F474529
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 676 | 310 | 649 | 362 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_10144483|Ga0307406_101444832 |
| Length | 417 |
| Sequence | MIFKDPKQRYDLLAVSVISLKLLIKQISLAGIYIHIPFCKQACHYCNFHFSTSLRYKNELIHALLKEIALTPDFFPEATAHADIIETIYFGGGTPSLCSKDEIKNILDKIRQTFRVSSEAEVTLEANPDDISEEKLLQWKEAGINRLSIGIQSFFEEDLAWMNRAHNSRQAWESLVLATRHFSNITIDLIYGTPALTNEKWKQNVAKAIGLGIPHLSCYALTVEPQTPLQKLIREHKTADVNPDQQSEQFLLLMEWMEQAGYEHYEISNFAKPGFRSRHNSSYWQGKPYFGFGPSAHSFDGRSRWWNIANNNTYIRSIDEGVIPFEQEILTPTQQVNEFIMISLRTQEGLDLARMIRQVHGFTEEKLAEITGNLLSESDKYISKGLMTREEQRLRLTKEGRLLADGIAADLFLLEAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 3 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 4 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 5 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 6 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 7 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 8 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 9 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 10 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 11 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 12 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 13 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 14 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 15 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 16 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 17 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 18 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 19 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 20 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 21 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 22 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 23 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 24 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 25 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 26 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 27 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 28 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 29 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 30 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 31 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 32 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 33 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 34 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 35 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 36 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 37 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 38 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 39 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 42 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 103 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 197 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 211 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 219 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 220 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 221 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 222 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 229 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 254 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 275 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 276 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 277 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 278 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 281 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 282 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 285 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 286 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 292 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 293 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 294 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 295 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 296 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 297 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 298 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 299 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 301 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 302 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 303 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 304 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 305 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 307 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 308 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 310 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.86 |
| Metatranscriptomes | 0 |
| Isolates | 4.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.07 |
| Nodule | 0.3 |
| Rhizoplane | 0.44 |
| Rhizosphere | 86.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1665027 | 2162886007 | Bacteria | 5197 |
| 2 | SwRhRL2b_contig_2641798 | 2162886007 | Bacteria | 2800 |
| 3 | JGI24740J21852_10014041 | 3300001979 | Bacteria | 2968 |
| 4 | JGI24739J22299_10035425 | 3300001989 | Bacteria | 1691 |
| 5 | JGI24751J29686_10000655 | 3300002459 | Bacteria | 8686 |
| 6 | JGI25162J39368_1000258 | 3300002737 | Bacteria | 50724 |
| 7 | JGI25154J39366_1000006 | 3300002738 | Bacteria | 336396 |
| 8 | JGI25153J46596_10000485 | 3300003215 | Bacteria | 25536 |
| 9 | rootH1_10007636 | 3300003316 | Bacteria | 8851 |
| 10 | rootH1_10037394 | 3300003316 | Bacteria | 2846 |
| 11 | rootH1_10058961 | 3300003316 | Bacteria | 5062 |
| 12 | rootH2_10022930 | 3300003320 | Bacteria | 32910 |
| 13 | rootH2_10081840 | 3300003320 | Unclassified | 1190 |
| 14 | rootH2_10085143 | 3300003320 | Bacteria | 3335 |
| 15 | rootL2_10050502 | 3300003322 | Bacteria | 1750 |
| 16 | rootL2_10060108 | 3300003322 | Bacteria | 6828 |
| 17 | rootL2_10105470 | 3300003322 | Bacteria | 2966 |
| 18 | rootL2_10192099 | 3300003322 | Bacteria | 1574 |
| 19 | rootL2_10213233 | 3300003322 | Bacteria | 2465 |
| 20 | rootL2_10283016 | 3300003322 | Bacteria | 2547 |
| 21 | rootH1_10023266 | 3300003316 | Bacteria | 2841 |
| 22 | rootH1_10023266 | 3300003323 | Bacteria | 4469 |
| 23 | rootH1_10023267 | 3300003323 | Bacteria | 3359 |
| 24 | rootH1_10046997 | 3300003323 | Bacteria | 18464 |
| 25 | rootH1_10060702 | 3300003323 | Bacteria | 5254 |
| 26 | rootH1_10088110 | 3300003323 | Bacteria | 8606 |
| 27 | rootH1_10129548 | 3300003323 | Bacteria | 1914 |
| 28 | rootH1_10190552 | 3300003323 | Bacteria | 4189 |
| 29 | rootH1_10205811 | 3300003323 | Bacteria | 6617 |
| 30 | JGI25160J50197_1002148 | 3300003354 | Bacteria | 9337 |
| 31 | Ga0065714_10083948 | 3300005288 | Bacteria | 2206 |
| 32 | Ga0065704_10070489 | 3300005289 | Bacteria | 22644 |
| 33 | Ga0065704_10072160 | 3300005289 | Bacteria | 9027 |
| 34 | Ga0065712_10073522 | 3300005290 | Bacteria | 4360 |
| 35 | Ga0065712_10115534 | 3300005290 | Bacteria | 1742 |
| 36 | Ga0065707_10120143 | 3300005295 | Bacteria | 2142 |
| 37 | Ga0070658_10011999 | 3300005327 | Bacteria | 6957 |
| 38 | Ga0070658_10186103 | 3300005327 | Bacteria | 1749 |
| 39 | Ga0070658_10204591 | 3300005327 | Unclassified | 1666 |
| 40 | Ga0070658_10227206 | 3300005327 | Bacteria | 1580 |
| 41 | Ga0070676_10017971 | 3300005328 | Bacteria | 3915 |
| 42 | Ga0070676_10061023 | 3300005328 | Bacteria | 2240 |
| 43 | Ga0070683_100002583 | 3300005329 | Bacteria | 14483 |
| 44 | Ga0070683_100003463 | 3300005329 | Bacteria | 12826 |
| 45 | Ga0070683_100014557 | 3300005329 | Bacteria | 6886 |
| 46 | Ga0070690_100017866 | 3300005330 | Bacteria | 4275 |
| 47 | Ga0070690_100047972 | 3300005330 | Bacteria | 2718 |
| 48 | Ga0070690_100056863 | 3300005330 | Bacteria | 2509 |
| 49 | Ga0070670_100040014 | 3300005331 | Bacteria | 4032 |
| 50 | Ga0070670_100040716 | 3300005331 | Bacteria | 3993 |
| 51 | Ga0070670_100048124 | 3300005331 | Bacteria | 3669 |
| 52 | Ga0070670_100065603 | 3300005331 | Bacteria | 3115 |
| 53 | Ga0070670_100103128 | 3300005331 | Bacteria | 2457 |
| 54 | Ga0068869_100002467 | 3300005334 | Bacteria | 11156 |
| 55 | Ga0068869_100018710 | 3300005334 | Bacteria | 4721 |
| 56 | Ga0070666_10013725 | 3300005335 | Bacteria | 5143 |
| 57 | Ga0070666_10018557 | 3300005335 | Bacteria | 4476 |
| 58 | Ga0070666_10065281 | 3300005335 | Unclassified | 2470 |
| 59 | Ga0070666_10091233 | 3300005335 | Bacteria | 2093 |
| 60 | Ga0070666_10240820 | 3300005335 | Bacteria | 1279 |
| 61 | Ga0070680_100000268 | 3300005336 | Bacteria | 34613 |
| 62 | Ga0070682_100000121 | 3300005337 | Bacteria | 69122 |
| 63 | Ga0070682_100002103 | 3300005337 | Bacteria | 11066 |
| 64 | Ga0070682_100053130 | 3300005337 | Bacteria | 2538 |
| 65 | Ga0070682_100096896 | 3300005337 | Bacteria | 1940 |
| 66 | Ga0068868_100003164 | 3300005338 | Bacteria | 11456 |
| 67 | Ga0068868_100017935 | 3300005338 | Bacteria | 5281 |
| 68 | Ga0068868_100037742 | 3300005338 | Bacteria | 3747 |
| 69 | Ga0068868_100071496 | 3300005338 | Bacteria | 2767 |
| 70 | Ga0068868_100390529 | 3300005338 | Bacteria | 1199 |
| 71 | Ga0070660_100013028 | 3300005339 | Bacteria | 5951 |
| 72 | Ga0070660_100024051 | 3300005339 | Bacteria | 4519 |
| 73 | Ga0070660_100101803 | 3300005339 | Bacteria | 2276 |
| 74 | Ga0070689_100029970 | 3300005340 | Bacteria | 4126 |
| 75 | Ga0070689_100066581 | 3300005340 | Bacteria | 2806 |
| 76 | Ga0070691_10000271 | 3300005341 | Bacteria | 18096 |
| 77 | Ga0070687_100064062 | 3300005343 | Bacteria | 1952 |
| 78 | Ga0070661_100000111 | 3300005344 | Bacteria | 68066 |
| 79 | Ga0070661_100023047 | 3300005344 | Bacteria | 4461 |
| 80 | Ga0070661_100024199 | 3300005344 | Bacteria | 4355 |
| 81 | Ga0070661_100201233 | 3300005344 | Bacteria | 1522 |
| 82 | Ga0070668_100048430 | 3300005347 | Bacteria | 3268 |
| 83 | Ga0070669_100059867 | 3300005353 | Bacteria | 2796 |
| 84 | Ga0070669_100224026 | 3300005353 | Bacteria | 1488 |
| 85 | Ga0070675_100028857 | 3300005354 | Bacteria | 4470 |
| 86 | Ga0070671_100001071 | 3300005355 | Bacteria | 20211 |
| 87 | Ga0070671_100045530 | 3300005355 | Bacteria | 3648 |
| 88 | Ga0070673_100006098 | 3300005364 | Bacteria | 7810 |
| 89 | Ga0070673_100039851 | 3300005364 | Bacteria | 3599 |
| 90 | Ga0070673_100051667 | 3300005364 | Bacteria | 3221 |
| 91 | Ga0070673_100065303 | 3300005364 | Bacteria | 2902 |
| 92 | Ga0070688_100008316 | 3300005365 | Bacteria | 5629 |
| 93 | Ga0070688_100013987 | 3300005365 | Bacteria | 4539 |
| 94 | Ga0070688_100063656 | 3300005365 | Bacteria | 2338 |
| 95 | Ga0070659_100003782 | 3300005366 | Bacteria | 10802 |
| 96 | Ga0070659_100004992 | 3300005366 | Bacteria | 9504 |
| 97 | Ga0070659_100042015 | 3300005366 | Bacteria | 3575 |
| 98 | Ga0070659_100221079 | 3300005366 | Bacteria | 1563 |
| 99 | Ga0070667_100006052 | 3300005367 | Bacteria | 10050 |
| 100 | Ga0070667_100031584 | 3300005367 | Bacteria | 4415 |
| 101 | Ga0070667_100037265 | 3300005367 | Bacteria | 4077 |
| 102 | Ga0070667_100049812 | 3300005367 | Bacteria | 3529 |
| 103 | Ga0070667_100059798 | 3300005367 | Unclassified | 3224 |
| 104 | Ga0070667_100065563 | 3300005367 | Bacteria | 3084 |
| 105 | Ga0070667_100098839 | 3300005367 | Bacteria | 2518 |
| 106 | Ga0070663_100305307 | 3300005455 | Unclassified | 1275 |
| 107 | Ga0070662_100005807 | 3300005457 | Bacteria | 7913 |
| 108 | Ga0070662_100007166 | 3300005457 | Bacteria | 7222 |
| 109 | Ga0070681_10035895 | 3300005458 | Bacteria | 4979 |
| 110 | Ga0070681_10060332 | 3300005458 | Bacteria | 3770 |
| 111 | Ga0068867_100016665 | 3300005459 | Bacteria | 5219 |
| 112 | Ga0068867_100039839 | 3300005459 | Unclassified | 3427 |
| 113 | Ga0068867_100052616 | 3300005459 | Bacteria | 3005 |
| 114 | Ga0068867_100150006 | 3300005459 | Unclassified | 1830 |
| 115 | Ga0068867_100304831 | 3300005459 | Bacteria | 1314 |
| 116 | Ga0070685_10016650 | 3300005466 | Unclassified | 3921 |
| 117 | Ga0070685_10019407 | 3300005466 | Bacteria | 3666 |
| 118 | Ga0070679_100037756 | 3300005530 | Bacteria | 4799 |
| 119 | Ga0070679_100157899 | 3300005530 | Bacteria | 2242 |
| 120 | Ga0070684_100000105 | 3300005535 | Bacteria | 54272 |
| 121 | Ga0070684_100010934 | 3300005535 | Bacteria | 7213 |
| 122 | Ga0070684_100042770 | 3300005535 | Bacteria | 3913 |
| 123 | Ga0070684_100233094 | 3300005535 | Bacteria | 1681 |
| 124 | Ga0068853_100003177 | 3300005539 | Bacteria | 12555 |
| 125 | Ga0068853_100044698 | 3300005539 | Bacteria | 3791 |
| 126 | Ga0068853_100058967 | 3300005539 | Bacteria | 3315 |
| 127 | Ga0068853_100112909 | 3300005539 | Bacteria | 2415 |
| 128 | Ga0068853_100214820 | 3300005539 | Bacteria | 1754 |
| 129 | Ga0068853_100317114 | 3300005539 | Bacteria | 1444 |
| 130 | Ga0070672_100050493 | 3300005543 | Bacteria | 3240 |
| 131 | Ga0070672_100076134 | 3300005543 | Unclassified | 2680 |
| 132 | Ga0070672_100088937 | 3300005543 | Bacteria | 2487 |
| 133 | Ga0070686_100095597 | 3300005544 | Bacteria | 1996 |
| 134 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 135 | Ga0070665_100005140 | 3300005548 | Bacteria | 13552 |
| 136 | Ga0068855_100006230 | 3300005563 | Bacteria | 14539 |
| 137 | Ga0068855_100011315 | 3300005563 | Bacteria | 10775 |
| 138 | Ga0068855_100023086 | 3300005563 | Bacteria | 7454 |
| 139 | Ga0068855_100026647 | 3300005563 | Bacteria | 6916 |
| 140 | Ga0068855_100057963 | 3300005563 | Bacteria | 4538 |
| 141 | Ga0068855_100084962 | 3300005563 | Bacteria | 3663 |
| 142 | Ga0068855_100095453 | 3300005563 | Bacteria | 3427 |
| 143 | Ga0068855_100117596 | 3300005563 | Bacteria | 3045 |
| 144 | Ga0070664_100000838 | 3300005564 | Bacteria | 23738 |
| 145 | Ga0070664_100035238 | 3300005564 | Bacteria | 4201 |
| 146 | Ga0070664_100075864 | 3300005564 | Bacteria | 2888 |
| 147 | Ga0070664_100197599 | 3300005564 | Bacteria | 1793 |
| 148 | Ga0068857_100002762 | 3300005577 | Bacteria | 14423 |
| 149 | Ga0068857_100005990 | 3300005577 | Bacteria | 10383 |
| 150 | Ga0068857_100040610 | 3300005577 | Bacteria | 4126 |
| 151 | Ga0068857_100062804 | 3300005577 | Bacteria | 3302 |
| 152 | Ga0068857_100187210 | 3300005577 | Unclassified | 1885 |
| 153 | Ga0068854_100050338 | 3300005578 | Bacteria | 2980 |
| 154 | Ga0068854_100057303 | 3300005578 | Bacteria | 2810 |
| 155 | Ga0068856_100030372 | 3300005614 | Bacteria | 5283 |
| 156 | Ga0068856_100140724 | 3300005614 | Bacteria | 2420 |
| 157 | Ga0068856_100199924 | 3300005614 | Bacteria | 2013 |
| 158 | Ga0068852_100000460 | 3300005616 | Bacteria | 26906 |
| 159 | Ga0068852_100005237 | 3300005616 | Bacteria | 9250 |
| 160 | Ga0068852_100153054 | 3300005616 | Bacteria | 2146 |
| 161 | Ga0068859_100000620 | 3300005617 | Bacteria | 35497 |
| 162 | Ga0068859_100007242 | 3300005617 | Bacteria | 11253 |
| 163 | Ga0068859_100085924 | 3300005617 | Unclassified | 3191 |
| 164 | Ga0068864_100015413 | 3300005618 | Bacteria | 6356 |
| 165 | Ga0068864_100034999 | 3300005618 | Bacteria | 4274 |
| 166 | Ga0068864_100039686 | 3300005618 | Bacteria | 4024 |
| 167 | Ga0068864_100086279 | 3300005618 | Bacteria | 2761 |
| 168 | Ga0068864_100172900 | 3300005618 | Bacteria | 1971 |
| 169 | Ga0068866_10005900 | 3300005718 | Bacteria | 5090 |
| 170 | Ga0068866_10028230 | 3300005718 | Bacteria | 2672 |
| 171 | Ga0068861_100012731 | 3300005719 | Bacteria | 5871 |
| 172 | Ga0068861_100021936 | 3300005719 | Bacteria | 4594 |
| 173 | Ga0068861_100145425 | 3300005719 | Bacteria | 1940 |
| 174 | Ga0068851_10006509 | 3300005834 | Bacteria | 5333 |
| 175 | Ga0068851_10046052 | 3300005834 | Bacteria | 2206 |
| 176 | Ga0068851_10052377 | 3300005834 | Bacteria | 2075 |
| 177 | Ga0068851_10085264 | 3300005834 | Bacteria | 1655 |
| 178 | Ga0068863_100022535 | 3300005841 | Bacteria | 6014 |
| 179 | Ga0068863_100045188 | 3300005841 | Bacteria | 4180 |
| 180 | Ga0068863_100071975 | 3300005841 | Bacteria | 3271 |
| 181 | Ga0068863_100123674 | 3300005841 | Bacteria | 2468 |
| 182 | Ga0068858_100070745 | 3300005842 | Bacteria | 3234 |
| 183 | Ga0068858_100142847 | 3300005842 | Bacteria | 2247 |
| 184 | Ga0068858_100346297 | 3300005842 | Bacteria | 1423 |
| 185 | Ga0068860_100000394 | 3300005843 | Bacteria | 57127 |
| 186 | Ga0068860_100014820 | 3300005843 | Bacteria | 7626 |
| 187 | Ga0068860_100031932 | 3300005843 | Bacteria | 5062 |
| 188 | Ga0068860_100394524 | 3300005843 | Bacteria | 1368 |
| 189 | Ga0081540_1004387 | 3300005983 | Bacteria | 10781 |
| 190 | Ga0081539_10000714 | 3300005985 | Bacteria | 66625 |
| 191 | Ga0075366_10000017 | 3300006195 | Bacteria | 63599 |
| 192 | Ga0075366_10001639 | 3300006195 | Bacteria | 11231 |
| 193 | Ga0075366_10014674 | 3300006195 | Bacteria | 4478 |
| 194 | Ga0075366_10064609 | 3300006195 | Bacteria | 2176 |
| 195 | Ga0097621_100000359 | 3300006237 | Bacteria | 31567 |
| 196 | Ga0097621_100005579 | 3300006237 | Bacteria | 8871 |
| 197 | Ga0097621_100015918 | 3300006237 | Bacteria | 5672 |
| 198 | Ga0097621_100019163 | 3300006237 | Bacteria | 5246 |
| 199 | Ga0097621_100048701 | 3300006237 | Bacteria | 3440 |
| 200 | Ga0097621_100219561 | 3300006237 | Bacteria | 1656 |
| 201 | Ga0068871_100001167 | 3300006358 | Bacteria | 17651 |
| 202 | Ga0068871_100005004 | 3300006358 | Bacteria | 9260 |
| 203 | Ga0068871_100092328 | 3300006358 | Bacteria | 2525 |
| 204 | Ga0068871_100355306 | 3300006358 | Bacteria | 1297 |
| 205 | Ga0075428_100013338 | 3300006844 | Bacteria | 9143 |
| 206 | Ga0075428_100313052 | 3300006844 | Bacteria | 1687 |
| 207 | Ga0075430_100000960 | 3300006846 | Bacteria | 22735 |
| 208 | Ga0075431_100003991 | 3300006847 | Bacteria | 14378 |
| 209 | Ga0075431_100063071 | 3300006847 | Bacteria | 3824 |
| 210 | Ga0075429_100000723 | 3300006880 | Bacteria | 25874 |
| 211 | Ga0068865_100012266 | 3300006881 | Bacteria | 5390 |
| 212 | Ga0068865_100037589 | 3300006881 | Bacteria | 3270 |
| 213 | Ga0068865_100095899 | 3300006881 | Bacteria | 2162 |
| 214 | Ga0068865_100115717 | 3300006881 | Bacteria | 1985 |
| 215 | Ga0097620_100000620 | 3300006931 | Bacteria | 35497 |
| 216 | Ga0097620_100007242 | 3300006931 | Bacteria | 11253 |
| 217 | Ga0097620_100085931 | 3300006931 | Unclassified | 3191 |
| 218 | Ga0079104_1000256 | 3300006946 | Bacteria | 71046 |
| 219 | Ga0105244_10000025 | 3300009036 | Bacteria | 217877 |
| 220 | Ga0105240_10008191 | 3300009093 | Bacteria | 14980 |
| 221 | Ga0105240_10020065 | 3300009093 | Bacteria | 8922 |
| 222 | Ga0105240_10025004 | 3300009093 | Bacteria | 7860 |
| 223 | Ga0105240_10049773 | 3300009093 | Bacteria | 5286 |
| 224 | Ga0105240_10150950 | 3300009093 | Bacteria | 2767 |
| 225 | Ga0105240_10184558 | 3300009093 | Bacteria | 2458 |
| 226 | Ga0111539_10030151 | 3300009094 | Bacteria | 6596 |
| 227 | Ga0111539_10390477 | 3300009094 | Bacteria | 1621 |
| 228 | Ga0105245_10091171 | 3300009098 | Bacteria | 2804 |
| 229 | Ga0105247_10000619 | 3300009101 | Bacteria | 28588 |
| 230 | Ga0114129_10041957 | 3300009147 | Bacteria | 6442 |
| 231 | Ga0114129_10120630 | 3300009147 | Bacteria | 3610 |
| 232 | Ga0105243_10000009 | 3300009148 | Bacteria | 354419 |
| 233 | Ga0105241_10000252 | 3300009174 | Bacteria | 40539 |
| 234 | Ga0105241_10002136 | 3300009174 | Bacteria | 14943 |
| 235 | Ga0105241_10019869 | 3300009174 | Bacteria | 4958 |
| 236 | Ga0105241_10092250 | 3300009174 | Bacteria | 2391 |
| 237 | Ga0105241_10186770 | 3300009174 | Unclassified | 1723 |
| 238 | Ga0105242_10031774 | 3300009176 | Bacteria | 4220 |
| 239 | Ga0105242_10041383 | 3300009176 | Bacteria | 3716 |
| 240 | Ga0105242_10053818 | 3300009176 | Bacteria | 3288 |
| 241 | Ga0105242_10498683 | 3300009176 | Bacteria | 1158 |
| 242 | Ga0105248_10033685 | 3300009177 | Bacteria | 5724 |
| 243 | Ga0105248_10510547 | 3300009177 | Bacteria | 1355 |
| 244 | Ga0105237_10000191 | 3300009545 | Bacteria | 87065 |
| 245 | Ga0105237_10000938 | 3300009545 | Bacteria | 39240 |
| 246 | Ga0105237_10006188 | 3300009545 | Bacteria | 13363 |
| 247 | Ga0105237_10008039 | 3300009545 | Bacteria | 11472 |
| 248 | Ga0105237_10008044 | 3300009545 | Bacteria | 11467 |
| 249 | Ga0105237_10012420 | 3300009545 | Bacteria | 8977 |
| 250 | Ga0105237_10034602 | 3300009545 | Bacteria | 5115 |
| 251 | Ga0105237_10128039 | 3300009545 | Bacteria | 2533 |
| 252 | Ga0105238_10004065 | 3300009551 | Bacteria | 14503 |
| 253 | Ga0105238_10023581 | 3300009551 | Bacteria | 6270 |
| 254 | Ga0105238_10139933 | 3300009551 | Bacteria | 2397 |
| 255 | Ga0105249_10001117 | 3300009553 | Bacteria | 23873 |
| 256 | Ga0105249_10001306 | 3300009553 | Bacteria | 21852 |
| 257 | Ga0105249_10017168 | 3300009553 | Bacteria | 6425 |
| 258 | Ga0105249_10028284 | 3300009553 | Bacteria | 5060 |
| 259 | Ga0105249_10079924 | 3300009553 | Bacteria | 3036 |
| 260 | Ga0105249_10220478 | 3300009553 | Unclassified | 1866 |
| 261 | Ga0105239_10003738 | 3300010375 | Bacteria | 18534 |
| 262 | Ga0105239_10006447 | 3300010375 | Bacteria | 13611 |
| 263 | Ga0105239_10006468 | 3300010375 | Bacteria | 13590 |
| 264 | Ga0105239_10013262 | 3300010375 | Bacteria | 9159 |
| 265 | Ga0105239_10018690 | 3300010375 | Bacteria | 7656 |
| 266 | Ga0105246_10085720 | 3300011119 | Bacteria | 2256 |
| 267 | Ga0105246_10165860 | 3300011119 | Bacteria | 1687 |
| 268 | Ga0157373_10005562 | 3300013100 | Bacteria | 9445 |
| 269 | Ga0157373_10021611 | 3300013100 | Unclassified | 4672 |
| 270 | Ga0157373_10058618 | 3300013100 | Unclassified | 2729 |
| 271 | Ga0157373_10091764 | 3300013100 | Bacteria | 2139 |
| 272 | Ga0157371_10010282 | 3300013102 | Bacteria | 7299 |
| 273 | Ga0157371_10010327 | 3300013102 | Bacteria | 7286 |
| 274 | Ga0157371_10157541 | 3300013102 | Bacteria | 1621 |
| 275 | Ga0157370_10010610 | 3300013104 | Bacteria | 9697 |
| 276 | Ga0157370_10013171 | 3300013104 | Bacteria | 8529 |
| 277 | Ga0157370_10029357 | 3300013104 | Bacteria | 5397 |
| 278 | Ga0157370_10204091 | 3300013104 | Bacteria | 1833 |
| 279 | Ga0157370_10344279 | 3300013104 | Bacteria | 1374 |
| 280 | Ga0157369_10006913 | 3300013105 | Bacteria | 13093 |
| 281 | Ga0157369_10058404 | 3300013105 | Bacteria | 4162 |
| 282 | Ga0157374_10000011 | 3300013296 | Bacteria | 466749 |
| 283 | Ga0157374_10004430 | 3300013296 | Bacteria | 11807 |
| 284 | Ga0157374_10009692 | 3300013296 | Bacteria | 8270 |
| 285 | Ga0157374_10197668 | 3300013296 | Bacteria | 1968 |
| 286 | Ga0157374_10289602 | 3300013296 | Bacteria | 1618 |
| 287 | Ga0157374_10548456 | 3300013296 | Bacteria | 1164 |
| 288 | Ga0157378_10007261 | 3300013297 | Bacteria | 9675 |
| 289 | Ga0157378_10061615 | 3300013297 | Bacteria | 3349 |
| 290 | Ga0157378_10066657 | 3300013297 | Unclassified | 3225 |
| 291 | Ga0157378_10269177 | 3300013297 | Bacteria | 1638 |
| 292 | Ga0163162_10001000 | 3300013306 | Bacteria | 26251 |
| 293 | Ga0163162_10007147 | 3300013306 | Bacteria | 10837 |
| 294 | Ga0163162_10103635 | 3300013306 | Bacteria | 2939 |
| 295 | Ga0163162_10126262 | 3300013306 | Bacteria | 2664 |
| 296 | Ga0163162_10194665 | 3300013306 | Bacteria | 2156 |
| 297 | Ga0157372_10001585 | 3300013307 | Bacteria | 24755 |
| 298 | Ga0157372_10012413 | 3300013307 | Bacteria | 9079 |
| 299 | Ga0157372_10022925 | 3300013307 | Bacteria | 6762 |
| 300 | Ga0157372_10034739 | 3300013307 | Bacteria | 5546 |
| 301 | Ga0157372_10077080 | 3300013307 | Bacteria | 3764 |
| 302 | Ga0157372_10083286 | 3300013307 | Bacteria | 3623 |
| 303 | Ga0157372_10115305 | 3300013307 | Unclassified | 3080 |
| 304 | Ga0157372_10154852 | 3300013307 | Bacteria | 2647 |
| 305 | Ga0157372_10293439 | 3300013307 | Bacteria | 1891 |
| 306 | Ga0157375_10002200 | 3300013308 | Bacteria | 16851 |
| 307 | Ga0157375_10043524 | 3300013308 | Bacteria | 4355 |
| 308 | Ga0157375_10127417 | 3300013308 | Bacteria | 2662 |
| 309 | Ga0157375_10160772 | 3300013308 | Unclassified | 2387 |
| 310 | Ga0157375_10176974 | 3300013308 | Bacteria | 2283 |
| 311 | Ga0157375_10415969 | 3300013308 | Bacteria | 1511 |
| 312 | Ga0163163_10000831 | 3300014325 | Bacteria | 26270 |
| 313 | Ga0163163_10545822 | 3300014325 | Bacteria | 1221 |
| 314 | Ga0157380_10000295 | 3300014326 | Bacteria | 29994 |
| 315 | Ga0157380_10003690 | 3300014326 | Bacteria | 10535 |
| 316 | Ga0157380_10006038 | 3300014326 | Bacteria | 8484 |
| 317 | Ga0157380_10007843 | 3300014326 | Bacteria | 7600 |
| 318 | Ga0157380_10137672 | 3300014326 | Bacteria | 2092 |
| 319 | Ga0157380_10193763 | 3300014326 | Bacteria | 1797 |
| 320 | Ga0157380_10211019 | 3300014326 | Bacteria | 1730 |
| 321 | Ga0157380_10453299 | 3300014326 | Bacteria | 1232 |
| 322 | Ga0157377_10116447 | 3300014745 | Bacteria | 1614 |
| 323 | Ga0157379_10010412 | 3300014968 | Bacteria | 8103 |
| 324 | Ga0157379_10016392 | 3300014968 | Bacteria | 6517 |
| 325 | Ga0157379_10199582 | 3300014968 | Bacteria | 1809 |
| 326 | Ga0157379_10318506 | 3300014968 | Bacteria | 1420 |
| 327 | Ga0157376_10000938 | 3300014969 | Bacteria | 18935 |
| 328 | Ga0157376_10002924 | 3300014969 | Bacteria | 11719 |
| 329 | Ga0157376_10046953 | 3300014969 | Bacteria | 3564 |
| 330 | Ga0157376_10079127 | 3300014969 | Bacteria | 2817 |
| 331 | Ga0157376_10158982 | 3300014969 | Bacteria | 2046 |
| 332 | Ga0182005_1000017 | 3300015265 | Bacteria | 331828 |
| 333 | Ga0163161_10000014 | 3300017792 | Bacteria | 258440 |
| 334 | Ga0163161_10003336 | 3300017792 | Bacteria | 11258 |
| 335 | Ga0163161_10020278 | 3300017792 | Bacteria | 4664 |
| 336 | Ga0163161_10051257 | 3300017792 | Bacteria | 2989 |
| 337 | Ga0163161_10124095 | 3300017792 | Bacteria | 1943 |
| 338 | Ga0209436_100091 | 3300025208 | Bacteria | 44391 |
| 339 | Ga0209646_1000031 | 3300025246 | Bacteria | 381260 |
| 340 | Ga0209026_1000019 | 3300025250 | Bacteria | 381260 |
| 341 | Ga0209130_1000333 | 3300025284 | Bacteria | 54192 |
| 342 | Ga0209758_1001097 | 3300025297 | Bacteria | 35040 |
| 343 | Ga0207426_1000024 | 3300025302 | Bacteria | 534075 |
| 344 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 345 | Ga0207426_1000691 | 3300025302 | Bacteria | 40521 |
| 346 | Ga0207656_10019824 | 3300025321 | Bacteria | 2664 |
| 347 | Ga0207656_10045420 | 3300025321 | Bacteria | 1880 |
| 348 | Ga0207655_1000003 | 3300025728 | Bacteria | 1081376 |
| 349 | Ga0207710_10004843 | 3300025900 | Bacteria | 5838 |
| 350 | Ga0207680_10043718 | 3300025903 | Unclassified | 2629 |
| 351 | Ga0207680_10055071 | 3300025903 | Bacteria | 2395 |
| 352 | Ga0207647_10000096 | 3300025904 | Bacteria | 67468 |
| 353 | Ga0207685_10066048 | 3300025905 | Bacteria | 1450 |
| 354 | Ga0207645_10002123 | 3300025907 | Bacteria | 15868 |
| 355 | Ga0207643_10053248 | 3300025908 | Bacteria | 2299 |
| 356 | Ga0207643_10187738 | 3300025908 | Bacteria | 1253 |
| 357 | Ga0207705_10203833 | 3300025909 | Bacteria | 1499 |
| 358 | Ga0207654_10006725 | 3300025911 | Bacteria | 5780 |
| 359 | Ga0207654_10012351 | 3300025911 | Bacteria | 4377 |
| 360 | Ga0207707_10004370 | 3300025912 | Bacteria | 12497 |
| 361 | Ga0207707_10045387 | 3300025912 | Bacteria | 3830 |
| 362 | Ga0207695_10000212 | 3300025913 | Bacteria | 156450 |
| 363 | Ga0207695_10001387 | 3300025913 | Bacteria | 40927 |
| 364 | Ga0207695_10037303 | 3300025913 | Bacteria | 5245 |
| 365 | Ga0207695_10057600 | 3300025913 | Bacteria | 4036 |
| 366 | Ga0207671_10001331 | 3300025914 | Bacteria | 28876 |
| 367 | Ga0207671_10001357 | 3300025914 | Bacteria | 28586 |
| 368 | Ga0207671_10001792 | 3300025914 | Bacteria | 24073 |
| 369 | Ga0207671_10022086 | 3300025914 | Bacteria | 4816 |
| 370 | Ga0207671_10023899 | 3300025914 | Bacteria | 4603 |
| 371 | Ga0207671_10040837 | 3300025914 | Bacteria | 3433 |
| 372 | Ga0207671_10057849 | 3300025914 | Bacteria | 2874 |
| 373 | Ga0207662_10114215 | 3300025918 | Bacteria | 1687 |
| 374 | Ga0207657_10005058 | 3300025919 | Bacteria | 13836 |
| 375 | Ga0207657_10024210 | 3300025919 | Bacteria | 5632 |
| 376 | Ga0207649_10000517 | 3300025920 | Bacteria | 27099 |
| 377 | Ga0207649_10042501 | 3300025920 | Unclassified | 2773 |
| 378 | Ga0207649_10169274 | 3300025920 | Bacteria | 1520 |
| 379 | Ga0207652_10011840 | 3300025921 | Bacteria | 7036 |
| 380 | Ga0207652_10216432 | 3300025921 | Bacteria | 1726 |
| 381 | Ga0207681_10020339 | 3300025923 | Bacteria | 4204 |
| 382 | Ga0207681_10093448 | 3300025923 | Unclassified | 2153 |
| 383 | Ga0207694_10078063 | 3300025924 | Bacteria | 2595 |
| 384 | Ga0207650_10094137 | 3300025925 | Bacteria | 2294 |
| 385 | Ga0207659_10020402 | 3300025926 | Bacteria | 4380 |
| 386 | Ga0207659_10088658 | 3300025926 | Bacteria | 2305 |
| 387 | Ga0207644_10014077 | 3300025931 | Bacteria | 5349 |
| 388 | Ga0207690_10267819 | 3300025932 | Bacteria | 1326 |
| 389 | Ga0207706_10001896 | 3300025933 | Bacteria | 20531 |
| 390 | Ga0207706_10008919 | 3300025933 | Bacteria | 9232 |
| 391 | Ga0207686_10003596 | 3300025934 | Bacteria | 8305 |
| 392 | Ga0207709_10000026 | 3300025935 | Bacteria | 354467 |
| 393 | Ga0207670_10022409 | 3300025936 | Bacteria | 3914 |
| 394 | Ga0207669_10140389 | 3300025937 | Bacteria | 1676 |
| 395 | Ga0207704_10064983 | 3300025938 | Unclassified | 2282 |
| 396 | Ga0207691_10030881 | 3300025940 | Bacteria | 5003 |
| 397 | Ga0207691_10041641 | 3300025940 | Unclassified | 4239 |
| 398 | Ga0207691_10045858 | 3300025940 | Bacteria | 4018 |
| 399 | Ga0207689_10002065 | 3300025942 | Bacteria | 18954 |
| 400 | Ga0207689_10002750 | 3300025942 | Bacteria | 16259 |
| 401 | Ga0207689_10023984 | 3300025942 | Bacteria | 5118 |
| 402 | Ga0207689_10053043 | 3300025942 | Bacteria | 3340 |
| 403 | Ga0207689_10078622 | 3300025942 | Bacteria | 2711 |
| 404 | Ga0207661_10001812 | 3300025944 | Bacteria | 14604 |
| 405 | Ga0207661_10010041 | 3300025944 | Bacteria | 6802 |
| 406 | Ga0207661_10284543 | 3300025944 | Bacteria | 1478 |
| 407 | Ga0207679_10000091 | 3300025945 | Bacteria | 78725 |
| 408 | Ga0207679_10036462 | 3300025945 | Bacteria | 3488 |
| 409 | Ga0207667_10000414 | 3300025949 | Bacteria | 57815 |
| 410 | Ga0207667_10006924 | 3300025949 | Bacteria | 13699 |
| 411 | Ga0207667_10008497 | 3300025949 | Bacteria | 12190 |
| 412 | Ga0207667_10022188 | 3300025949 | Bacteria | 7021 |
| 413 | Ga0207667_10045879 | 3300025949 | Bacteria | 4627 |
| 414 | Ga0207651_10009976 | 3300025960 | Bacteria | 5235 |
| 415 | Ga0207651_10024166 | 3300025960 | Unclassified | 3754 |
| 416 | Ga0207651_10033617 | 3300025960 | Bacteria | 3310 |
| 417 | Ga0207651_10053609 | 3300025960 | Bacteria | 2758 |
| 418 | Ga0207651_10063786 | 3300025960 | Unclassified | 2575 |
| 419 | Ga0207712_10000725 | 3300025961 | Bacteria | 25158 |
| 420 | Ga0207712_10000915 | 3300025961 | Bacteria | 21389 |
| 421 | Ga0207712_10001923 | 3300025961 | Bacteria | 13655 |
| 422 | Ga0207712_10016389 | 3300025961 | Bacteria | 4797 |
| 423 | Ga0207712_10101099 | 3300025961 | Bacteria | 2143 |
| 424 | Ga0207668_10136275 | 3300025972 | Bacteria | 1881 |
| 425 | Ga0207640_10053742 | 3300025981 | Bacteria | 2630 |
| 426 | Ga0207640_10328775 | 3300025981 | Bacteria | 1220 |
| 427 | Ga0207658_10025912 | 3300025986 | Bacteria | 4108 |
| 428 | Ga0207658_10026833 | 3300025986 | Bacteria | 4042 |
| 429 | Ga0207658_10086364 | 3300025986 | Unclassified | 2419 |
| 430 | Ga0207658_10135087 | 3300025986 | Bacteria | 1987 |
| 431 | Ga0207677_10101709 | 3300026023 | Bacteria | 2117 |
| 432 | Ga0207703_10020625 | 3300026035 | Bacteria | 5155 |
| 433 | Ga0207639_10004779 | 3300026041 | Bacteria | 9134 |
| 434 | Ga0207639_10085621 | 3300026041 | Bacteria | 2507 |
| 435 | Ga0207639_10092413 | 3300026041 | Bacteria | 2425 |
| 436 | Ga0207678_10050208 | 3300026067 | Bacteria | 3604 |
| 437 | Ga0207708_10353361 | 3300026075 | Bacteria | 1206 |
| 438 | Ga0207702_10011662 | 3300026078 | Bacteria | 7321 |
| 439 | Ga0207702_10174712 | 3300026078 | Bacteria | 1973 |
| 440 | Ga0207702_10289456 | 3300026078 | Bacteria | 1551 |
| 441 | Ga0207641_10002004 | 3300026088 | Bacteria | 19426 |
| 442 | Ga0207641_10039756 | 3300026088 | Bacteria | 3935 |
| 443 | Ga0207641_10084252 | 3300026088 | Bacteria | 2767 |
| 444 | Ga0207641_10090078 | 3300026088 | Bacteria | 2682 |
| 445 | Ga0207641_10158141 | 3300026088 | Bacteria | 2058 |
| 446 | Ga0207648_10001340 | 3300026089 | Bacteria | 27318 |
| 447 | Ga0207648_10001507 | 3300026089 | Bacteria | 25668 |
| 448 | Ga0207648_10022209 | 3300026089 | Bacteria | 5700 |
| 449 | Ga0207648_10272762 | 3300026089 | Unclassified | 1511 |
| 450 | Ga0207676_10017907 | 3300026095 | Bacteria | 5141 |
| 451 | Ga0207676_10021806 | 3300026095 | Bacteria | 4704 |
| 452 | Ga0207676_10137961 | 3300026095 | Bacteria | 2084 |
| 453 | Ga0207676_10365803 | 3300026095 | Bacteria | 1338 |
| 454 | Ga0207674_10006954 | 3300026116 | Bacteria | 13246 |
| 455 | Ga0207674_10020844 | 3300026116 | Bacteria | 7074 |
| 456 | Ga0207674_10079222 | 3300026116 | Bacteria | 3290 |
| 457 | Ga0207674_10084698 | 3300026116 | Bacteria | 3167 |
| 458 | Ga0207674_10192364 | 3300026116 | Bacteria | 1990 |
| 459 | Ga0207675_100003521 | 3300026118 | Bacteria | 15283 |
| 460 | Ga0207675_100020709 | 3300026118 | Bacteria | 6132 |
| 461 | Ga0207675_100022252 | 3300026118 | Bacteria | 5903 |
| 462 | Ga0207675_100048083 | 3300026118 | Bacteria | 3982 |
| 463 | Ga0207675_100055083 | 3300026118 | Bacteria | 3710 |
| 464 | Ga0207675_100124453 | 3300026118 | Bacteria | 2442 |
| 465 | Ga0207675_100234511 | 3300026118 | Bacteria | 1771 |
| 466 | Ga0207683_10002163 | 3300026121 | Bacteria | 17263 |
| 467 | Ga0207698_10000539 | 3300026142 | Bacteria | 21930 |
| 468 | Ga0207698_10004422 | 3300026142 | Bacteria | 8564 |
| 469 | Ga0207698_10045981 | 3300026142 | Bacteria | 3292 |
| 470 | Ga0209281_1000115 | 3300027111 | Bacteria | 210393 |
| 471 | Ga0268266_10000068 | 3300028379 | Bacteria | 241100 |
| 472 | Ga0268266_10122070 | 3300028379 | Unclassified | 2319 |
| 473 | Ga0268264_10000559 | 3300028381 | Bacteria | 45910 |
| 474 | Ga0268264_10017234 | 3300028381 | Bacteria | 5917 |
| 475 | Ga0268264_10050501 | 3300028381 | Bacteria | 3463 |
| 476 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 477 | Ga0307515_10000012 | 3300028794 | Bacteria | 582232 |
| 478 | Ga0307515_10001810 | 3300028794 | Bacteria | 47689 |
| 479 | Ga0307515_10002270 | 3300028794 | Bacteria | 42110 |
| 480 | Ga0307515_10156850 | 3300028794 | Bacteria | 2344 |
| 481 | Ga0316177_1089742 | 3300030731 | Bacteria | 1721 |
| 482 | Ga0265327_10000059 | 3300031251 | Bacteria | 236935 |
| 483 | Ga0265327_10000199 | 3300031251 | Bacteria | 125838 |
| 484 | Ga0265327_10032218 | 3300031251 | Bacteria | 2936 |
| 485 | Ga0307513_10043985 | 3300031456 | Bacteria | 4897 |
| 486 | Ga0307408_100000856 | 3300031548 | Bacteria | 23954 |
| 487 | Ga0307408_100013451 | 3300031548 | Bacteria | 5431 |
| 488 | Ga0307405_10000004 | 3300031731 | Bacteria | 444977 |
| 489 | Ga0307405_10100442 | 3300031731 | Bacteria | 1939 |
| 490 | Ga0307413_10000007 | 3300031824 | Bacteria | 65102 |
| 491 | Ga0307413_10017033 | 3300031824 | Bacteria | 3775 |
| 492 | Ga0307413_10019663 | 3300031824 | Bacteria | 3575 |
| 493 | Ga0307410_10000120 | 3300031852 | Bacteria | 27455 |
| 494 | Ga0307410_10007574 | 3300031852 | Bacteria | 5955 |
| 495 | Ga0307406_10000011 | 3300031901 | Bacteria | 112730 |
| 496 | Ga0307406_10144483 | 3300031901 | Bacteria | 1689 |
| 497 | Ga0307407_10009643 | 3300031903 | Bacteria | 4507 |
| 498 | Ga0307412_10004038 | 3300031911 | Bacteria | 8178 |
| 499 | Ga0307416_100001392 | 3300032002 | Bacteria | 13100 |
| 500 | Ga0307416_100016391 | 3300032002 | Bacteria | 5150 |
| 501 | Ga0307416_100065853 | 3300032002 | Unclassified | 2980 |
| 502 | Ga0307414_10000014 | 3300032004 | Bacteria | 302974 |
| 503 | Ga0307414_10007685 | 3300032004 | Bacteria | 6072 |
| 504 | Ga0307414_10008348 | 3300032004 | Bacteria | 5866 |
| 505 | Ga0307411_10000033 | 3300032005 | Bacteria | 45514 |
| 506 | Ga0307411_10029017 | 3300032005 | Bacteria | 3373 |
| 507 | Ga0307415_100003538 | 3300032126 | Bacteria | 7968 |
| 508 | Ga0307415_100004256 | 3300032126 | Bacteria | 7401 |
| 509 | Ga0307510_10102177 | 3300033180 | Bacteria | 2650 |
| 510 | Ga0373934_0080323 | 3300035086 | Bacteria | 1310 |
| 511 | Ga0373946_0070590 | 3300035171 | Bacteria | 1508 |
| 512 | Ga0316574_0234993 | 3300035398 | Bacteria | 1172 |
| 513 | Ga0395900_0003671 | 3300037418 | Bacteria | 16502 |
| 514 | Ga0395900_0065448 | 3300037418 | Bacteria | 3734 |
| 515 | Ga0395898_0201579 | 3300037466 | Bacteria | 1900 |
| 516 | Ga0395905_0006214 | 3300037471 | Bacteria | 12056 |
| 517 | Ga0395905_0199579 | 3300037471 | Bacteria | 1875 |
| 518 | Ga0395901_0074733 | 3300038443 | Bacteria | 3535 |
| 519 | Ga0439436_0000350 | 3300041404 | Bacteria | 11404 |
| 520 | Ga0439439_0011292 | 3300041406 | Bacteria | 2148 |
| 521 | Ga0451837_0682610 | 3300041494 | Bacteria | 1922 |
| 522 | Ga0439457_000130 | 3300042014 | Bacteria | 18863 |
| 523 | Ga0439457_024499 | 3300042014 | Bacteria | 1335 |
| 524 | Ga0450894_003099 | 3300042131 | Bacteria | 2193 |
| 525 | Ga0451577_0148156 | 3300042876 | Unclassified | 2111 |
| 526 | Ga0466969_0000356 | 3300044656 | Bacteria | 25182 |
| 527 | Ga0466972_0000026 | 3300044658 | Bacteria | 184739 |
| 528 | Ga0466972_0000047 | 3300044658 | Bacteria | 122901 |
| 529 | Ga0466972_0001885 | 3300044658 | Bacteria | 10291 |
| 530 | Ga0466966_0000038 | 3300044684 | Bacteria | 97255 |
| 531 | Ga0453684_0001806 | 3300044712 | Bacteria | 56712 |
| 532 | Ga0453684_0021742 | 3300044712 | Bacteria | 9564 |
| 533 | Ga0453684_0118592 | 3300044712 | Bacteria | 3200 |
| 534 | Ga0453684_0431476 | 3300044712 | Bacteria | 1470 |
| 535 | Ga0466968_0016485 | 3300044735 | Bacteria | 2943 |
| 536 | Ga0466968_0072521 | 3300044735 | Bacteria | 1501 |
| 537 | Ga0466968_0075604 | 3300044735 | Unclassified | 1473 |
| 538 | Ga0466970_0000091 | 3300044765 | Bacteria | 38259 |
| 539 | Ga0466957_0000329 | 3300044842 | Bacteria | 23093 |
| 540 | Ga0466957_0000739 | 3300044842 | Bacteria | 16704 |
| 541 | Ga0466959_0000289 | 3300045049 | Bacteria | 30468 |
| 542 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 543 | Ga0495638_0016015 | 3300046460 | Bacteria | 5025 |
| 544 | Ga0495638_0081989 | 3300046460 | Bacteria | 1957 |
| 545 | Ga0495651_0151850 | 3300046462 | Bacteria | 1669 |
| 546 | Ga0495653_0109404 | 3300046463 | Bacteria | 1989 |
| 547 | Ga0495650_0000081 | 3300046471 | Bacteria | 240957 |
| 548 | Ga0495585_0000950 | 3300046492 | Bacteria | 24426 |
| 549 | Ga0495628_0147456 | 3300046516 | Bacteria | 1793 |
| 550 | Ga0495643_0027265 | 3300046522 | Bacteria | 3213 |
| 551 | Ga0495648_0002523 | 3300046524 | Bacteria | 16787 |
| 552 | Ga0495609_0003529 | 3300046538 | Bacteria | 8912 |
| 553 | Ga0495633_0000026 | 3300046558 | Bacteria | 204722 |
| 554 | Ga0495668_0000054 | 3300046616 | Bacteria | 203960 |
| 555 | Ga0495668_0001528 | 3300046616 | Bacteria | 21968 |
| 556 | Ga0495625_0000168 | 3300046660 | Bacteria | 102626 |
| 557 | Ga0495625_0001205 | 3300046660 | Bacteria | 32862 |
| 558 | Ga0495625_0103299 | 3300046660 | Bacteria | 1955 |
| 559 | Ga0495625_0105718 | 3300046660 | Bacteria | 1928 |
| 560 | Ga0495658_0007766 | 3300046683 | Bacteria | 5310 |
| 561 | Ga0495649_0048889 | 3300046694 | Bacteria | 2298 |
| 562 | Ga0495672_0030404 | 3300047320 | Bacteria | 3389 |
| 563 | Ga0495680_0182403 | 3300047322 | Bacteria | 1514 |
| 564 | Ga0495687_000058 | 3300047443 | Bacteria | 185830 |
| 565 | Ga0495686_0150112 | 3300047472 | Bacteria | 1369 |
| 566 | Ga0496106_0056974 | 3300048909 | Bacteria | 2955 |
| 567 | Ga0496111_0125380 | 3300048914 | Bacteria | 1898 |
| 568 | Ga0496114_0038907 | 3300048917 | Unclassified | 3936 |
| 569 | Ga0496116_0000002 | 3300048919 | Bacteria | 920291 |
| 570 | Ga0496116_0025953 | 3300048919 | Bacteria | 4295 |
| 571 | Ga0496121_0143642 | 3300048924 | Bacteria | 1767 |
| 572 | Ga0496125_0000007 | 3300048928 | Bacteria | 715355 |
| 573 | Ga0496126_0046451 | 3300048929 | Bacteria | 3982 |
| 574 | Ga0496126_0312642 | 3300048929 | Bacteria | 1293 |
| 575 | Ga0495682_0016019 | 3300049460 | Bacteria | 2837 |
| 576 | Ga0501032_0011039 | 3300049569 | Bacteria | 6493 |
| 577 | Ga0501032_0142832 | 3300049569 | Bacteria | 1576 |
| 578 | Ga0501034_0072688 | 3300049571 | Bacteria | 3448 |
| 579 | Ga0501036_0046476 | 3300049572 | Bacteria | 3676 |
| 580 | Ga0501037_0091082 | 3300049573 | Bacteria | 2205 |
| 581 | Ga0501038_0047620 | 3300049574 | Bacteria | 3713 |
| 582 | Ga0501040_0022226 | 3300049576 | Bacteria | 4244 |
| 583 | Ga0501043_0002152 | 3300049579 | Bacteria | 16797 |
| 584 | Ga0501043_0016289 | 3300049579 | Bacteria | 5829 |
| 585 | Ga0501043_0127082 | 3300049579 | Unclassified | 1999 |
| 586 | Ga0501046_0041183 | 3300049580 | Bacteria | 3687 |
| 587 | Ga0501046_0051262 | 3300049580 | Bacteria | 3257 |
| 588 | Ga0501047_0032624 | 3300049581 | Bacteria | 5028 |
| 589 | Ga0501047_0037183 | 3300049581 | Bacteria | 4707 |
| 590 | Ga0501047_0073494 | 3300049581 | Bacteria | 3292 |
| 591 | Ga0501047_0218087 | 3300049581 | Bacteria | 1764 |
| 592 | Ga0501048_0029256 | 3300049582 | Bacteria | 3997 |
| 593 | Ga0501067_0075771 | 3300049583 | Bacteria | 1864 |
| 594 | Ga0501068_0034965 | 3300049584 | Bacteria | 2999 |
| 595 | Ga0501070_0072073 | 3300049586 | Bacteria | 2860 |
| 596 | Ga0501072_0065688 | 3300049588 | Unclassified | 2861 |
| 597 | Ga0501074_0021945 | 3300049590 | Bacteria | 4636 |
| 598 | Ga0501202_000230 | 3300049652 | Bacteria | 7373 |
| 599 | Ga0501249_000015 | 3300049679 | Bacteria | 124336 |
| 600 | Ga0501249_000664 | 3300049679 | Bacteria | 7877 |
| 601 | Ga0501219_000020 | 3300049703 | Bacteria | 25032 |
| 602 | Ga0501225_0011909 | 3300049705 | Bacteria | 2446 |
| 603 | Ga0501079_0008887 | 3300049741 | Bacteria | 7607 |
| 604 | Ga0501079_0034323 | 3300049741 | Bacteria | 3904 |
| 605 | Ga0501080_0039205 | 3300049742 | Bacteria | 4421 |
| 606 | Ga0501080_0127762 | 3300049742 | Bacteria | 2353 |
| 607 | Ga0501241_008741 | 3300049758 | Bacteria | 1848 |
| 608 | Ga0501264_000187 | 3300049761 | Bacteria | 9940 |
| 609 | Ga0501035_0023552 | 3300049822 | Bacteria | 5649 |
| 610 | Ga0501044_0005008 | 3300049823 | Bacteria | 14790 |
| 611 | Ga0501044_0028917 | 3300049823 | Bacteria | 5846 |
| 612 | Ga0501044_0041171 | 3300049823 | Bacteria | 4810 |
| 613 | Ga0501044_0069430 | 3300049823 | Bacteria | 3587 |
| 614 | Ga0501284_00030 | 3300050005 | Bacteria | 71858 |
| 615 | nmdc:mga0k408_65980_c1 | 3300050493 | Bacteria | 2107 |
| 616 | nmdc:mga0k408_81_c1 | 3300050493 | Bacteria | 45236 |
| 617 | nmdc:mga0k408_9076_c1 | 3300050493 | Bacteria | 5352 |
| 618 | nmdc:mga05p37_32575_c1 | 3300050507 | Bacteria | 6374 |
| 619 | nmdc:mga09592_998_c1 | 3300050508 | Bacteria | 22420 |
| 620 | nmdc:mga0qj67_14877_c1 | 3300050509 | Bacteria | 5886 |
| 621 | nmdc:mga06r32_26115_c1 | 3300050510 | Bacteria | 5441 |
| 622 | nmdc:mga08y16_72331_c1 | 3300050511 | Bacteria | 3593 |
| 623 | Ga0500578_0000469 | 3300053086 | Bacteria | 49263 |
| 624 | Ga0500578_0137110 | 3300053086 | Bacteria | 1531 |
| 625 | Ga0500647_0087718 | 3300053091 | Bacteria | 1491 |
| 626 | Ga0500583_0000182 | 3300053092 | Bacteria | 25516 |
| 627 | Ga0500583_0000288 | 3300053092 | Bacteria | 17461 |
| 628 | Ga0500583_0072611 | 3300053092 | Bacteria | 1648 |
| 629 | Ga0500641_0002301 | 3300053096 | Bacteria | 6777 |
| 630 | Ga0500641_0018407 | 3300053096 | Bacteria | 2627 |
| 631 | Ga0500650_0050089 | 3300053098 | Bacteria | 1939 |
| 632 | Ga0500562_000005 | 3300053108 | Bacteria | 266746 |
| 633 | Ga0500594_0015338 | 3300053118 | Bacteria | 1847 |
| 634 | Ga0500594_0019407 | 3300053118 | Bacteria | 1685 |
| 635 | Ga0500614_007348 | 3300053123 | Bacteria | 2322 |
| 636 | Ga0500618_000016 | 3300053125 | Bacteria | 164049 |
| 637 | Ga0500652_006537 | 3300053131 | Bacteria | 3760 |
| 638 | Ga0500559_0051831 | 3300053136 | Bacteria | 1813 |
| 639 | Ga0500568_0005771 | 3300053139 | Bacteria | 6335 |
| 640 | Ga0500589_003476 | 3300053147 | Bacteria | 5674 |
| 641 | Ga0500622_0001399 | 3300053156 | Bacteria | 19440 |
| 642 | Ga0500622_0001705 | 3300053156 | Bacteria | 17048 |
| 643 | Ga0500622_0011213 | 3300053156 | Bacteria | 4891 |
| 644 | Ga0500622_0024966 | 3300053156 | Bacteria | 3159 |
| 645 | Ga0500627_0071077 | 3300053158 | Bacteria | 1542 |
| 646 | Ga0500611_000039 | 3300053727 | Bacteria | 68825 |
| 647 | Ga0500645_009542 | 3300053730 | Bacteria | 3255 |
| 648 | Ga0501084_0019472 | 3300054114 | Bacteria | 5654 |
| 649 | Ga0501084_0102931 | 3300054114 | Bacteria | 2398 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013307 | Ga0157372_10115305 | Ga0157372_101153052 | 268 |
| 2 | 3300013297 | Ga0157378_10007261 | Ga0157378_100072613 | 271 |
| 3 | 3300005339 | Ga0070660_100013028 | Ga0070660_1000130285 | 286 |
| 4 | 3300049573 | Ga0501037_0091082 | Ga0501037_0091082_1275_2192 | 287 |
| 5 | 3300005335 | Ga0070666_10240820 | Ga0070666_102408201 | 301 |
| 6 | 3300005718 | Ga0068866_10028230 | Ga0068866_100282302 | 301 |
| 7 | 3300005842 | Ga0068858_100346297 | Ga0068858_1003462972 | 301 |
| 8 | 3300009093 | Ga0105240_10049773 | Ga0105240_100497731 | 301 |
| 9 | 3300009545 | Ga0105237_10000938 | Ga0105237_1000093832 | 301 |
| 10 | 3300010375 | Ga0105239_10006447 | Ga0105239_100064475 | 301 |
| 11 | 3300028381 | Ga0268264_10050501 | Ga0268264_100505012 | 301 |
| 12 | 3300005327 | Ga0070658_10186103 | Ga0070658_101861032 | 303 |
| 13 | 3300025909 | Ga0207705_10203833 | Ga0207705_102038331 | 303 |
| 14 | 3300005343 | Ga0070687_100064062 | Ga0070687_1000640622 | 306 |
| 15 | 3300005364 | Ga0070673_100039851 | Ga0070673_1000398513 | 306 |
| 16 | 3300005365 | Ga0070688_100063656 | Ga0070688_1000636562 | 306 |
| 17 | 3300005466 | Ga0070685_10019407 | Ga0070685_100194071 | 306 |
| 18 | 3300005617 | Ga0068859_100007242 | Ga0068859_1000072427 | 306 |
| 19 | 3300005618 | Ga0068864_100015413 | Ga0068864_1000154133 | 306 |
| 20 | 3300005618 | Ga0068864_100172900 | Ga0068864_1001729002 | 306 |
| 21 | 3300005719 | Ga0068861_100145425 | Ga0068861_1001454253 | 306 |
| 22 | 3300005842 | Ga0068858_100142847 | Ga0068858_1001428473 | 306 |
| 23 | 3300005843 | Ga0068860_100031932 | Ga0068860_1000319324 | 306 |
| 24 | 3300006931 | Ga0097620_100007242 | Ga0097620_1000072427 | 306 |
| 25 | 3300009101 | Ga0105247_10000619 | Ga0105247_100006192 | 306 |
| 26 | 3300025900 | Ga0207710_10004843 | Ga0207710_100048432 | 306 |
| 27 | 3300025918 | Ga0207662_10114215 | Ga0207662_101142152 | 306 |
| 28 | 3300025960 | Ga0207651_10053609 | Ga0207651_100536092 | 306 |
| 29 | 3300025961 | Ga0207712_10000725 | Ga0207712_100007255 | 306 |
| 30 | 3300026095 | Ga0207676_10017907 | Ga0207676_100179073 | 306 |
| 31 | 3300026116 | Ga0207674_10192364 | Ga0207674_101923642 | 306 |
| 32 | 3300005338 | Ga0068868_100390529 | Ga0068868_1003905291 | 308 |
| 33 | 3300006195 | Ga0075366_10000017 | Ga0075366_1000001748 | 308 |
| 34 | 3300013308 | Ga0157375_10176974 | Ga0157375_101769742 | 308 |
| 35 | 3300025925 | Ga0207650_10094137 | Ga0207650_100941374 | 308 |
| 36 | 3300050493 | nmdc:mga0k408_81_c1 | nmdc:mga0k408_81_c1_21230_22351 | 308 |
| 37 | 3300053091 | Ga0500647_0087718 | Ga0500647_0087718_85_1110 | 308 |
| 38 | 3300046660 | Ga0495625_0105718 | Ga0495625_0105718_481_1602 | 309 |
| 39 | 3300014326 | Ga0157380_10193763 | Ga0157380_101937632 | 310 |
| 40 | 3300014326 | Ga0157380_10453299 | Ga0157380_104532991 | 310 |
| 41 | 3300044735 | Ga0466968_0075604 | Ga0466968_0075604_386_1417 | 310 |
| 42 | 3300025961 | Ga0207712_10000915 | Ga0207712_100009158 | 311 |
| 43 | 3300003322 | rootL2_10060108 | rootL2_100601086 | 312 |
| 44 | 3300005548 | Ga0070665_100000014 | Ga0070665_100000014420 | 312 |
| 45 | 3300005843 | Ga0068860_100000394 | Ga0068860_10000039433 | 312 |
| 46 | 3300025911 | Ga0207654_10006725 | Ga0207654_100067255 | 312 |
| 47 | 3300025913 | Ga0207695_10001387 | Ga0207695_100013879 | 312 |
| 48 | 3300025914 | Ga0207671_10001331 | Ga0207671_1000133116 | 312 |
| 49 | 3300028379 | Ga0268266_10000068 | Ga0268266_1000006815 | 312 |
| 50 | 3300028381 | Ga0268264_10000559 | Ga0268264_1000055924 | 312 |
| 51 | 3300037418 | Ga0395900_0003671 | Ga0395900_0003671_9384_10505 | 313 |
| 52 | 3300044658 | Ga0466972_0000026 | Ga0466972_0000026_51588_52712 | 313 |
| 53 | 3300044765 | Ga0466970_0000091 | Ga0466970_0000091_33310_34434 | 313 |
| 54 | 3300005329 | Ga0070683_100002583 | Ga0070683_10000258311 | 314 |
| 55 | 3300005334 | Ga0068869_100018710 | Ga0068869_1000187104 | 314 |
| 56 | 3300005366 | Ga0070659_100042015 | Ga0070659_1000420152 | 314 |
| 57 | 3300005455 | Ga0070663_100305307 | Ga0070663_1003053071 | 314 |
| 58 | 3300005563 | Ga0068855_100006230 | Ga0068855_1000062308 | 314 |
| 59 | 3300009553 | Ga0105249_10001117 | Ga0105249_1000111711 | 314 |
| 60 | 3300013100 | Ga0157373_10058618 | Ga0157373_100586182 | 314 |
| 61 | 3300025913 | Ga0207695_10000212 | Ga0207695_10000212121 | 314 |
| 62 | 3300025942 | Ga0207689_10053043 | Ga0207689_100530432 | 314 |
| 63 | 3300025944 | Ga0207661_10001812 | Ga0207661_1000181211 | 314 |
| 64 | 3300025949 | Ga0207667_10000414 | Ga0207667_1000041448 | 314 |
| 65 | 3300025981 | Ga0207640_10328775 | Ga0207640_103287751 | 314 |
| 66 | 3300026118 | Ga0207675_100048083 | Ga0207675_1000480832 | 314 |
| 67 | 3300037418 | Ga0395900_0065448 | Ga0395900_0065448_591_1712 | 314 |
| 68 | 3300037471 | Ga0395905_0199579 | Ga0395905_0199579_642_1763 | 314 |
| 69 | 3300038443 | Ga0395901_0074733 | Ga0395901_0074733_1776_2897 | 314 |
| 70 | 3300049581 | Ga0501047_0037183 | Ga0501047_0037183_2621_3622 | 314 |
| 71 | 3300049583 | Ga0501067_0075771 | Ga0501067_0075771_209_1210 | 314 |
| 72 | 3300049586 | Ga0501070_0072073 | Ga0501070_0072073_843_1844 | 314 |
| 73 | 3300049590 | Ga0501074_0021945 | Ga0501074_0021945_3008_4009 | 314 |
| 74 | 3300049822 | Ga0501035_0023552 | Ga0501035_0023552_468_1469 | 314 |
| 75 | 3300049823 | Ga0501044_0028917 | Ga0501044_0028917_3345_4346 | 314 |
| 76 | 3300053125 | Ga0500618_000016 | Ga0500618_000016_132624_133745 | 314 |
| 77 | 3300009094 | Ga0111539_10390477 | Ga0111539_103904771 | 315 |
| 78 | 3300028794 | Ga0307515_10002270 | Ga0307515_1000227027 | 315 |
| 79 | 3300046462 | Ga0495651_0151850 | Ga0495651_0151850_41_1162 | 315 |
| 80 | 3300046492 | Ga0495585_0000950 | Ga0495585_0000950_17791_18912 | 315 |
| 81 | 3300046538 | Ga0495609_0003529 | Ga0495609_0003529_5087_6208 | 315 |
| 82 | 3300046616 | Ga0495668_0000054 | Ga0495668_0000054_45513_46634 | 315 |
| 83 | 3300046660 | Ga0495625_0001205 | Ga0495625_0001205_16958_18079 | 315 |
| 84 | 3300046683 | Ga0495658_0007766 | Ga0495658_0007766_3850_4971 | 315 |
| 85 | 3300049460 | Ga0495682_0016019 | Ga0495682_0016019_1156_2277 | 315 |
| 86 | 3300050511 | nmdc:mga08y16_72331_c1 | nmdc:mga08y16_72331_c1_406_1524 | 315 |
| 87 | 3300053123 | Ga0500614_007348 | Ga0500614_007348_510_1631 | 315 |
| 88 | 3300005331 | Ga0070670_100103128 | Ga0070670_1001031282 | 316 |
| 89 | 3300005339 | Ga0070660_100024051 | Ga0070660_1000240513 | 316 |
| 90 | 3300005563 | Ga0068855_100084962 | Ga0068855_1000849622 | 316 |
| 91 | 3300009093 | Ga0105240_10150950 | Ga0105240_101509502 | 316 |
| 92 | 3300025919 | Ga0207657_10024210 | Ga0207657_100242103 | 316 |
| 93 | 3300025923 | Ga0207681_10093448 | Ga0207681_100934482 | 316 |
| 94 | 3300025926 | Ga0207659_10020402 | Ga0207659_100204022 | 316 |
| 95 | 3300025940 | Ga0207691_10045858 | Ga0207691_100458583 | 316 |
| 96 | 3300028794 | Ga0307515_10001810 | Ga0307515_1000181036 | 316 |
| 97 | 3300046558 | Ga0495633_0000026 | Ga0495633_0000026_79721_80842 | 316 |
| 98 | 3300046660 | Ga0495625_0000168 | Ga0495625_0000168_73839_74960 | 316 |
| 99 | 3300003322 | rootL2_10105470 | rootL2_101054703 | 317 |
| 100 | 3300005330 | Ga0070690_100056863 | Ga0070690_1000568632 | 317 |
| 101 | 3300005331 | Ga0070670_100040716 | Ga0070670_1000407162 | 317 |
| 102 | 3300005543 | Ga0070672_100088937 | Ga0070672_1000889372 | 317 |
| 103 | 3300005577 | Ga0068857_100040610 | Ga0068857_1000406103 | 317 |
| 104 | 3300005834 | Ga0068851_10046052 | Ga0068851_100460523 | 317 |
| 105 | 3300005834 | Ga0068851_10085264 | Ga0068851_100852642 | 317 |
| 106 | 3300006237 | Ga0097621_100219561 | Ga0097621_1002195612 | 317 |
| 107 | 3300006881 | Ga0068865_100037589 | Ga0068865_1000375893 | 317 |
| 108 | 3300009553 | Ga0105249_10079924 | Ga0105249_100799242 | 317 |
| 109 | 3300013297 | Ga0157378_10066657 | Ga0157378_100666572 | 317 |
| 110 | 3300013308 | Ga0157375_10043524 | Ga0157375_100435242 | 317 |
| 111 | 3300014325 | Ga0163163_10545822 | Ga0163163_105458222 | 317 |
| 112 | 3300014969 | Ga0157376_10046953 | Ga0157376_100469533 | 317 |
| 113 | 3300025321 | Ga0207656_10019824 | Ga0207656_100198242 | 317 |
| 114 | 3300025321 | Ga0207656_10045420 | Ga0207656_100454202 | 317 |
| 115 | 3300025920 | Ga0207649_10042501 | Ga0207649_100425012 | 317 |
| 116 | 3300025933 | Ga0207706_10008919 | Ga0207706_100089193 | 317 |
| 117 | 3300025934 | Ga0207686_10003596 | Ga0207686_100035966 | 317 |
| 118 | 3300025936 | Ga0207670_10022409 | Ga0207670_100224092 | 317 |
| 119 | 3300025945 | Ga0207679_10036462 | Ga0207679_100364622 | 317 |
| 120 | 3300025961 | Ga0207712_10101099 | Ga0207712_101010992 | 317 |
| 121 | 3300026023 | Ga0207677_10101709 | Ga0207677_101017092 | 317 |
| 122 | 3300026035 | Ga0207703_10020625 | Ga0207703_100206252 | 317 |
| 123 | 3300001989 | JGI24739J22299_10035425 | JGI24739J22299_100354251 | 318 |
| 124 | 3300013102 | Ga0157371_10157541 | Ga0157371_101575412 | 318 |
| 125 | 3300005367 | Ga0070667_100049812 | Ga0070667_1000498122 | 319 |
| 126 | 3300026118 | Ga0207675_100003521 | Ga0207675_1000035214 | 319 |
| 127 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012030 | 319 |
| 128 | 3300049580 | Ga0501046_0041183 | Ga0501046_0041183_948_2015 | 319 |
| 129 | 3300049581 | Ga0501047_0073494 | Ga0501047_0073494_381_1448 | 319 |
| 130 | 3300049741 | Ga0501079_0008887 | Ga0501079_0008887_6515_7582 | 319 |
| 131 | 3300049742 | Ga0501080_0127762 | Ga0501080_0127762_466_1533 | 319 |
| 132 | 3300049823 | Ga0501044_0041171 | Ga0501044_0041171_2322_3389 | 319 |
| 133 | 3300053727 | Ga0500611_000039 | Ga0500611_000039_49965_50981 | 319 |
| 134 | 3300054114 | Ga0501084_0019472 | Ga0501084_0019472_2770_3837 | 319 |
| 135 | 3300005355 | Ga0070671_100045530 | Ga0070671_1000455302 | 320 |
| 136 | 3300005539 | Ga0068853_100112909 | Ga0068853_1001129092 | 320 |
| 137 | 3300005834 | Ga0068851_10006509 | Ga0068851_100065092 | 320 |
| 138 | 3300006358 | Ga0068871_100092328 | Ga0068871_1000923282 | 320 |
| 139 | 3300013308 | Ga0157375_10127417 | Ga0157375_101274172 | 320 |
| 140 | 3300014968 | Ga0157379_10318506 | Ga0157379_103185061 | 320 |
| 141 | 3300026041 | Ga0207639_10085621 | Ga0207639_100856213 | 320 |
| 142 | 3300005329 | Ga0070683_100014557 | Ga0070683_1000145571 | 321 |
| 143 | 3300005334 | Ga0068869_100002467 | Ga0068869_1000024673 | 321 |
| 144 | 3300005335 | Ga0070666_10013725 | Ga0070666_100137253 | 321 |
| 145 | 3300005335 | Ga0070666_10091233 | Ga0070666_100912332 | 321 |
| 146 | 3300005338 | Ga0068868_100071496 | Ga0068868_1000714962 | 321 |
| 147 | 3300005340 | Ga0070689_100029970 | Ga0070689_1000299701 | 321 |
| 148 | 3300005344 | Ga0070661_100023047 | Ga0070661_1000230472 | 321 |
| 149 | 3300005344 | Ga0070661_100201233 | Ga0070661_1002012331 | 321 |
| 150 | 3300005364 | Ga0070673_100065303 | Ga0070673_1000653032 | 321 |
| 151 | 3300005365 | Ga0070688_100008316 | Ga0070688_1000083164 | 321 |
| 152 | 3300005365 | Ga0070688_100013987 | Ga0070688_1000139873 | 321 |
| 153 | 3300005367 | Ga0070667_100031584 | Ga0070667_1000315842 | 321 |
| 154 | 3300005367 | Ga0070667_100065563 | Ga0070667_1000655633 | 321 |
| 155 | 3300005457 | Ga0070662_100005807 | Ga0070662_1000058075 | 321 |
| 156 | 3300005535 | Ga0070684_100010934 | Ga0070684_1000109345 | 321 |
| 157 | 3300005535 | Ga0070684_100233094 | Ga0070684_1002330941 | 321 |
| 158 | 3300005539 | Ga0068853_100058967 | Ga0068853_1000589673 | 321 |
| 159 | 3300005564 | Ga0070664_100075864 | Ga0070664_1000758643 | 321 |
| 160 | 3300005616 | Ga0068852_100153054 | Ga0068852_1001530542 | 321 |
| 161 | 3300005618 | Ga0068864_100034999 | Ga0068864_1000349992 | 321 |
| 162 | 3300005618 | Ga0068864_100039686 | Ga0068864_1000396862 | 321 |
| 163 | 3300005841 | Ga0068863_100022535 | Ga0068863_1000225352 | 321 |
| 164 | 3300005842 | Ga0068858_100070745 | Ga0068858_1000707452 | 321 |
| 165 | 3300006881 | Ga0068865_100115717 | Ga0068865_1001157172 | 321 |
| 166 | 3300009177 | Ga0105248_10510547 | Ga0105248_105105472 | 321 |
| 167 | 3300009553 | Ga0105249_10017168 | Ga0105249_100171686 | 321 |
| 168 | 3300013296 | Ga0157374_10197668 | Ga0157374_101976682 | 321 |
| 169 | 3300013306 | Ga0163162_10126262 | Ga0163162_101262622 | 321 |
| 170 | 3300014968 | Ga0157379_10016392 | Ga0157379_100163926 | 321 |
| 171 | 3300017792 | Ga0163161_10124095 | Ga0163161_101240952 | 321 |
| 172 | 3300025905 | Ga0207685_10066048 | Ga0207685_100660481 | 321 |
| 173 | 3300025920 | Ga0207649_10169274 | Ga0207649_101692742 | 321 |
| 174 | 3300025926 | Ga0207659_10088658 | Ga0207659_100886582 | 321 |
| 175 | 3300025940 | Ga0207691_10030881 | Ga0207691_100308812 | 321 |
| 176 | 3300025942 | Ga0207689_10002750 | Ga0207689_100027505 | 321 |
| 177 | 3300025942 | Ga0207689_10023984 | Ga0207689_100239841 | 321 |
| 178 | 3300025986 | Ga0207658_10135087 | Ga0207658_101350872 | 321 |
| 179 | 3300026088 | Ga0207641_10002004 | Ga0207641_1000200416 | 321 |
| 180 | 3300026089 | Ga0207648_10022209 | Ga0207648_100222092 | 321 |
| 181 | 3300026095 | Ga0207676_10365803 | Ga0207676_103658031 | 321 |
| 182 | 3300026116 | Ga0207674_10020844 | Ga0207674_100208445 | 321 |
| 183 | 3300047472 | Ga0495686_0150112 | Ga0495686_0150112_69_1094 | 321 |
| 184 | 3300053730 | Ga0500645_009542 | Ga0500645_009542_603_1628 | 321 |
| 185 | iso_pu_bacteria | 2818991444 | 2819589804 | 321 |
| 186 | iso_pu_bacteria | 2914759650 | 2914762346 | 321 |
| 187 | 3300003322 | rootL2_10213233 | rootL2_102132331 | 322 |
| 188 | 3300005288 | Ga0065714_10083948 | Ga0065714_100839482 | 322 |
| 189 | 3300005290 | Ga0065712_10115534 | Ga0065712_101155342 | 322 |
| 190 | 3300005544 | Ga0070686_100095597 | Ga0070686_1000955972 | 322 |
| 191 | 3300005617 | Ga0068859_100085924 | Ga0068859_1000859242 | 322 |
| 192 | 3300005841 | Ga0068863_100123674 | Ga0068863_1001236741 | 322 |
| 193 | 3300006237 | Ga0097621_100019163 | Ga0097621_1000191632 | 322 |
| 194 | 3300006931 | Ga0097620_100085931 | Ga0097620_1000859313 | 322 |
| 195 | 3300009553 | Ga0105249_10220478 | Ga0105249_102204782 | 322 |
| 196 | 3300025908 | Ga0207643_10187738 | Ga0207643_101877381 | 322 |
| 197 | 3300025942 | Ga0207689_10078622 | Ga0207689_100786222 | 322 |
| 198 | 3300025960 | Ga0207651_10009976 | Ga0207651_100099762 | 322 |
| 199 | 3300026075 | Ga0207708_10353361 | Ga0207708_103533611 | 322 |
| 200 | 3300026088 | Ga0207641_10158141 | Ga0207641_101581412 | 322 |
| 201 | 3300026095 | Ga0207676_10021806 | Ga0207676_100218062 | 322 |
| 202 | 3300047320 | Ga0495672_0030404 | Ga0495672_0030404_1172_2224 | 322 |
| 203 | iso_pu_bacteria | 2721755487 | 2722726059 | 322 |
| 204 | iso_pu_bacteria | 2904780799 | 2904782676 | 322 |
| 205 | iso_pu_bacteria | 2919177583 | 2919180286 | 322 |
| 206 | 3300003322 | rootL2_10283016 | rootL2_102830161 | 323 |
| 207 | 3300003323 | rootH1_10129548 | rootH1_101295482 | 323 |
| 208 | 3300005295 | Ga0065707_10120143 | Ga0065707_101201431 | 323 |
| 209 | 3300005327 | Ga0070658_10204591 | Ga0070658_102045912 | 323 |
| 210 | 3300005337 | Ga0070682_100000121 | Ga0070682_10000012154 | 323 |
| 211 | 3300005539 | Ga0068853_100214820 | Ga0068853_1002148202 | 323 |
| 212 | 3300013100 | Ga0157373_10021611 | Ga0157373_100216113 | 323 |
| 213 | 3300044712 | Ga0453684_0431476 | Ga0453684_0431476_15_1097 | 323 |
| 214 | 3300049705 | Ga0501225_0011909 | Ga0501225_0011909_680_1711 | 323 |
| 215 | iso_pu_bacteria | 2887375801 | 2887378098 | 323 |
| 216 | 3300002459 | JGI24751J29686_10000655 | JGI24751J29686_100006554 | 324 |
| 217 | 3300005331 | Ga0070670_100040014 | Ga0070670_1000400143 | 324 |
| 218 | 3300005539 | Ga0068853_100044698 | Ga0068853_1000446983 | 324 |
| 219 | 3300005719 | Ga0068861_100012731 | Ga0068861_1000127314 | 324 |
| 220 | 3300009174 | Ga0105241_10092250 | Ga0105241_100922502 | 324 |
| 221 | 3300009545 | Ga0105237_10008039 | Ga0105237_100080392 | 324 |
| 222 | 3300009553 | Ga0105249_10001306 | Ga0105249_100013065 | 324 |
| 223 | 3300010375 | Ga0105239_10006468 | Ga0105239_100064687 | 324 |
| 224 | 3300025921 | Ga0207652_10011840 | Ga0207652_100118404 | 324 |
| 225 | 3300025961 | Ga0207712_10001923 | Ga0207712_100019236 | 324 |
| 226 | 3300026118 | Ga0207675_100022252 | Ga0207675_1000222524 | 324 |
| 227 | 3300026142 | Ga0207698_10045981 | Ga0207698_100459813 | 324 |
| 228 | 3300030731 | Ga0316177_1089742 | Ga0316177_10897422 | 324 |
| 229 | 3300042131 | Ga0450894_003099 | Ga0450894_003099_346_1467 | 324 |
| 230 | 3300049579 | Ga0501043_0127082 | Ga0501043_0127082_248_1279 | 324 |
| 231 | 3300053108 | Ga0500562_000005 | Ga0500562_000005_201275_202384 | 324 |
| 232 | 3300053156 | Ga0500622_0001705 | Ga0500622_0001705_14271_15380 | 324 |
| 233 | iso_pu_bacteria | 2929154850 | 2929160006 | 324 |
| 234 | 3300005337 | Ga0070682_100096896 | Ga0070682_1000968962 | 325 |
| 235 | 3300005353 | Ga0070669_100224026 | Ga0070669_1002240262 | 325 |
| 236 | 3300005459 | Ga0068867_100304831 | Ga0068867_1003048311 | 325 |
| 237 | 3300005719 | Ga0068861_100021936 | Ga0068861_1000219364 | 325 |
| 238 | 3300006358 | Ga0068871_100355306 | Ga0068871_1003553062 | 325 |
| 239 | 3300006846 | Ga0075430_100000960 | Ga0075430_1000009605 | 325 |
| 240 | 3300006847 | Ga0075431_100063071 | Ga0075431_1000630712 | 325 |
| 241 | 3300009545 | Ga0105237_10034602 | Ga0105237_100346022 | 325 |
| 242 | 3300013104 | Ga0157370_10013171 | Ga0157370_100131712 | 325 |
| 243 | 3300013297 | Ga0157378_10061615 | Ga0157378_100616154 | 325 |
| 244 | 3300025903 | Ga0207680_10043718 | Ga0207680_100437182 | 325 |
| 245 | 3300025914 | Ga0207671_10022086 | Ga0207671_100220862 | 325 |
| 246 | 3300025961 | Ga0207712_10016389 | Ga0207712_100163891 | 325 |
| 247 | 3300026118 | Ga0207675_100124453 | Ga0207675_1001244531 | 325 |
| 248 | 3300031548 | Ga0307408_100000856 | Ga0307408_1000008562 | 325 |
| 249 | 3300031824 | Ga0307413_10017033 | Ga0307413_100170332 | 325 |
| 250 | 3300031852 | Ga0307410_10000120 | Ga0307410_1000012029 | 325 |
| 251 | 3300031901 | Ga0307406_10000011 | Ga0307406_1000001118 | 325 |
| 252 | 3300031903 | Ga0307407_10009643 | Ga0307407_100096431 | 325 |
| 253 | 3300032004 | Ga0307414_10000014 | Ga0307414_10000014158 | 325 |
| 254 | 3300032005 | Ga0307411_10029017 | Ga0307411_100290172 | 325 |
| 255 | 3300049569 | Ga0501032_0011039 | Ga0501032_0011039_1166_2275 | 325 |
| 256 | 3300049572 | Ga0501036_0046476 | Ga0501036_0046476_531_1640 | 325 |
| 257 | 3300049574 | Ga0501038_0047620 | Ga0501038_0047620_1725_2834 | 325 |
| 258 | 3300049579 | Ga0501043_0002152 | Ga0501043_0002152_5808_6920 | 325 |
| 259 | 3300049579 | Ga0501043_0016289 | Ga0501043_0016289_665_1774 | 325 |
| 260 | 3300049580 | Ga0501046_0051262 | Ga0501046_0051262_209_1318 | 325 |
| 261 | 3300049581 | Ga0501047_0218087 | Ga0501047_0218087_474_1586 | 325 |
| 262 | 3300049582 | Ga0501048_0029256 | Ga0501048_0029256_1871_2980 | 325 |
| 263 | 3300049584 | Ga0501068_0034965 | Ga0501068_0034965_1321_2430 | 325 |
| 264 | 3300049588 | Ga0501072_0065688 | Ga0501072_0065688_986_2179 | 325 |
| 265 | 3300049741 | Ga0501079_0034323 | Ga0501079_0034323_515_1624 | 325 |
| 266 | 3300049742 | Ga0501080_0039205 | Ga0501080_0039205_820_1929 | 325 |
| 267 | 3300049758 | Ga0501241_008741 | Ga0501241_008741_565_1746 | 325 |
| 268 | 3300050509 | nmdc:mga0qj67_14877_c1 | nmdc:mga0qj67_14877_c1_4557_5591 | 325 |
| 269 | 3300050510 | nmdc:mga06r32_26115_c1 | nmdc:mga06r32_26115_c1_105_1139 | 325 |
| 270 | 3300054114 | Ga0501084_0102931 | Ga0501084_0102931_647_1756 | 325 |
| 271 | 2162886007 | SwRhRL2b_contig_2641798 | SwRhRL2b_0475.00003030 | 326 |
| 272 | 3300003320 | rootH2_10022930 | rootH2_1002293020 | 326 |
| 273 | 3300005289 | Ga0065704_10072160 | Ga0065704_100721603 | 326 |
| 274 | 3300005563 | Ga0068855_100057963 | Ga0068855_1000579633 | 326 |
| 275 | 3300005577 | Ga0068857_100002762 | Ga0068857_10000276211 | 326 |
| 276 | 3300005578 | Ga0068854_100050338 | Ga0068854_1000503384 | 326 |
| 277 | 3300005614 | Ga0068856_100140724 | Ga0068856_1001407242 | 326 |
| 278 | 3300005616 | Ga0068852_100005237 | Ga0068852_1000052376 | 326 |
| 279 | 3300005983 | Ga0081540_1004387 | Ga0081540_10043875 | 326 |
| 280 | 3300006195 | Ga0075366_10001639 | Ga0075366_100016394 | 326 |
| 281 | 3300006195 | Ga0075366_10064609 | Ga0075366_100646092 | 326 |
| 282 | 3300009093 | Ga0105240_10020065 | Ga0105240_100200656 | 326 |
| 283 | 3300009093 | Ga0105240_10184558 | Ga0105240_101845581 | 326 |
| 284 | 3300009148 | Ga0105243_10000009 | Ga0105243_1000000984 | 326 |
| 285 | 3300009174 | Ga0105241_10002136 | Ga0105241_100021369 | 326 |
| 286 | 3300009545 | Ga0105237_10006188 | Ga0105237_100061885 | 326 |
| 287 | 3300009551 | Ga0105238_10004065 | Ga0105238_100040656 | 326 |
| 288 | 3300009551 | Ga0105238_10023581 | Ga0105238_100235813 | 326 |
| 289 | 3300009551 | Ga0105238_10139933 | Ga0105238_101399331 | 326 |
| 290 | 3300010375 | Ga0105239_10013262 | Ga0105239_100132625 | 326 |
| 291 | 3300013104 | Ga0157370_10010610 | Ga0157370_100106104 | 326 |
| 292 | 3300013105 | Ga0157369_10058404 | Ga0157369_100584041 | 326 |
| 293 | 3300013306 | Ga0163162_10007147 | Ga0163162_100071478 | 326 |
| 294 | 3300013307 | Ga0157372_10001585 | Ga0157372_1000158515 | 326 |
| 295 | 3300013307 | Ga0157372_10034739 | Ga0157372_100347394 | 326 |
| 296 | 3300013307 | Ga0157372_10293439 | Ga0157372_102934392 | 326 |
| 297 | 3300025924 | Ga0207694_10078063 | Ga0207694_100780633 | 326 |
| 298 | 3300025932 | Ga0207690_10267819 | Ga0207690_102678192 | 326 |
| 299 | 3300025949 | Ga0207667_10006924 | Ga0207667_1000692411 | 326 |
| 300 | 3300025981 | Ga0207640_10053742 | Ga0207640_100537422 | 326 |
| 301 | 3300026078 | Ga0207702_10289456 | Ga0207702_102894562 | 326 |
| 302 | 3300026142 | Ga0207698_10000539 | Ga0207698_1000053914 | 326 |
| 303 | 3300031251 | Ga0265327_10000199 | Ga0265327_100001995 | 326 |
| 304 | 3300042876 | Ga0451577_0148156 | Ga0451577_0148156_460_1581 | 326 |
| 305 | 3300044658 | Ga0466972_0001885 | Ga0466972_0001885_244_1365 | 326 |
| 306 | 3300044735 | Ga0466968_0072521 | Ga0466968_0072521_267_1388 | 326 |
| 307 | 3300046460 | Ga0495638_0016015 | Ga0495638_0016015_2906_4027 | 326 |
| 308 | 3300046460 | Ga0495638_0081989 | Ga0495638_0081989_301_1413 | 326 |
| 309 | 3300046524 | Ga0495648_0002523 | Ga0495648_0002523_1963_3084 | 326 |
| 310 | 3300046660 | Ga0495625_0103299 | Ga0495625_0103299_690_1811 | 326 |
| 311 | 3300047443 | Ga0495687_000058 | Ga0495687_000058_64541_65662 | 326 |
| 312 | 3300048919 | Ga0496116_0025953 | Ga0496116_0025953_542_1582 | 326 |
| 313 | 3300048929 | Ga0496126_0312642 | Ga0496126_0312642_113_1153 | 326 |
| 314 | 3300053096 | Ga0500641_0018407 | Ga0500641_0018407_378_1415 | 326 |
| 315 | 3300053139 | Ga0500568_0005771 | Ga0500568_0005771_4285_5406 | 326 |
| 316 | 3300053156 | Ga0500622_0001399 | Ga0500622_0001399_3137_4258 | 326 |
| 317 | 3300053156 | Ga0500622_0011213 | Ga0500622_0011213_3099_4139 | 326 |
| 318 | 3300005327 | Ga0070658_10227206 | Ga0070658_102272062 | 327 |
| 319 | 3300005617 | Ga0068859_100000620 | Ga0068859_10000062018 | 327 |
| 320 | 3300006931 | Ga0097620_100000620 | Ga0097620_10000062018 | 327 |
| 321 | 3300009545 | Ga0105237_10000191 | Ga0105237_1000019119 | 327 |
| 322 | 3300025908 | Ga0207643_10053248 | Ga0207643_100532482 | 327 |
| 323 | 3300025914 | Ga0207671_10001357 | Ga0207671_1000135712 | 327 |
| 324 | 3300032004 | Ga0307414_10008348 | Ga0307414_100083486 | 327 |
| 325 | 3300046522 | Ga0495643_0027265 | Ga0495643_0027265_826_1989 | 327 |
| 326 | 3300002737 | JGI25162J39368_1000258 | JGI25162J39368_100025831 | 328 |
| 327 | 3300003323 | rootH1_10190552 | rootH1_101905523 | 328 |
| 328 | 3300003354 | JGI25160J50197_1002148 | JGI25160J50197_10021483 | 328 |
| 329 | 3300005327 | Ga0070658_10011999 | Ga0070658_100119992 | 328 |
| 330 | 3300005329 | Ga0070683_100003463 | Ga0070683_1000034638 | 328 |
| 331 | 3300005330 | Ga0070690_100017866 | Ga0070690_1000178662 | 328 |
| 332 | 3300005330 | Ga0070690_100047972 | Ga0070690_1000479722 | 328 |
| 333 | 3300005331 | Ga0070670_100048124 | Ga0070670_1000481244 | 328 |
| 334 | 3300005335 | Ga0070666_10018557 | Ga0070666_100185575 | 328 |
| 335 | 3300005335 | Ga0070666_10065281 | Ga0070666_100652812 | 328 |
| 336 | 3300005338 | Ga0068868_100003164 | Ga0068868_1000031643 | 328 |
| 337 | 3300005338 | Ga0068868_100037742 | Ga0068868_1000377424 | 328 |
| 338 | 3300005339 | Ga0070660_100101803 | Ga0070660_1001018032 | 328 |
| 339 | 3300005340 | Ga0070689_100066581 | Ga0070689_1000665811 | 328 |
| 340 | 3300005344 | Ga0070661_100000111 | Ga0070661_10000011147 | 328 |
| 341 | 3300005344 | Ga0070661_100024199 | Ga0070661_1000241992 | 328 |
| 342 | 3300005355 | Ga0070671_100001071 | Ga0070671_1000010718 | 328 |
| 343 | 3300005364 | Ga0070673_100051667 | Ga0070673_1000516671 | 328 |
| 344 | 3300005366 | Ga0070659_100004992 | Ga0070659_1000049924 | 328 |
| 345 | 3300005367 | Ga0070667_100006052 | Ga0070667_1000060526 | 328 |
| 346 | 3300005457 | Ga0070662_100007166 | Ga0070662_1000071666 | 328 |
| 347 | 3300005459 | Ga0068867_100039839 | Ga0068867_1000398391 | 328 |
| 348 | 3300005530 | Ga0070679_100157899 | Ga0070679_1001578992 | 328 |
| 349 | 3300005535 | Ga0070684_100000105 | Ga0070684_10000010513 | 328 |
| 350 | 3300005535 | Ga0070684_100042770 | Ga0070684_1000427704 | 328 |
| 351 | 3300005539 | Ga0068853_100003177 | Ga0068853_1000031775 | 328 |
| 352 | 3300005539 | Ga0068853_100317114 | Ga0068853_1003171141 | 328 |
| 353 | 3300005563 | Ga0068855_100023086 | Ga0068855_1000230869 | 328 |
| 354 | 3300005563 | Ga0068855_100095453 | Ga0068855_1000954532 | 328 |
| 355 | 3300005563 | Ga0068855_100117596 | Ga0068855_1001175962 | 328 |
| 356 | 3300005564 | Ga0070664_100000838 | Ga0070664_1000008383 | 328 |
| 357 | 3300005564 | Ga0070664_100035238 | Ga0070664_1000352385 | 328 |
| 358 | 3300005564 | Ga0070664_100197599 | Ga0070664_1001975992 | 328 |
| 359 | 3300005577 | Ga0068857_100005990 | Ga0068857_1000059904 | 328 |
| 360 | 3300005577 | Ga0068857_100062804 | Ga0068857_1000628042 | 328 |
| 361 | 3300005578 | Ga0068854_100057303 | Ga0068854_1000573034 | 328 |
| 362 | 3300005614 | Ga0068856_100030372 | Ga0068856_1000303722 | 328 |
| 363 | 3300005834 | Ga0068851_10052377 | Ga0068851_100523772 | 328 |
| 364 | 3300005843 | Ga0068860_100394524 | Ga0068860_1003945241 | 328 |
| 365 | 3300005985 | Ga0081539_10000714 | Ga0081539_1000071421 | 328 |
| 366 | 3300006237 | Ga0097621_100000359 | Ga0097621_10000035920 | 328 |
| 367 | 3300006237 | Ga0097621_100048701 | Ga0097621_1000487012 | 328 |
| 368 | 3300006358 | Ga0068871_100001167 | Ga0068871_1000011676 | 328 |
| 369 | 3300006358 | Ga0068871_100005004 | Ga0068871_1000050046 | 328 |
| 370 | 3300006844 | Ga0075428_100013338 | Ga0075428_1000133384 | 328 |
| 371 | 3300006844 | Ga0075428_100313052 | Ga0075428_1003130522 | 328 |
| 372 | 3300006880 | Ga0075429_100000723 | Ga0075429_1000007237 | 328 |
| 373 | 3300009093 | Ga0105240_10008191 | Ga0105240_1000819110 | 328 |
| 374 | 3300009174 | Ga0105241_10186770 | Ga0105241_101867702 | 328 |
| 375 | 3300009176 | Ga0105242_10041383 | Ga0105242_100413832 | 328 |
| 376 | 3300009176 | Ga0105242_10053818 | Ga0105242_100538182 | 328 |
| 377 | 3300009176 | Ga0105242_10498683 | Ga0105242_104986831 | 328 |
| 378 | 3300009177 | Ga0105248_10033685 | Ga0105248_100336855 | 328 |
| 379 | 3300009545 | Ga0105237_10012420 | Ga0105237_100124206 | 328 |
| 380 | 3300009545 | Ga0105237_10128039 | Ga0105237_101280392 | 328 |
| 381 | 3300010375 | Ga0105239_10018690 | Ga0105239_100186902 | 328 |
| 382 | 3300011119 | Ga0105246_10085720 | Ga0105246_100857202 | 328 |
| 383 | 3300011119 | Ga0105246_10165860 | Ga0105246_101658602 | 328 |
| 384 | 3300013100 | Ga0157373_10005562 | Ga0157373_100055624 | 328 |
| 385 | 3300013102 | Ga0157371_10010327 | Ga0157371_100103276 | 328 |
| 386 | 3300013105 | Ga0157369_10006913 | Ga0157369_100069136 | 328 |
| 387 | 3300013296 | Ga0157374_10000011 | Ga0157374_10000011118 | 328 |
| 388 | 3300013296 | Ga0157374_10004430 | Ga0157374_100044308 | 328 |
| 389 | 3300013296 | Ga0157374_10009692 | Ga0157374_100096924 | 328 |
| 390 | 3300013296 | Ga0157374_10289602 | Ga0157374_102896021 | 328 |
| 391 | 3300013296 | Ga0157374_10548456 | Ga0157374_105484562 | 328 |
| 392 | 3300013297 | Ga0157378_10269177 | Ga0157378_102691772 | 328 |
| 393 | 3300013306 | Ga0163162_10001000 | Ga0163162_1000100021 | 328 |
| 394 | 3300013306 | Ga0163162_10103635 | Ga0163162_101036353 | 328 |
| 395 | 3300013306 | Ga0163162_10194665 | Ga0163162_101946652 | 328 |
| 396 | 3300013307 | Ga0157372_10012413 | Ga0157372_100124135 | 328 |
| 397 | 3300013307 | Ga0157372_10077080 | Ga0157372_100770804 | 328 |
| 398 | 3300013308 | Ga0157375_10002200 | Ga0157375_100022005 | 328 |
| 399 | 3300013308 | Ga0157375_10160772 | Ga0157375_101607721 | 328 |
| 400 | 3300013308 | Ga0157375_10415969 | Ga0157375_104159692 | 328 |
| 401 | 3300014325 | Ga0163163_10000831 | Ga0163163_1000083112 | 328 |
| 402 | 3300014326 | Ga0157380_10211019 | Ga0157380_102110192 | 328 |
| 403 | 3300014968 | Ga0157379_10010412 | Ga0157379_100104122 | 328 |
| 404 | 3300014968 | Ga0157379_10199582 | Ga0157379_101995822 | 328 |
| 405 | 3300014969 | Ga0157376_10002924 | Ga0157376_100029246 | 328 |
| 406 | 3300014969 | Ga0157376_10079127 | Ga0157376_100791272 | 328 |
| 407 | 3300014969 | Ga0157376_10158982 | Ga0157376_101589822 | 328 |
| 408 | 3300017792 | Ga0163161_10003336 | Ga0163161_100033366 | 328 |
| 409 | 3300017792 | Ga0163161_10051257 | Ga0163161_100512572 | 328 |
| 410 | 3300025302 | Ga0207426_1000059 | Ga0207426_1000059114 | 328 |
| 411 | 3300025903 | Ga0207680_10055071 | Ga0207680_100550712 | 328 |
| 412 | 3300025914 | Ga0207671_10001792 | Ga0207671_1000179216 | 328 |
| 413 | 3300025914 | Ga0207671_10023899 | Ga0207671_100238993 | 328 |
| 414 | 3300025914 | Ga0207671_10057849 | Ga0207671_100578492 | 328 |
| 415 | 3300025919 | Ga0207657_10005058 | Ga0207657_100050584 | 328 |
| 416 | 3300025920 | Ga0207649_10000517 | Ga0207649_100005178 | 328 |
| 417 | 3300025921 | Ga0207652_10216432 | Ga0207652_102164322 | 328 |
| 418 | 3300025931 | Ga0207644_10014077 | Ga0207644_100140772 | 328 |
| 419 | 3300025933 | Ga0207706_10001896 | Ga0207706_1000189614 | 328 |
| 420 | 3300025938 | Ga0207704_10064983 | Ga0207704_100649832 | 328 |
| 421 | 3300025944 | Ga0207661_10010041 | Ga0207661_100100412 | 328 |
| 422 | 3300025944 | Ga0207661_10284543 | Ga0207661_102845432 | 328 |
| 423 | 3300025945 | Ga0207679_10000091 | Ga0207679_1000009137 | 328 |
| 424 | 3300025949 | Ga0207667_10022188 | Ga0207667_100221885 | 328 |
| 425 | 3300025949 | Ga0207667_10045879 | Ga0207667_100458795 | 328 |
| 426 | 3300025960 | Ga0207651_10033617 | Ga0207651_100336171 | 328 |
| 427 | 3300025960 | Ga0207651_10063786 | Ga0207651_100637862 | 328 |
| 428 | 3300025986 | Ga0207658_10086364 | Ga0207658_100863642 | 328 |
| 429 | 3300026041 | Ga0207639_10004779 | Ga0207639_100047796 | 328 |
| 430 | 3300026067 | Ga0207678_10050208 | Ga0207678_100502081 | 328 |
| 431 | 3300026078 | Ga0207702_10011662 | Ga0207702_100116626 | 328 |
| 432 | 3300026088 | Ga0207641_10090078 | Ga0207641_100900782 | 328 |
| 433 | 3300026089 | Ga0207648_10272762 | Ga0207648_102727622 | 328 |
| 434 | 3300026095 | Ga0207676_10137961 | Ga0207676_101379612 | 328 |
| 435 | 3300026116 | Ga0207674_10006954 | Ga0207674_1000695411 | 328 |
| 436 | 3300026116 | Ga0207674_10079222 | Ga0207674_100792224 | 328 |
| 437 | 3300026118 | Ga0207675_100055083 | Ga0207675_1000550833 | 328 |
| 438 | 3300031251 | Ga0265327_10000059 | Ga0265327_10000059156 | 328 |
| 439 | 3300035086 | Ga0373934_0080323 | Ga0373934_0080323_30_1163 | 328 |
| 440 | 3300035171 | Ga0373946_0070590 | Ga0373946_0070590_227_1270 | 328 |
| 441 | 3300044712 | Ga0453684_0001806 | Ga0453684_0001806_23030_24157 | 328 |
| 442 | 3300044712 | Ga0453684_0021742 | Ga0453684_0021742_2419_3549 | 328 |
| 443 | 3300046463 | Ga0495653_0109404 | Ga0495653_0109404_17_1150 | 328 |
| 444 | 3300046471 | Ga0495650_0000081 | Ga0495650_0000081_134986_136191 | 328 |
| 445 | 3300046516 | Ga0495628_0147456 | Ga0495628_0147456_336_1469 | 328 |
| 446 | 3300046694 | Ga0495649_0048889 | Ga0495649_0048889_551_1678 | 328 |
| 447 | 3300048909 | Ga0496106_0056974 | Ga0496106_0056974_427_1551 | 328 |
| 448 | 3300048914 | Ga0496111_0125380 | Ga0496111_0125380_678_1811 | 328 |
| 449 | 3300048917 | Ga0496114_0038907 | Ga0496114_0038907_491_1615 | 328 |
| 450 | 3300050508 | nmdc:mga09592_998_c1 | nmdc:mga09592_998_c1_16960_18078 | 328 |
| 451 | iso_pu_bacteria | 2911138879 | 2911141341 | 328 |
| 452 | iso_pu_bacteria | 2919437846 | 2919440304 | 328 |
| 453 | 3300002738 | JGI25154J39366_1000006 | JGI25154J39366_1000006153 | 329 |
| 454 | 3300003215 | JGI25153J46596_10000485 | JGI25153J46596_100004853 | 329 |
| 455 | 3300003320 | rootH2_10081840 | rootH2_100818401 | 329 |
| 456 | 3300003322 | rootL2_10050502 | rootL2_100505021 | 329 |
| 457 | 3300003323 | rootH1_10060702 | rootH1_100607024 | 329 |
| 458 | 3300005328 | Ga0070676_10061023 | Ga0070676_100610232 | 329 |
| 459 | 3300005458 | Ga0070681_10035895 | Ga0070681_100358953 | 329 |
| 460 | 3300005459 | Ga0068867_100052616 | Ga0068867_1000526162 | 329 |
| 461 | 3300005563 | Ga0068855_100026647 | Ga0068855_1000266473 | 329 |
| 462 | 3300005614 | Ga0068856_100199924 | Ga0068856_1001999242 | 329 |
| 463 | 3300005618 | Ga0068864_100086279 | Ga0068864_1000862792 | 329 |
| 464 | 3300005718 | Ga0068866_10005900 | Ga0068866_100059003 | 329 |
| 465 | 3300005843 | Ga0068860_100014820 | Ga0068860_1000148206 | 329 |
| 466 | 3300006195 | Ga0075366_10014674 | Ga0075366_100146743 | 329 |
| 467 | 3300006881 | Ga0068865_100095899 | Ga0068865_1000958992 | 329 |
| 468 | 3300009093 | Ga0105240_10025004 | Ga0105240_100250045 | 329 |
| 469 | 3300009147 | Ga0114129_10041957 | Ga0114129_100419573 | 329 |
| 470 | 3300009174 | Ga0105241_10019869 | Ga0105241_100198694 | 329 |
| 471 | 3300009545 | Ga0105237_10008044 | Ga0105237_100080442 | 329 |
| 472 | 3300010375 | Ga0105239_10003738 | Ga0105239_100037382 | 329 |
| 473 | 3300013100 | Ga0157373_10091764 | Ga0157373_100917643 | 329 |
| 474 | 3300013307 | Ga0157372_10022925 | Ga0157372_100229253 | 329 |
| 475 | 3300013307 | Ga0157372_10083286 | Ga0157372_100832862 | 329 |
| 476 | 3300014745 | Ga0157377_10116447 | Ga0157377_101164471 | 329 |
| 477 | 3300014969 | Ga0157376_10000938 | Ga0157376_100009386 | 329 |
| 478 | 3300015265 | Ga0182005_1000017 | Ga0182005_100001793 | 329 |
| 479 | 3300017792 | Ga0163161_10020278 | Ga0163161_100202783 | 329 |
| 480 | 3300025208 | Ga0209436_100091 | Ga0209436_1000916 | 329 |
| 481 | 3300025246 | Ga0209646_1000031 | Ga0209646_1000031184 | 329 |
| 482 | 3300025250 | Ga0209026_1000019 | Ga0209026_1000019184 | 329 |
| 483 | 3300025284 | Ga0209130_1000333 | Ga0209130_100033328 | 329 |
| 484 | 3300025297 | Ga0209758_1001097 | Ga0209758_10010978 | 329 |
| 485 | 3300025302 | Ga0207426_1000024 | Ga0207426_1000024357 | 329 |
| 486 | 3300025302 | Ga0207426_1000691 | Ga0207426_100069113 | 329 |
| 487 | 3300025912 | Ga0207707_10045387 | Ga0207707_100453873 | 329 |
| 488 | 3300025913 | Ga0207695_10057600 | Ga0207695_100576002 | 329 |
| 489 | 3300025937 | Ga0207669_10140389 | Ga0207669_101403891 | 329 |
| 490 | 3300025949 | Ga0207667_10008497 | Ga0207667_100084977 | 329 |
| 491 | 3300026041 | Ga0207639_10092413 | Ga0207639_100924132 | 329 |
| 492 | 3300026078 | Ga0207702_10174712 | Ga0207702_101747122 | 329 |
| 493 | 3300026089 | Ga0207648_10001507 | Ga0207648_1000150723 | 329 |
| 494 | 3300026116 | Ga0207674_10084698 | Ga0207674_100846983 | 329 |
| 495 | 3300026118 | Ga0207675_100234511 | Ga0207675_1002345112 | 329 |
| 496 | 3300028381 | Ga0268264_10017234 | Ga0268264_100172343 | 329 |
| 497 | 3300037471 | Ga0395905_0006214 | Ga0395905_0006214_8464_9660 | 329 |
| 498 | 3300044656 | Ga0466969_0000356 | Ga0466969_0000356_8784_9905 | 329 |
| 499 | 3300044658 | Ga0466972_0000047 | Ga0466972_0000047_6757_7878 | 329 |
| 500 | 3300044684 | Ga0466966_0000038 | Ga0466966_0000038_63203_64324 | 329 |
| 501 | 3300044712 | Ga0453684_0118592 | Ga0453684_0118592_1868_2914 | 329 |
| 502 | 3300044735 | Ga0466968_0016485 | Ga0466968_0016485_306_1427 | 329 |
| 503 | 3300044842 | Ga0466957_0000329 | Ga0466957_0000329_19070_20191 | 329 |
| 504 | 3300044842 | Ga0466957_0000739 | Ga0466957_0000739_309_1430 | 329 |
| 505 | 3300045049 | Ga0466959_0000289 | Ga0466959_0000289_20994_22115 | 329 |
| 506 | 3300046616 | Ga0495668_0001528 | Ga0495668_0001528_2782_3903 | 329 |
| 507 | 3300049569 | Ga0501032_0142832 | Ga0501032_0142832_339_1466 | 329 |
| 508 | 3300049571 | Ga0501034_0072688 | Ga0501034_0072688_102_1226 | 329 |
| 509 | 3300049581 | Ga0501047_0032624 | Ga0501047_0032624_3011_4132 | 329 |
| 510 | 3300049823 | Ga0501044_0005008 | Ga0501044_0005008_1314_2435 | 329 |
| 511 | 3300049823 | Ga0501044_0069430 | Ga0501044_0069430_2398_3525 | 329 |
| 512 | 3300050493 | nmdc:mga0k408_9076_c1 | nmdc:mga0k408_9076_c1_1840_2961 | 329 |
| 513 | 3300050507 | nmdc:mga05p37_32575_c1 | nmdc:mga05p37_32575_c1_3001_4122 | 329 |
| 514 | 3300053086 | Ga0500578_0137110 | Ga0500578_0137110_318_1439 | 329 |
| 515 | 3300053136 | Ga0500559_0051831 | Ga0500559_0051831_44_1165 | 329 |
| 516 | iso_pu_bacteria | 2818991442 | 2819575196 | 329 |
| 517 | iso_pu_bacteria | 2818991460 | 2819677179 | 329 |
| 518 | iso_pu_bacteria | 2840677318 | 2840679022 | 329 |
| 519 | iso_pu_bacteria | 2883068021 | 2883070301 | 329 |
| 520 | iso_pu_bacteria | 2896085136 | 2896086835 | 329 |
| 521 | iso_pu_bacteria | 2896109856 | 2896112821 | 329 |
| 522 | iso_pu_bacteria | 8003151029 | 8003152055 | 329 |
| 523 | 3300001979 | JGI24740J21852_10014041 | JGI24740J21852_100140413 | 330 |
| 524 | 3300003320 | rootH2_10085143 | rootH2_100851433 | 330 |
| 525 | 3300003322 | rootL2_10192099 | rootL2_101920991 | 330 |
| 526 | 3300003323 | rootH1_10046997 | rootH1_1004699715 | 330 |
| 527 | 3300003323 | rootH1_10205811 | rootH1_102058115 | 330 |
| 528 | 3300005366 | Ga0070659_100003782 | Ga0070659_1000037822 | 330 |
| 529 | 3300005367 | Ga0070667_100037265 | Ga0070667_1000372652 | 330 |
| 530 | 3300005367 | Ga0070667_100098839 | Ga0070667_1000988392 | 330 |
| 531 | 3300005616 | Ga0068852_100000460 | Ga0068852_10000046011 | 330 |
| 532 | 3300005841 | Ga0068863_100071975 | Ga0068863_1000719752 | 330 |
| 533 | 3300009176 | Ga0105242_10031774 | Ga0105242_100317742 | 330 |
| 534 | 3300009553 | Ga0105249_10028284 | Ga0105249_100282842 | 330 |
| 535 | 3300013102 | Ga0157371_10010282 | Ga0157371_100102823 | 330 |
| 536 | 3300013104 | Ga0157370_10204091 | Ga0157370_102040912 | 330 |
| 537 | 3300013307 | Ga0157372_10154852 | Ga0157372_101548523 | 330 |
| 538 | 3300025904 | Ga0207647_10000096 | Ga0207647_1000009632 | 330 |
| 539 | 3300025914 | Ga0207671_10040837 | Ga0207671_100408371 | 330 |
| 540 | 3300025986 | Ga0207658_10025912 | Ga0207658_100259122 | 330 |
| 541 | 3300025986 | Ga0207658_10026833 | Ga0207658_100268333 | 330 |
| 542 | 3300026088 | Ga0207641_10084252 | Ga0207641_100842523 | 330 |
| 543 | 3300026142 | Ga0207698_10004422 | Ga0207698_100044222 | 330 |
| 544 | 3300031251 | Ga0265327_10032218 | Ga0265327_100322182 | 330 |
| 545 | 3300031456 | Ga0307513_10043985 | Ga0307513_100439853 | 330 |
| 546 | 3300041404 | Ga0439436_0000350 | Ga0439436_0000350_3369_4493 | 330 |
| 547 | 3300041406 | Ga0439439_0011292 | Ga0439439_0011292_553_1677 | 330 |
| 548 | 3300042014 | Ga0439457_000130 | Ga0439457_000130_8593_9717 | 330 |
| 549 | 3300047322 | Ga0495680_0182403 | Ga0495680_0182403_54_1253 | 330 |
| 550 | 3300050493 | nmdc:mga0k408_65980_c1 | nmdc:mga0k408_65980_c1_381_1505 | 330 |
| 551 | 3300053086 | Ga0500578_0000469 | Ga0500578_0000469_6829_7953 | 330 |
| 552 | 3300053092 | Ga0500583_0000182 | Ga0500583_0000182_3008_4132 | 330 |
| 553 | 3300053092 | Ga0500583_0000288 | Ga0500583_0000288_1360_2484 | 330 |
| 554 | 3300053098 | Ga0500650_0050089 | Ga0500650_0050089_712_1836 | 330 |
| 555 | 3300053131 | Ga0500652_006537 | Ga0500652_006537_792_1919 | 330 |
| 556 | 3300053147 | Ga0500589_003476 | Ga0500589_003476_1898_3022 | 330 |
| 557 | iso_pu_bacteria | 2522125168 | 2522552008 | 330 |
| 558 | iso_pu_bacteria | 2738541278 | 2738725860 | 330 |
| 559 | iso_pu_bacteria | 2739367866 | 2740031932 | 330 |
| 560 | iso_pu_bacteria | 2890737413 | 2890738498 | 330 |
| 561 | iso_pu_bacteria | 2929177148 | 2929177415 | 330 |
| 562 | iso_pu_bacteria | 2945977869 | 2945979782 | 330 |
| 563 | iso_pu_bacteria | 2946013367 | 2946014351 | 330 |
| 564 | 3300003316 | rootH1_10037394 | rootH1_100373942 | 331 |
| 565 | 3300005328 | Ga0070676_10017971 | Ga0070676_100179712 | 331 |
| 566 | 3300005338 | Ga0068868_100017935 | Ga0068868_1000179352 | 331 |
| 567 | 3300005347 | Ga0070668_100048430 | Ga0070668_1000484301 | 331 |
| 568 | 3300005353 | Ga0070669_100059867 | Ga0070669_1000598672 | 331 |
| 569 | 3300005364 | Ga0070673_100006098 | Ga0070673_1000060986 | 331 |
| 570 | 3300005367 | Ga0070667_100059798 | Ga0070667_1000597982 | 331 |
| 571 | 3300005459 | Ga0068867_100016665 | Ga0068867_1000166654 | 331 |
| 572 | 3300005466 | Ga0070685_10016650 | Ga0070685_100166502 | 331 |
| 573 | 3300005543 | Ga0070672_100050493 | Ga0070672_1000504933 | 331 |
| 574 | 3300005548 | Ga0070665_100005140 | Ga0070665_1000051408 | 331 |
| 575 | 3300005577 | Ga0068857_100187210 | Ga0068857_1001872101 | 331 |
| 576 | 3300006237 | Ga0097621_100005579 | Ga0097621_1000055795 | 331 |
| 577 | 3300006847 | Ga0075431_100003991 | Ga0075431_1000039913 | 331 |
| 578 | 3300006881 | Ga0068865_100012266 | Ga0068865_1000122662 | 331 |
| 579 | 3300009094 | Ga0111539_10030151 | Ga0111539_100301513 | 331 |
| 580 | 3300009147 | Ga0114129_10120630 | Ga0114129_101206302 | 331 |
| 581 | 3300014326 | Ga0157380_10006038 | Ga0157380_100060383 | 331 |
| 582 | 3300014326 | Ga0157380_10137672 | Ga0157380_101376722 | 331 |
| 583 | 3300025907 | Ga0207645_10002123 | Ga0207645_1000212310 | 331 |
| 584 | 3300025923 | Ga0207681_10020339 | Ga0207681_100203393 | 331 |
| 585 | 3300025942 | Ga0207689_10002065 | Ga0207689_100020657 | 331 |
| 586 | 3300025960 | Ga0207651_10024166 | Ga0207651_100241662 | 331 |
| 587 | 3300025972 | Ga0207668_10136275 | Ga0207668_101362752 | 331 |
| 588 | 3300026089 | Ga0207648_10001340 | Ga0207648_100013407 | 331 |
| 589 | 3300026118 | Ga0207675_100020709 | Ga0207675_1000207094 | 331 |
| 590 | 3300026121 | Ga0207683_10002163 | Ga0207683_1000216311 | 331 |
| 591 | 3300028379 | Ga0268266_10122070 | Ga0268266_101220701 | 331 |
| 592 | 3300028794 | Ga0307515_10000012 | Ga0307515_10000012338 | 331 |
| 593 | 3300028794 | Ga0307515_10156850 | Ga0307515_101568502 | 331 |
| 594 | 3300031548 | Ga0307408_100013451 | Ga0307408_1000134514 | 331 |
| 595 | 3300031731 | Ga0307405_10000004 | Ga0307405_10000004166 | 331 |
| 596 | 3300031731 | Ga0307405_10100442 | Ga0307405_101004421 | 331 |
| 597 | 3300031852 | Ga0307410_10007574 | Ga0307410_100075744 | 331 |
| 598 | 3300031911 | Ga0307412_10004038 | Ga0307412_100040387 | 331 |
| 599 | 3300032002 | Ga0307416_100016391 | Ga0307416_1000163915 | 331 |
| 600 | 3300032002 | Ga0307416_100065853 | Ga0307416_1000658532 | 331 |
| 601 | 3300032126 | Ga0307415_100003538 | Ga0307415_1000035386 | 331 |
| 602 | 3300032126 | Ga0307415_100004256 | Ga0307415_1000042564 | 331 |
| 603 | 3300037466 | Ga0395898_0201579 | Ga0395898_0201579_143_1198 | 331 |
| 604 | 3300049652 | Ga0501202_000230 | Ga0501202_000230_5111_6166 | 331 |
| 605 | 3300049761 | Ga0501264_000187 | Ga0501264_000187_2678_3832 | 331 |
| 606 | 3300053156 | Ga0500622_0024966 | Ga0500622_0024966_1684_2814 | 331 |
| 607 | iso_pu_bacteria | 2884791551 | 2884797031 | 331 |
| 608 | 3300003316 | rootH1_10007636 | rootH1_100076369 | 332 |
| 609 | 3300003323 | rootH1_10023266 | rootH1_100232664 | 332 |
| 610 | 3300003323 | rootH1_10023267 | rootH1_100232673 | 332 |
| 611 | 3300003323 | rootH1_10088110 | rootH1_100881102 | 332 |
| 612 | 3300005290 | Ga0065712_10073522 | Ga0065712_100735223 | 332 |
| 613 | 3300005331 | Ga0070670_100065603 | Ga0070670_1000656032 | 332 |
| 614 | 3300005459 | Ga0068867_100150006 | Ga0068867_1001500062 | 332 |
| 615 | 3300005543 | Ga0070672_100076134 | Ga0070672_1000761342 | 332 |
| 616 | 3300006237 | Ga0097621_100015918 | Ga0097621_1000159183 | 332 |
| 617 | 3300013104 | Ga0157370_10029357 | Ga0157370_100293573 | 332 |
| 618 | 3300014326 | Ga0157380_10003690 | Ga0157380_100036905 | 332 |
| 619 | 3300014326 | Ga0157380_10007843 | Ga0157380_100078433 | 332 |
| 620 | 3300025935 | Ga0207709_10000026 | Ga0207709_1000002685 | 332 |
| 621 | 3300025940 | Ga0207691_10041641 | Ga0207691_100416414 | 332 |
| 622 | 3300031901 | Ga0307406_10144483 | Ga0307406_101444832 | 332 |
| 623 | 3300032004 | Ga0307414_10007685 | Ga0307414_100076855 | 332 |
| 624 | 3300041494 | Ga0451837_0682610 | Ga0451837_0682610_535_1665 | 332 |
| 625 | 3300042014 | Ga0439457_024499 | Ga0439457_024499_101_1249 | 332 |
| 626 | 3300045051 | Ga0451576_0000003 | Ga0451576_0000003_261764_262903 | 332 |
| 627 | 3300049576 | Ga0501040_0022226 | Ga0501040_0022226_457_1572 | 332 |
| 628 | 3300049703 | Ga0501219_000020 | Ga0501219_000020_21196_22329 | 332 |
| 629 | 3300050005 | Ga0501284_00030 | Ga0501284_00030_21667_22800 | 332 |
| 630 | iso_pu_bacteria | 2965320100 | 2965321747 | 332 |
| 631 | iso_pu_bacteria | 8036736890 | 8036738955 | 332 |
| 632 | 3300003316 | rootH1_10058961 | rootH1_100589612 | 333 |
| 633 | 3300005841 | Ga0068863_100045188 | Ga0068863_1000451884 | 333 |
| 634 | 3300009098 | Ga0105245_10091171 | Ga0105245_100911712 | 333 |
| 635 | 3300014326 | Ga0157380_10000295 | Ga0157380_1000029513 | 333 |
| 636 | 3300026088 | Ga0207641_10039756 | Ga0207641_100397562 | 333 |
| 637 | 3300048924 | Ga0496121_0143642 | Ga0496121_0143642_301_1365 | 333 |
| 638 | 3300053092 | Ga0500583_0072611 | Ga0500583_0072611_518_1612 | 333 |
| 639 | iso_pu_bacteria | 2896344016 | 2896347188 | 333 |
| 640 | iso_pu_bacteria | 2958512119 | 2958515042 | 333 |
| 641 | 3300005354 | Ga0070675_100028857 | Ga0070675_1000288574 | 334 |
| 642 | 3300006946 | Ga0079104_1000256 | Ga0079104_100025631 | 334 |
| 643 | 3300013104 | Ga0157370_10344279 | Ga0157370_103442792 | 334 |
| 644 | 3300027111 | Ga0209281_1000115 | Ga0209281_100011542 | 334 |
| 645 | 3300031824 | Ga0307413_10000007 | Ga0307413_1000000712 | 334 |
| 646 | 3300031824 | Ga0307413_10019663 | Ga0307413_100196631 | 334 |
| 647 | 3300032002 | Ga0307416_100001392 | Ga0307416_1000013925 | 334 |
| 648 | 3300032005 | Ga0307411_10000033 | Ga0307411_1000003328 | 334 |
| 649 | 3300048919 | Ga0496116_0000002 | Ga0496116_0000002_499284_500438 | 334 |
| 650 | 3300048928 | Ga0496125_0000007 | Ga0496125_0000007_500705_501784 | 334 |
| 651 | 3300005336 | Ga0070680_100000268 | Ga0070680_10000026818 | 335 |
| 652 | 3300005337 | Ga0070682_100002103 | Ga0070682_1000021033 | 335 |
| 653 | 3300005341 | Ga0070691_10000271 | Ga0070691_100002719 | 335 |
| 654 | 3300005366 | Ga0070659_100221079 | Ga0070659_1002210791 | 335 |
| 655 | 3300005458 | Ga0070681_10060332 | Ga0070681_100603323 | 335 |
| 656 | 3300005530 | Ga0070679_100037756 | Ga0070679_1000377562 | 335 |
| 657 | 3300005563 | Ga0068855_100011315 | Ga0068855_1000113153 | 335 |
| 658 | 3300009174 | Ga0105241_10000252 | Ga0105241_1000025213 | 335 |
| 659 | 3300025911 | Ga0207654_10012351 | Ga0207654_100123512 | 335 |
| 660 | 3300025912 | Ga0207707_10004370 | Ga0207707_100043709 | 335 |
| 661 | 3300025913 | Ga0207695_10037303 | Ga0207695_100373031 | 335 |
| 662 | 3300033180 | Ga0307510_10102177 | Ga0307510_101021773 | 335 |
| 663 | 3300035398 | Ga0316574_0234993 | Ga0316574_0234993_22_1155 | 335 |
| 664 | 3300049679 | Ga0501249_000015 | Ga0501249_000015_93445_94527 | 335 |
| 665 | 3300049679 | Ga0501249_000664 | Ga0501249_000664_3546_4679 | 335 |
| 666 | 3300053096 | Ga0500641_0002301 | Ga0500641_0002301_1873_2955 | 335 |
| 667 | 3300053118 | Ga0500594_0015338 | Ga0500594_0015338_436_1518 | 335 |
| 668 | 3300053158 | Ga0500627_0071077 | Ga0500627_0071077_18_1100 | 335 |
| 669 | 3300005337 | Ga0070682_100053130 | Ga0070682_1000531301 | 336 |
| 670 | 3300009036 | Ga0105244_10000025 | Ga0105244_10000025100 | 336 |
| 671 | 3300017792 | Ga0163161_10000014 | Ga0163161_1000001419 | 336 |
| 672 | 3300025728 | Ga0207655_1000003 | Ga0207655_1000003577 | 336 |
| 673 | 3300048929 | Ga0496126_0046451 | Ga0496126_0046451_2770_3924 | 336 |
| 674 | 3300053118 | Ga0500594_0019407 | Ga0500594_0019407_366_1427 | 336 |
| 675 | 2162886007 | SwRhRL2b_contig_1665027 | SwRhRL2b_0885.00004140 | 337 |
| 676 | 3300005289 | Ga0065704_10070489 | Ga0065704_100704893 | 337 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1olt-assembly1.cif.gz_A | coproporphyrinogen iii oxidase (hemn) from escherichia coli is a radical sam enzyme. | 0.8313 | 5 | 330 |
| 1olt-assembly1.cif.gz_A | coproporphyrinogen iii oxidase (hemn) from escherichia coli is a radical sam enzyme. | 0.8051 | 5 | 330 |
| 7n7i-assembly3.cif.gz_C | x-ray crystal structure of viperin-like enzyme from trichoderma virens | 0.7429 | 12 | 131 |
| 4rtb-assembly1.cif.gz_A | x-ray structure of the fefe-hydrogenase maturase hydg from carboxydothermus hydrogenoformans | 0.7295 | 8 | 134 |
| 5exk-assembly6.cif.gz_K | crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate | 0.726 | 27 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9HA92_43_208_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9244 | 7 | 143 | 3.20.20.70 |
| af_Q54VE8_28_212_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9052 | 5 | 145 | 3.20.20.70 |
| af_P9WP73_8_223_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.8732 | 8 | 170 | 3.80.30.20 |
| af_Q5SUV1_33_283_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8724 | 8 | 201 | 3.20.20.70 |
| af_Q2FXY9_297_360_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8672 | 256 | 319 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6AHA5-F1-model_v4 | Coproporphyrinogen III oxidase | 0.9903 | 260 | 331 |
|
| AF-A0A519RAU5-F1-model_v4 | Radical SAM protein | 0.985 | 2 | 110 |
GO:0003824
GO:0005737 GO:0006779 GO:0051539 |
| AF-A0A645C5G4-F1-model_v4 | HemN C-terminal domain-containing protein | 0.9685 | 215 | 332 |
GO:0005737
GO:0006779 GO:0051539 |
| AF-A0A559NTG7-F1-model_v4 | Heme chaperone HemW | 0.9611 | 3 | 335 |
GO:0004109
GO:0005737 GO:0006779 GO:0046872 GO:0051539 |
| AF-A0A352FB89-F1-model_v4 | HemN C-terminal domain-containing protein | 0.9584 | 260 | 332 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar