bacteria 36634
480 Ga0373947_0009374 3300035725 Bacteria 5623
481 Ga0373947_0012236 3300035725 Bacteria 4914
482 Ga0373937_0061674 3300036401 Bacteria 3447
483 Ga0373937_0453219 3300036401 Bacteria 1218
484 Ga0373925_0003003 3300037068 Bacteria 13268
485 Ga0373925_0005485 3300037068 Bacteria 9439
486 Ga0373925_0056920 3300037068 Bacteria 2929
487 Ga0373925_0240157 3300037068 Bacteria 1451
488 Ga0395898_0453615 3300037466 Bacteria 1221
489 Ga0436364_1339026 3300037853 Bacteria 2574
490 Ga0395901_0137477 3300038443 Bacteria 2568
491 Ga0400483_129746 3300039062 Bacteria 5600
492 Ga0400483_231693 3300039062 Bacteria 6547
493 Ga0436360_0438289 3300039438 Bacteria 8975
494 Ga0436361_1047939 3300039447 Bacteria 3685
495 Ga0439441_000085 3300042001 Bacteria 7319
496 Ga0439451_009833 3300042009 Bacteria 1930
497 Ga0439435_0000004 3300042436 Bacteria 26852
498 Ga0439444_0000088 3300042437 Bacteria 7050
499 Ga0451577_0029827 3300042876 Bacteria 4928
500 Ga0466963_0016908 3300044694 Bacteria 4543
501 Ga0466963_0087011 3300044694 Bacteria 2124
502 Ga0466971_0056762 3300044719 Bacteria 1766
503 Ga0466957_0014493 3300044842 Bacteria 4590
504 Ga0466960_0002633 3300044901 Bacteria 6763
505 Ga0451576_0229263 3300045051 Bacteria 1940
506 Ga0466967_0001367 3300045976 Bacteria 14050
507 Ga0466967_0047952 3300045976 Bacteria 3727
508 Ga0466967_0301131 3300045976 Bacteria 1542
509 Ga0495603_0006662 3300046455 Bacteria 6931
510 Ga0495629_0002312 3300046459 Bacteria 14680
511 Ga0495641_0020728 3300046461 Unclassified 3324
512 Ga0495653_0033543 3300046463 Bacteria 4066
513 Ga0495580_0004546 3300046472 Bacteria 11650
514 Ga0495582_0023953 3300046473 Bacteria 3338
515 Ga0495662_0010174 3300046476 Bacteria 4609
516 Ga0495662_0038902 3300046476 Bacteria 2298
517 Ga0495664_0000075 3300046477 Bacteria 48095
518 Ga0495618_0010428 3300046514 Bacteria 5618
519 Ga0495630_0000895 3300046517 Bacteria 20849
520 Ga0495630_0024443 3300046517 Bacteria 4467
521 Ga0495630_0121080 3300046517 Bacteria 1985
522 Ga0495652_0021822 3300046529 Bacteria 5691
523 Ga0495665_0049135 3300046531 Unclassified 2236
524 Ga0495665_0051106 3300046531 Bacteria 2190
525 Ga0495640_0000884 3300046533 Bacteria 22995
526 Ga0495640_0151452 3300046533 Bacteria 1490
527 Ga0495640_0175361 3300046533 Bacteria 1368
528 Ga0495586_0001686 3300046535 Bacteria 12121
529 Ga0495621_0011715 3300046539 Bacteria 2721
530 Ga0495645_0033408 3300046543 Bacteria 3754
531 Ga0495667_0039062 3300046559 Bacteria 3159
532 Ga0495635_0000957 3300046663 Bacteria 19062
533 Ga0495635_0023583 3300046663 Bacteria 4286
534 Ga0495635_0228993 3300046663 Bacteria 1256
535 Ga0495588_0037830 3300046674 Bacteria 2453
536 Ga0495647_0000076 3300046681 Bacteria 23834
537 Ga0495647_0045233 3300046681 Unclassified 1691
538 Ga0495658_0004279 3300046683 Bacteria 7027
539 Ga0495658_0004329 3300046683 Bacteria 6994
540 Ga0495658_0064311 3300046683 Bacteria 2113
541 Ga0495669_0029497 3300046684 Bacteria 2406
542 Ga0495613_0004531 3300046689 Bacteria 10419
543 Ga0495613_0089079 3300046689 Bacteria 2235
544 Ga0495624_0002870 3300046690 Bacteria 12900
545 Ga0495624_0147741 3300046690 Bacteria 1438
546 Ga0495581_0011484 3300047315 Bacteria 5125
547 Ga0495636_0154955 3300047318 Bacteria 1030
548 Ga0495674_0002704 3300047319 Bacteria 17249
549 Ga0495674_0018069 3300047319 Bacteria 6564
550 Ga0495676_0019750 3300047321 Bacteria 5924
551 Ga0495676_0076093 3300047321 Bacteria 2564
552 Ga0495680_0012553 3300047322 Bacteria 7448
553 Ga0495680_0079506 3300047322 Bacteria 2479
554 Ga0495684_0232412 3300047471 Bacteria 1348
555 Ga0495686_0000702 3300047472 Bacteria 45195
556 Ga0495593_0008414 3300047673 Bacteria 6000
557 Ga0496100_0020097 3300048903 Bacteria 3998
558 Ga0496101_0053575 3300048904 Bacteria 2911
559 Ga0496101_0061299 3300048904 Bacteria 2731
560 Ga0496102_0002559 3300048905 Bacteria 15516
561 Ga0496102_0243005 3300048905 Unclassified 1697
562 Ga0496102_0272071 3300048905 Unclassified 1597
563 Ga0496103_0045838 3300048906 Bacteria 2698
564 Ga0496104_0000951 3300048907 Bacteria 24933
565 Ga0496104_0062692 3300048907 Bacteria 3525
566 Ga0496104_0124059 3300048907 Bacteria 2479
567 Ga0496104_0356339 3300048907 Unclassified 1375
568 Ga0496105_0020138 3300048908 Bacteria 5387
569 Ga0496105_0072800 3300048908 Bacteria 2839
570 Ga0496106_0007190 3300048909 Bacteria 8222
571 Ga0496106_0016327 3300048909 Bacteria 5493
572 Ga0496106_0026112 3300048909 Bacteria 4346
573 Ga0496107_0008817 3300048910 Bacteria 6988
574 Ga0496107_0302494 3300048910 Unclassified 1190
575 Ga0496108_0117653 3300048911 Bacteria 2277
576 Ga0496108_0126510 3300048911 Bacteria 2194
577 Ga0496109_0009383 3300048912 Bacteria 8337
578 Ga0496109_0086245 3300048912 Bacteria 2899
579 Ga0496109_0247204 3300048912 Unclassified 1679
580 Ga0496110_0010521 3300048913 Bacteria 7532
581 Ga0496110_0040454 3300048913 Bacteria 4062
582 Ga0496110_0073131 3300048913 Bacteria 3042
583 Ga0496111_0020011 3300048914 Unclassified 4656
584 Ga0496111_0036161 3300048914 Bacteria 3531
585 Ga0496112_0022326 3300048915 Bacteria 6030
586 Ga0496112_0112240 3300048915 Bacteria 2695
587 Ga0496113_0012841 3300048916 Bacteria 5646
588 Ga0496113_0082788 3300048916 Bacteria 2461
589 Ga0496113_0264817 3300048916 Unclassified 1373
590 Ga0496114_0005459 3300048917 Bacteria 9945
591 Ga0496115_0008526 3300048918 Bacteria 7585
592 Ga0496115_0083577 3300048918 Bacteria 2603
593 Ga0496115_0208691 3300048918 Unclassified 1613
594 Ga0496125_0049624 3300048928 Bacteria 3485
595 Ga0496126_0125005 3300048929 Bacteria 2227
596 Ga0501036_0026934 3300049572 Bacteria 4858
597 Ga0501037_0199936 3300049573 Bacteria 1413
598 Ga0501040_0006794 3300049576 Bacteria 7418
599 Ga0501040_0021379 3300049576 Bacteria 4321
600 Ga0501040_0034347 3300049576 Bacteria 3436
601 Ga0501040_0221683 3300049576 Bacteria 1346
602 Ga0501041_0093569 3300049577 Bacteria 1856
603 Ga0501046_0065735 3300049580 Bacteria 2829
604 Ga0501048_0039569 3300049582 Bacteria 3382
605 Ga0501067_0003973 3300049583 Bacteria 8161
606 Ga0501068_0000452 3300049584 Bacteria 20843
607 Ga0501070_0079638 3300049586 Bacteria 2711
608 Ga0501071_0004700 3300049587 Bacteria 8679
609 Ga0501072_0000006 3300049588 Bacteria 245475
610 Ga0501072_0139191 3300049588 Unclassified 1935
611 Ga0501075_0009298 3300049591 Bacteria 6878
612 Ga0501075_0139159 3300049591 Unclassified 1849
613 Ga0501076_0011546 3300049592 Bacteria 6585
614 Ga0501077_0006970 3300049593 Bacteria 6962
615 Ga0501077_0025408 3300049593 Bacteria 3762
616 Ga0501079_0003564 3300049741 Bacteria 11449
617 Ga0501079_0006593 3300049741 Bacteria 8733
618 Ga0501079_0218324 3300049741 Bacteria 1489
619 Ga0501080_0137473 3300049742 Bacteria 2260
620 Ga0501081_0010246 3300049743 Bacteria 6120
621 Ga0501083_0007775 3300049744 Bacteria 7594
622 Ga0501083_0024200 3300049744 Bacteria 4210
623 Ga0501044_0037099 3300049823 Bacteria 5096
624 Ga0501045_0002003 3300049824 Bacteria 13762
625 nmdc:mga03n38_1014_c1 3300050490 Bacteria 7689
626 nmdc:mga00v17_2112_c1 3300050491 Bacteria 10224
627 nmdc:mga0yw44_1072_c1 3300050492 Bacteria 10514
628 nmdc:mga0yw44_19297_c1 3300050492 Bacteria 3757
629 nmdc:mga06z11_1371_c1 3300050494 Bacteria 9016
630 nmdc:mga04h51_1352_c1 3300050495 Bacteria 5649
631 nmdc:mga05p37_27259_c1 3300050507 Bacteria 5108
632 nmdc:mga05p37_355_c1 3300050507 Bacteria 49150
633 nmdc:mga05p37_38596_c1 3300050507 Bacteria 5859
634 nmdc:mga09592_16009_c1 3300050508 Bacteria 6129
635 nmdc:mga09592_1792_c1 3300050508 Bacteria 17230
636 nmdc:mga09592_201034_c1 3300050508 Unclassified 1726
637 nmdc:mga0qj67_190463_c1 3300050509 Bacteria 1667
638 nmdc:mga0qj67_199649_c1 3300050509 Bacteria 1625
639 nmdc:mga0qj67_3686_c1 3300050509 Bacteria 11065
640 nmdc:mga0qj67_4152_c1 3300050509 Bacteria 10503
641 nmdc:mga0qj67_48263_c1 3300050509 Bacteria 3363
642 nmdc:mga06r32_115571_c1 3300050510 Bacteria 2643
643 nmdc:mga06r32_229581_c1 3300050510 Bacteria 1844
644 nmdc:mga06r32_39941_c1 3300050510 Bacteria 4454
645 nmdc:mga08y16_161099_c1 3300050511 Bacteria 2331
646 nmdc:mga08y16_94026_c1 3300050511 Bacteria 3123
647 nmdc:mga0n895_145809_c1 3300050512 Bacteria 2397
648 nmdc:mga0n895_145847_c1 3300050512 Bacteria 2396
649 nmdc:mga0n895_308129_c1 3300050512 Unclassified 1605
650 nmdc:mga0n895_52196_c1 3300050512 Bacteria 4013
651 nmdc:mga0rr50_107142_c1 3300050513 Bacteria 2206
652 nmdc:mga0rr50_154348_c1 3300050513 Unclassified 1858
653 nmdc:mga0a205_15092_c1 3300050515 Bacteria 7215
654 nmdc:mga0a205_368062_c1 3300050515 Bacteria 1303
655 nmdc:mga0a205_46954_c1 3300050515 Bacteria 4165
656 nmdc:mga0a205_65096_c1 3300050515 Plasmid 3521
657 Ga0495601_0026922 3300053077 Bacteria 3553
658 Ga0495601_0206480 3300053077 Bacteria 1283
659 Ga0495612_0000345 3300053078 Bacteria 18746
660 Ga0495619_0002505 3300053085 Bacteria 12030
661 Ga0495619_0003421 3300053085 Bacteria 10245
662 Ga0495619_0020795 3300053085 Bacteria 4185
663 Ga0495619_0043141 3300053085 Bacteria 2956
664 Ga0500555_043120 3300053103 Bacteria 1251
665 Ga0500627_0038902 3300053158 Unclassified 2035
666 Ga0501084_0009922 3300054114 Bacteria 7871
667 Ga0501084_0011694 3300054114 Bacteria 7266
668 Ga0501082_0003950 3300060353 Bacteria 12942
669 Ga0501082_0020780 3300060353 Bacteria 5661
670 Ga0501082_0233858 3300060353 Bacteria 1599
671 Ga0466962_0058469 3300061719 Bacteria 1840
672 Ga0530510_0011114 3300061734 Bacteria 6315
673 Ga0530510_0055971 3300061734 Bacteria 2849
674 Ga0530510_0062013 3300061734 Bacteria 2707
675 2644340517 2643221660 Bacteria 4208257
676 Ga0495603_0091477
677 rootH2_10302989
678 rootH1_10043315
679 rootH1_10214354
680 Ga0055540_1018557
681 Ga0058861_11893010
682 Ga0065707_10100189
683 Ga0065707_10131035
684 Ga0070658_10024042
685 Ga0070676_10011048
686 Ga0070676_10138562
687 Ga0070683_100252753
688 Ga0070690_100000203
689 Ga0070670_100004185
690 Ga0070670_100058690
691 Ga0070670_100068593
692 Ga0070670_100170470
693 Ga0070670_100176971
694 Ga0070677_10002513
695 Ga0068869_100002662
696 Ga0070666_10002242
697 Ga0070666_10033366
698 Ga0070682_100026568
699 Ga0068868_100000697
700 Ga0068868_100001118
701 Ga0068868_100029096
702 Ga0068868_100188311
703 Ga0070689_100002785
704 Ga0070689_100031061
705 Ga0070691_10000395
706 Ga0070687_100000070
707 Ga0070687_100031533
708 Ga0070661_100072726
709 Ga0070692_10001807
710 Ga0070668_100011125
711 Ga0070668_100204486
712 Ga0070669_100273513
713 Ga0070675_100002323
714 Ga0070675_100012761
715 Ga0070675_100024288
716 Ga0070675_100076625
717 Ga0070671_100012811
718 Ga0070671_100049982
719 Ga0070671_100109453
720 Ga0070674_100023581
721 Ga0070674_100055161
722 Ga0070673_100037185
723 Ga0070688_100025835
724 Ga0070659_100133209
725 Ga0070667_100061630
726 Ga0070667_100106600
727 Ga0070667_100112069
728 Ga0070667_100247610
729 Ga0070703_10004770
730 Ga0070709_10002448
731 Ga0070709_10004334
732 Ga0070709_10035288
733 Ga0070714_100020303
734 Ga0070714_100025083
735 Ga0070714_100052345
736 Ga0070713_100000923
737 Ga0070713_100010653
738 Ga0070713_100225505
739 Ga0070710_10007113
740 Ga0070710_10008662
741 Ga0070701_10029952
742 Ga0070711_100001151
743 Ga0070711_100017165
744 Ga0070711_100019023
745 Ga0070705_100000586
746 Ga0070705_100012550
747 Ga0070705_100112514
748 Ga0070700_100012630
749 Ga0070694_100000527
750 Ga0070708_100018141
751 Ga0070708_100044575
752 Ga0070708_100164824
753 Ga0070708_100345982
754 Ga0070663_100011298
755 Ga0070678_100008894
756 Ga0070678_100011575
757 Ga0070678_100050071
758 Ga0070662_100038317
759 Ga0070662_100046558
760 Ga0070662_100189317
761 Ga0070681_10007432
762 Ga0070681_10009213
763 Ga0070681_10078635
764 Ga0070681_10097905
765 Ga0068867_100000775
766 Ga0068867_100010066
767 Ga0068867_100030069
768 Ga0068867_100051515
769 Ga0070685_10134268
770 Ga0070706_100017210
771 Ga0070706_100293433
772 Ga0070698_100010044
773 Ga0070698_100135127
774 Ga0070699_100032485
775 Ga0070699_100047858
776 Ga0070679_100001447
777 Ga0070684_100025790
778 Ga0070697_100052696
779 Ga0068853_100034711
780 Ga0070672_100046019
781 Ga0070672_100281233
782 Ga0070686_100000240
783 Ga0070695_100000374
784 Ga0070695_100006942
785 Ga0070693_100000298
786 Ga0070665_100014541
787 Ga0070665_100068049
788 Ga0070704_100000864
789 Ga0070704_100002844
790 Ga0070704_100018852
791 Ga0070704_100140095
792 Ga0068855_100001747
793 Ga0068855_100319710
794 Ga0070664_100004970
795 Ga0070664_100092159
796 Ga0068857_100017390
797 Ga0068857_100041592
798 Ga0068854_100009390
799 Ga0068856_100002249
800 Ga0068856_100005249
801 Ga0070702_100000032
802 Ga0070702_100024741
803 Ga0068852_100002813
804 Ga0068852_100067800
805 Ga0068859_100000445
806 Ga0068859_100113554
807 Ga0068864_100039066
808 Ga0068864_100168726
809 Ga0068864_100215329
810 Ga0068864_100261518
811 Ga0068866_10000116
812 Ga0068866_10021608
813 Ga0068861_100000246
814 Ga0068863_100260158
815 Ga0068858_100002515
816 Ga0068858_100017399
817 Ga0068858_100066134
818 Ga0068860_100001848
819 Ga0068860_100407095
820 Ga0068862_100000668
821 Ga0068862_100152255
822 Ga0081455_10015177
823 Ga0081455_10015762
824 Ga0081455_10016172
825 Ga0081455_10022859
826 Ga0081455_10027664
827 Ga0081538_10037910
828 Ga0081540_1010843
829 Ga0081539_10035222
830 Ga0070717_10019653
831 Ga0070717_10279259
832 Ga0075365_10001073
833 Ga0075364_10000041
834 Ga0070715_10001568
835 Ga0070715_10037174
836 Ga0070716_100001516
837 Ga0070716_100003729
838 Ga0070712_100000185
839 Ga0070712_100029032
840 Ga0070712_100030172
841 Ga0070712_100161043
842 Ga0075367_10005237
843 Ga0075369_10001677
844 Ga0097621_100001462
845 Ga0097621_100009440
846 Ga0097621_100021742
847 Ga0097621_100036516
848 Ga0068871_100000271
849 Ga0068871_100008770
850 Ga0068871_100023194
851 Ga0075428_100033779
852 Ga0075428_100045813
853 Ga0075428_100066796
854 Ga0075430_100099997
855 Ga0075430_100122456
856 Ga0075430_100172708
857 Ga0075430_100174141
858 Ga0075431_100088797
859 Ga0075431_100112391
860 Ga0075433_10054300
861 Ga0075434_100032733
862 Ga0075434_100077043
863 Ga0075434_100121216
864 Ga0075434_100127546
865 Ga0075434_100383971
866 Ga0075429_100001221
867 Ga0075429_100036373
868 Ga0075429_100162342
869 Ga0068865_100000421
870 Ga0068865_100039873
871 Ga0068865_100065599
872 Ga0075436_100034698
873 Ga0075436_100045192
874 Ga0097620_100000445
875 Ga0097620_100113554
876 Ga0075435_100041754
877 Ga0075435_100056191
878 Ga0075435_100124096
879 Ga0075435_100159912
880 Ga0099794_10001342
881 Ga0105251_10029212
882 Ga0111539_10080484
883 Ga0111539_10180056
884 Ga0105245_10000464
885 Ga0105247_10080101
886 Ga0114129_10047869
887 Ga0114129_10055815
888 Ga0114129_10064694
889 Ga0114129_10071066
890 Ga0114129_10732202
891 Ga0105243_10000963
892 Ga0105243_10134587
893 Ga0105241_10011829
894 Ga0105242_10000689
895 Ga0105242_10010686
896 Ga0105242_10011041
897 Ga0105248_10051170
898 Ga0105248_10068855
899 Ga0105248_10089658
900 Ga0105237_10063673
901 Ga0105238_10035123
902 Ga0105238_10042323
903 Ga0105249_10034159
904 Ga0105239_10060676
905 Ga0105246_10340863
906 Ga0157369_10001331
907 Ga0157374_10019448
908 Ga0157374_10096485
909 Ga0157378_10000816
910 Ga0157378_10008421
911 Ga0163162_10015939
912 Ga0163162_10403330
913 Ga0157372_10002054
914 Ga0157375_10021525
915 Ga0157375_10034410
916 Ga0157375_10095822
917 Ga0157375_10357084
918 Ga0163163_10367562
919 Ga0157380_10026662
920 Ga0157380_10237273
921 Ga0157377_10016292
922 Ga0157379_10066667
923 Ga0157376_10003015
924 Ga0157376_10068124
925 Ga0163161_10022566
926 Ga0213875_10089874
927 Ga0209051_1000843
928 Ga0207682_10006284
929 Ga0207692_10000698
930 Ga0207642_10000116
931 Ga0207642_10007668
932 Ga0207710_10005335
933 Ga0207688_10004733
934 Ga0207688_10021140
935 Ga0207680_10028842
936 Ga0207647_10047203
937 Ga0207685_10000799
938 Ga0207685_10006832
939 Ga0207699_10001488
940 Ga0207699_10002688
941 Ga0207699_10065674
942 Ga0207645_10004977
943 Ga0207643_10027987
944 Ga0207705_10095937
945 Ga0207684_10021823
946 Ga0207684_10030752
947 Ga0207654_10029447
948 Ga0207654_10036785
949 Ga0207707_10075102
950 Ga0207707_10077788
951 Ga0207707_10086096
952 Ga0207695_10022429
953 Ga0207671_10030726
954 Ga0207671_10085634
955 Ga0207693_10000280
956 Ga0207693_10001609
957 Ga0207693_10034325
958 Ga0207663_10002244
959 Ga0207663_10035708
960 Ga0207660_10002745
961 Ga0207662_10000088
962 Ga0207662_10016954
963 Ga0207649_10006375
964 Ga0207652_10003045
965 Ga0207646_10272665
966 Ga0207681_10113777
967 Ga0207681_10125293
968 Ga0207694_10068435
969 Ga0207694_10115487
970 Ga0207650_10032541
971 Ga0207650_10065209
972 Ga0207650_10116064
973 Ga0207650_10158367
974 Ga0207659_10003323
975 Ga0207659_10006995
976 Ga0207659_10030546
977 Ga0207659_10126904
978 Ga0207687_10000349
979 Ga0207687_10075317
980 Ga0207700_10001216
981 Ga0207700_10001949
982 Ga0207664_10001209
983 Ga0207664_10030843
984 Ga0207664_10038791
985 Ga0207664_10039819
986 Ga0207644_10003123
987 Ga0207644_10015796
988 Ga0207644_10031183
989 Ga0207644_10036022
990 Ga0207690_10081335
991 Ga0207706_10054860
992 Ga0207706_10076346
993 Ga0207706_10155684
994 Ga0207686_10001742
995 Ga0207686_10048011
996 Ga0207709_10001394
997 Ga0207709_10171858
998 Ga0207670_10002102
999 Ga0207670_10025778
1000 Ga0207670_10117916
1001 Ga0207669_10050591
1002 Ga0207669_10152410
1003 Ga0207704_10176726
1004 Ga0207665_10000223
1005 Ga0207665_10002070
1006 Ga0207691_10002229
1007 Ga0207691_10037211
1008 Ga0207691_10071015
1009 Ga0207691_10089392
1010 Ga0207711_10021061
1011 Ga0207711_10057241
1012 Ga0207711_10068689
1013 Ga0207711_10083097
1014 Ga0207689_10000079
1015 Ga0207689_10058393
1016 Ga0207689_10129763
1017 Ga0207679_10004969
1018 Ga0207679_10005906
1019 Ga0207667_10003261
1020 Ga0207667_10055873
1021 Ga0207651_10009979
1022 Ga0207651_10025288
1023 Ga0207651_10078582
1024 Ga0207712_10022939
1025 Ga0207668_10160172
1026 Ga0207640_10001480
1027 Ga0207658_10025598
1028 Ga0207658_10146569
1029 Ga0207658_10152689
1030 Ga0207677_10001090
1031 Ga0207677_10020964
1032 Ga0207703_10005469
1033 Ga0207703_10013825
1034 Ga0207703_10095801
1035 Ga0207678_10037099
1036 Ga0207708_10000326
1037 Ga0207708_10083797
1038 Ga0207702_10005592
1039 Ga0207702_10032786
1040 Ga0207702_10268235
1041 Ga0207641_10036381
1042 Ga0207641_10044708
1043 Ga0207641_10426658
1044 Ga0207648_10000071
1045 Ga0207648_10014240
1046 Ga0207648_10033642
1047 Ga0207648_10097605
1048 Ga0207648_10256350
1049 Ga0207676_10065449
1050 Ga0207676_10283841
1051 Ga0207674_10030865
1052 Ga0207674_10053185
1053 Ga0207675_100000040
1054 Ga0207675_100019931
1055 Ga0207675_100029665
1056 Ga0207683_10005122
1057 Ga0207683_10005345
1058 Ga0207683_10012990
1059 Ga0207683_10072160
1060 Ga0207683_10119565
1061 Ga0207698_10012247
1062 Ga0207698_10012768
1063 Ga0207698_10070206
1064 Ga0207698_10079948
1065 Ga0209996_1008039
1066 Ga0210000_1004200
1067 Ga0209995_1000813
1068 Ga0209968_1000908
1069 Ga0209588_1003017
1070 Ga0209971_1017332
1071 Ga0209966_1000011
1072 Ga0209966_1022502
1073 Ga0209813_10011779
1074 Ga0207428_10052517
1075 Ga0268266_10090465
1076 Ga0268266_10333321
1077 Ga0268265_10002113
1078 Ga0268265_10254589
1079 Ga0268264_10000527
1080 Ga0268264_10105269
1081 Ga0268264_10336262
1082 Ga0265319_1030112
1083 Ga0265318_10000392
1084 Ga0265318_10001252
1085 Ga0265318_10003873
1086 Ga0265318_10015190
1087 Ga0265322_10037162
1088 Ga0265336_10018923
1089 Ga0265338_10025744
1090 Ga0265760_10027209
1091 Ga0265330_10000900
1092 Ga0265330_10001096
1093 Ga0265332_10000362
1094 Ga0265332_10000671
1095 Ga0265332_10002472
1096 Ga0265328_10001141
1097 Ga0265328_10002164
1098 Ga0265328_10004804
1099 Ga0265328_10009651
1100 Ga0265320_10000221
1101 Ga0265320_10007236
1102 Ga0265325_10000004
1103 Ga0265329_10005195
1104 Ga0265329_10041870
1105 Ga0265339_10004491
1106 Ga0265339_10014115
1107 Ga0265339_10078749
1108 Ga0265331_10000378
1109 Ga0265331_10005482
1110 Ga0265316_10002329
1111 Ga0265316_10002908
1112 Ga0265316_10247474
1113 Ga0265313_10000196
1114 Ga0265314_10000455
1115 Ga0265314_10000555
1116 Ga0265314_10003642
1117 Ga0265314_10016082
1118 Ga0265314_10022097
1119 Ga0265342_10000058
1120 Ga0265342_10002058
1121 Ga0265342_10005768
1122 Ga0265342_10007313
1123 Ga0265342_10021408
1124 Ga0307407_10201856
1125 Ga0307416_100038312
1126 Ga0307416_100116594
1127 Ga0307416_100132674
1128 Ga0307415_100036307
1129 Ga0373926_0000062
1130 Ga0373926_0068948
1131 Ga0373944_0023226
1132 Ga0373944_0029538
1133 Ga0373952_0003140
1134 Ga0373932_0003432
1135 Ga0373936_0000882
1136 Ga0373936_0029462
1137 Ga0373945_0000333
1138 Ga0373945_0007590
1139 Ga0373943_0000050
1140 Ga0373943_0002684
1141 Ga0373946_0000768
1142 Ga0373946_0061570
1143 Ga0373955_0089297
1144 Ga0373961_0003382
1145 Ga0373961_0025578
1146 Ga0373931_0004397
1147 Ga0373935_0013138
1148 Ga0373935_0147543
1149 Ga0373927_0000373
1150 Ga0373927_0000912
1151 Ga0373927_0021667
1152 Ga0373927_0076467
1153 Ga0373927_0158907
1154 Ga0373947_0000146
1155 Ga0373947_0009374
1156 Ga0373947_0012236
1157 Ga0373937_0061674
1158 Ga0373937_0453219
1159 Ga0373925_0003003
1160 Ga0373925_0005485
1161 Ga0373925_0056920
1162 Ga0373925_0240157
1163 Ga0395898_0453615
1164 Ga0436364_1339026
1165 Ga0395901_0137477
1166 Ga0400483_129746
1167 Ga0400483_231693
1168 Ga0436360_0438289
1169 Ga0436361_1047939
1170 Ga0439441_000085
1171 Ga0439451_009833
1172 Ga0439435_0000004
1173 Ga0439444_0000088
1174 Ga0451577_0029827
1175 Ga0466963_0016908
1176 Ga0466963_0087011
1177 Ga0466971_0056762
1178 Ga0466957_0014493
1179 Ga0466960_0002633
1180 Ga0451576_0229263
1181 Ga0466967_0001367
1182 Ga0466967_0047952
1183 Ga0466967_0301131
1184 Ga0495603_0006662
1185 Ga0495629_0002312
1186 Ga0495641_0020728
1187 Ga0495653_0033543
1188 Ga0495580_0004546
1189 Ga0495582_0023953
1190 Ga0495662_0010174
1191 Ga0495662_0038902
1192 Ga0495664_0000075
1193 Ga0495618_0010428
1194 Ga0495630_0000895
1195 Ga0495630_0024443
1196 Ga0495630_0121080
1197 Ga0495652_0021822
1198 Ga0495665_0049135
1199 Ga0495665_0051106
1200 Ga0495640_0000884
1201 Ga0495640_0151452
1202 Ga0495640_0175361
1203 Ga0495586_0001686
1204 Ga0495621_0011715
1205 Ga0495645_0033408
1206 Ga0495667_0039062
1207 Ga0495635_0000957
1208 Ga0495635_0023583
1209 Ga0495635_0228993
1210 Ga0495588_0037830
1211 Ga0495647_0000076
1212 Ga0495647_0045233
1213 Ga0495658_0004279
1214 Ga0495658_0004329
1215 Ga0495658_0064311
1216 Ga0495669_0029497
1217 Ga0495613_0004531
1218 Ga0495613_0089079
1219 Ga0495624_0002870
1220 Ga0495624_0147741
1221 Ga0495581_0011484
1222 Ga0495636_0154955
1223 Ga0495674_0002704
1224 Ga0495674_0018069
1225 Ga0495676_0019750
1226 Ga0495676_0076093
1227 Ga0495680_0012553
1228 Ga0495680_0079506
1229 Ga0495684_0232412
1230 Ga0495686_0000702
1231 Ga0495593_0008414
1232 Ga0496100_0020097
1233 Ga0496101_0053575
1234 Ga0496101_0061299
1235 Ga0496102_0002559
1236 Ga0496102_0243005
1237 Ga0496102_0272071
1238 Ga0496103_0045838
1239 Ga0496104_0000951
1240 Ga0496104_0062692
1241 Ga0496104_0124059
1242 Ga0496104_0356339
1243 Ga0496105_0020138
1244 Ga0496105_0072800
1245 Ga0496106_0007190
1246 Ga0496106_0016327
1247 Ga0496106_0026112
1248 Ga0496107_0008817
1249 Ga0496107_0302494
1250 Ga0496108_0117653
1251 Ga0496108_0126510
1252 Ga0496109_0009383
1253 Ga0496109_0086245
1254 Ga0496109_0247204
1255 Ga0496110_0010521
1256 Ga0496110_0040454
1257 Ga0496110_0073131
1258 Ga0496111_0020011
1259 Ga0496111_0036161
1260 Ga0496112_0022326
1261 Ga0496112_0112240
1262 Ga0496113_0012841
1263 Ga0496113_0082788
1264 Ga0496113_0264817
1265 Ga0496114_0005459
1266 Ga0496115_0008526
1267 Ga0496115_0083577
1268 Ga0496115_0208691
1269 Ga0496125_0049624
1270 Ga0496126_0125005
1271 Ga0501036_0026934
1272 Ga0501037_0199936
1273 Ga0501040_0006794
1274 Ga0501040_0021379
1275 Ga0501040_0034347
1276 Ga0501040_0221683
1277 Ga0501041_0093569
1278 Ga0501046_0065735
1279 Ga0501048_0039569
1280 Ga0501067_0003973
1281 Ga0501068_0000452
1282 Ga0501070_0079638
1283 Ga0501071_0004700
1284 Ga0501072_0000006
1285 Ga0501072_0139191
1286 Ga0501075_0009298
1287 Ga0501075_0139159
1288 Ga0501076_0011546
1289 Ga0501077_0006970
1290 Ga0501077_0025408
1291 Ga0501079_0003564
1292 Ga0501079_0006593
1293 Ga0501079_0218324
1294 Ga0501080_0137473
1295 Ga0501081_0010246
1296 Ga0501083_0007775
1297 Ga0501083_0024200
1298 Ga0501044_0037099
1299 Ga0501045_0002003
1300 nmdc:mga03n38_1014_c1
1301 nmdc:mga00v17_2112_c1
1302 nmdc:mga0yw44_1072_c1
1303 nmdc:mga0yw44_19297_c1
1304 nmdc:mga06z11_1371_c1
1305 nmdc:mga04h51_1352_c1
1306 nmdc:mga05p37_27259_c1
1307 nmdc:mga05p37_355_c1
1308 nmdc:mga05p37_38596_c1
1309 nmdc:mga09592_16009_c1
1310 nmdc:mga09592_1792_c1
1311 nmdc:mga09592_201034_c1
1312 nmdc:mga0qj67_190463_c1
1313 nmdc:mga0qj67_199649_c1
1314 nmdc:mga0qj67_3686_c1
1315 nmdc:mga0qj67_4152_c1
1316 nmdc:mga0qj67_48263_c1
1317 nmdc:mga06r32_115571_c1
1318 nmdc:mga06r32_229581_c1
1319 nmdc:mga06r32_39941_c1
1320 nmdc:mga08y16_161099_c1
1321 nmdc:mga08y16_94026_c1
1322 nmdc:mga0n895_145809_c1
1323 nmdc:mga0n895_145847_c1
1324 nmdc:mga0n895_308129_c1
1325 nmdc:mga0n895_52196_c1
1326 nmdc:mga0rr50_107142_c1
1327 nmdc:mga0rr50_154348_c1
1328 nmdc:mga0a205_15092_c1
1329 nmdc:mga0a205_368062_c1
1330 nmdc:mga0a205_46954_c1
1331 nmdc:mga0a205_65096_c1
1332 Ga0495601_0026922
1333 Ga0495601_0206480
1334 Ga0495612_0000345
1335 Ga0495619_0002505
1336 Ga0495619_0003421
1337 Ga0495619_0020795
1338 Ga0495619_0043141
1339 Ga0500555_043120
1340 Ga0500627_0038902
1341 Ga0501084_0009922
1342 Ga0501084_0011694
1343 Ga0501082_0003950
1344 Ga0501082_0020780
1345 Ga0501082_0233858
1346 Ga0466962_0058469
1347 Ga0530510_0011114
1348 Ga0530510_0055971
1349 Ga0530510_0062013
1350 2644340517

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

68

311

0.86

PF09084

NMT1

NMT1/THI5 like

93

302

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8522 20 320
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8389 20 333
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8336 20 333
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8193 23 335
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8164 20 327
ID Description Score Start End Superfamily
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8356 110 210 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8209 106 206 3.40.190.10
2x26A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8176 20 320 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8131 110 210 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8084 113 205 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537DMM7-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9893 7 359
AF-A0A537D0Y7-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9893 124 359
AF-A0A537D0Y7-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9852 124 359
AF-A0A537CZX2-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9844 8 302
AF-A0A1X0DT58-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9836 12 351

Map