F474529

General Info

Members Datasets Scaffolds Average Seq Length
676 310 649 362

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10144483|Ga0307406_101444832
Length 417
Sequence MIFKDPKQRYDLLAVSVISLKLLIKQISLAGIYIHIPFCKQACHYCNFHFSTSLRYKNELIHALLKEIALTPDFFPEATAHADIIETIYFGGGTPSLCSKDEIKNILDKIRQTFRVSSEAEVTLEANPDDISEEKLLQWKEAGINRLSIGIQSFFEEDLAWMNRAHNSRQAWESLVLATRHFSNITIDLIYGTPALTNEKWKQNVAKAIGLGIPHLSCYALTVEPQTPLQKLIREHKTADVNPDQQSEQFLLLMEWMEQAGYEHYEISNFAKPGFRSRHNSSYWQGKPYFGFGPSAHSFDGRSRWWNIANNNTYIRSIDEGVIPFEQEILTPTQQVNEFIMISLRTQEGLDLARMIRQVHGFTEEKLAEITGNLLSESDKYISKGLMTREEQRLRLTKEGRLLADGIAADLFLLEAE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
4 2738541278 Niastella sp. CF465 Isolate Unclassified
5 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
6 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
7 2818991444 Filimonas endophytica 3197 Isolate Unclassified
8 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
9 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
10 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
11 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
12 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
13 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
14 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
15 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
16 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
17 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
18 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
19 2914759650 Rhizosphaericola mali Isolate Rhizosphere
20 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
21 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
22 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
23 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
24 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
25 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
26 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
27 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
28 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
29 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
30 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
31 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
32 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
197 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
219 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
220 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
221 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
222 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
250 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
275 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
276 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
277 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
281 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
292 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
293 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
294 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
295 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
296 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
297 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
298 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
299 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
300 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
301 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
302 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
303 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
304 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
305 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
306 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
307 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
310 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.86
Metatranscriptomes 0
Isolates 4.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.07
Nodule 0.3
Rhizoplane 0.44
Rhizosphere 86.09
Stem 0
Stem Tuber 0
Unclassified 7.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1665027 2162886007 Bacteria 5197
2 SwRhRL2b_contig_2641798 2162886007 Bacteria 2800
3 JGI24740J21852_10014041 3300001979 Bacteria 2968
4 JGI24739J22299_10035425 3300001989 Bacteria 1691
5 JGI24751J29686_10000655 3300002459 Bacteria 8686
6 JGI25162J39368_1000258 3300002737 Bacteria 50724
7 JGI25154J39366_1000006 3300002738 Bacteria 336396
8 JGI25153J46596_10000485 3300003215 Bacteria 25536
9 rootH1_10007636 3300003316 Bacteria 8851
10 rootH1_10037394 3300003316 Bacteria 2846
11 rootH1_10058961 3300003316 Bacteria 5062
12 rootH2_10022930 3300003320 Bacteria 32910
13 rootH2_10081840 3300003320 Unclassified 1190
14 rootH2_10085143 3300003320 Bacteria 3335
15 rootL2_10050502 3300003322 Bacteria 1750
16 rootL2_10060108 3300003322 Bacteria 6828
17 rootL2_10105470 3300003322 Bacteria 2966
18 rootL2_10192099 3300003322 Bacteria 1574
19 rootL2_10213233 3300003322 Bacteria 2465
20 rootL2_10283016 3300003322 Bacteria 2547
21 rootH1_10023266 3300003316 Bacteria 2841
22 rootH1_10023266 3300003323 Bacteria 4469
23 rootH1_10023267 3300003323 Bacteria 3359
24 rootH1_10046997 3300003323 Bacteria 18464
25 rootH1_10060702 3300003323 Bacteria 5254
26 rootH1_10088110 3300003323 Bacteria 8606
27 rootH1_10129548 3300003323 Bacteria 1914
28 rootH1_10190552 3300003323 Bacteria 4189
29 rootH1_10205811 3300003323 Bacteria 6617
30 JGI25160J50197_1002148 3300003354 Bacteria 9337
31 Ga0065714_10083948 3300005288 Bacteria 2206
32 Ga0065704_10070489 3300005289 Bacteria 22644
33 Ga0065704_10072160 3300005289 Bacteria 9027
34 Ga0065712_10073522 3300005290 Bacteria 4360
35 Ga0065712_10115534 3300005290 Bacteria 1742
36 Ga0065707_10120143 3300005295 Bacteria 2142
37 Ga0070658_10011999 3300005327 Bacteria 6957
38 Ga0070658_10186103 3300005327 Bacteria 1749
39 Ga0070658_10204591 3300005327 Unclassified 1666
40 Ga0070658_10227206 3300005327 Bacteria 1580
41 Ga0070676_10017971 3300005328 Bacteria 3915
42 Ga0070676_10061023 3300005328 Bacteria 2240
43 Ga0070683_100002583 3300005329 Bacteria 14483
44 Ga0070683_100003463 3300005329 Bacteria 12826
45 Ga0070683_100014557 3300005329 Bacteria 6886
46 Ga0070690_100017866 3300005330 Bacteria 4275
47 Ga0070690_100047972 3300005330 Bacteria 2718
48 Ga0070690_100056863 3300005330 Bacteria 2509
49 Ga0070670_100040014 3300005331 Bacteria 4032
50 Ga0070670_100040716 3300005331 Bacteria 3993
51 Ga0070670_100048124 3300005331 Bacteria 3669
52 Ga0070670_100065603 3300005331 Bacteria 3115
53 Ga0070670_100103128 3300005331 Bacteria 2457
54 Ga0068869_100002467 3300005334 Bacteria 11156
55 Ga0068869_100018710 3300005334 Bacteria 4721
56 Ga0070666_10013725 3300005335 Bacteria 5143
57 Ga0070666_10018557 3300005335 Bacteria 4476
58 Ga0070666_10065281 3300005335 Unclassified 2470
59 Ga0070666_10091233 3300005335 Bacteria 2093
60 Ga0070666_10240820 3300005335 Bacteria 1279
61 Ga0070680_100000268 3300005336 Bacteria 34613
62 Ga0070682_100000121 3300005337 Bacteria 69122
63 Ga0070682_100002103 3300005337 Bacteria 11066
64 Ga0070682_100053130 3300005337 Bacteria 2538
65 Ga0070682_100096896 3300005337 Bacteria 1940
66 Ga0068868_100003164 3300005338 Bacteria 11456
67 Ga0068868_100017935 3300005338 Bacteria 5281
68 Ga0068868_100037742 3300005338 Bacteria 3747
69 Ga0068868_100071496 3300005338 Bacteria 2767
70 Ga0068868_100390529 3300005338 Bacteria 1199
71 Ga0070660_100013028 3300005339 Bacteria 5951
72 Ga0070660_100024051 3300005339 Bacteria 4519
73 Ga0070660_100101803 3300005339 Bacteria 2276
74 Ga0070689_100029970 3300005340 Bacteria 4126
75 Ga0070689_100066581 3300005340 Bacteria 2806
76 Ga0070691_10000271 3300005341 Bacteria 18096
77 Ga0070687_100064062 3300005343 Bacteria 1952
78 Ga0070661_100000111 3300005344 Bacteria 68066
79 Ga0070661_100023047 3300005344 Bacteria 4461
80 Ga0070661_100024199 3300005344 Bacteria 4355
81 Ga0070661_100201233 3300005344 Bacteria 1522
82 Ga0070668_100048430 3300005347 Bacteria 3268
83 Ga0070669_100059867 3300005353 Bacteria 2796
84 Ga0070669_100224026 3300005353 Bacteria 1488
85 Ga0070675_100028857 3300005354 Bacteria 4470
86 Ga0070671_100001071 3300005355 Bacteria 20211
87 Ga0070671_100045530 3300005355 Bacteria 3648
88 Ga0070673_100006098 3300005364 Bacteria 7810
89 Ga0070673_100039851 3300005364 Bacteria 3599
90 Ga0070673_100051667 3300005364 Bacteria 3221
91 Ga0070673_100065303 3300005364 Bacteria 2902
92 Ga0070688_100008316 3300005365 Bacteria 5629
93 Ga0070688_100013987 3300005365 Bacteria 4539
94 Ga0070688_100063656 3300005365 Bacteria 2338
95 Ga0070659_100003782 3300005366 Bacteria 10802
96 Ga0070659_100004992 3300005366 Bacteria 9504
97 Ga0070659_100042015 3300005366 Bacteria 3575
98 Ga0070659_100221079 3300005366 Bacteria 1563
99 Ga0070667_100006052 3300005367 Bacteria 10050
100 Ga0070667_100031584 3300005367 Bacteria 4415
101 Ga0070667_100037265 3300005367 Bacteria 4077
102 Ga0070667_100049812 3300005367 Bacteria 3529
103 Ga0070667_100059798 3300005367 Unclassified 3224
104 Ga0070667_100065563 3300005367 Bacteria 3084
105 Ga0070667_100098839 3300005367 Bacteria 2518
106 Ga0070663_100305307 3300005455 Unclassified 1275
107 Ga0070662_100005807 3300005457 Bacteria 7913
108 Ga0070662_100007166 3300005457 Bacteria 7222
109 Ga0070681_10035895 3300005458 Bacteria 4979
110 Ga0070681_10060332 3300005458 Bacteria 3770
111 Ga0068867_100016665 3300005459 Bacteria 5219
112 Ga0068867_100039839 3300005459 Unclassified 3427
113 Ga0068867_100052616 3300005459 Bacteria 3005
114 Ga0068867_100150006 3300005459 Unclassified 1830
115 Ga0068867_100304831 3300005459 Bacteria 1314
116 Ga0070685_10016650 3300005466 Unclassified 3921
117 Ga0070685_10019407 3300005466 Bacteria 3666
118 Ga0070679_100037756 3300005530 Bacteria 4799
119 Ga0070679_100157899 3300005530 Bacteria 2242
120 Ga0070684_100000105 3300005535 Bacteria 54272
121 Ga0070684_100010934 3300005535 Bacteria 7213
122 Ga0070684_100042770 3300005535 Bacteria 3913
123 Ga0070684_100233094 3300005535 Bacteria 1681
124 Ga0068853_100003177 3300005539 Bacteria 12555
125 Ga0068853_100044698 3300005539 Bacteria 3791
126 Ga0068853_100058967 3300005539 Bacteria 3315
127 Ga0068853_100112909 3300005539 Bacteria 2415
128 Ga0068853_100214820 3300005539 Bacteria 1754
129 Ga0068853_100317114 3300005539 Bacteria 1444
130 Ga0070672_100050493 3300005543 Bacteria 3240
131 Ga0070672_100076134 3300005543 Unclassified 2680
132 Ga0070672_100088937 3300005543 Bacteria 2487
133 Ga0070686_100095597 3300005544 Bacteria 1996
134 Ga0070665_100000014 3300005548 Bacteria 484881
135 Ga0070665_100005140 3300005548 Bacteria 13552
136 Ga0068855_100006230 3300005563 Bacteria 14539
137 Ga0068855_100011315 3300005563 Bacteria 10775
138 Ga0068855_100023086 3300005563 Bacteria 7454
139 Ga0068855_100026647 3300005563 Bacteria 6916
140 Ga0068855_100057963 3300005563 Bacteria 4538
141 Ga0068855_100084962 3300005563 Bacteria 3663
142 Ga0068855_100095453 3300005563 Bacteria 3427
143 Ga0068855_100117596 3300005563 Bacteria 3045
144 Ga0070664_100000838 3300005564 Bacteria 23738
145 Ga0070664_100035238 3300005564 Bacteria 4201
146 Ga0070664_100075864 3300005564 Bacteria 2888
147 Ga0070664_100197599 3300005564 Bacteria 1793
148 Ga0068857_100002762 3300005577 Bacteria 14423
149 Ga0068857_100005990 3300005577 Bacteria 10383
150 Ga0068857_100040610 3300005577 Bacteria 4126
151 Ga0068857_100062804 3300005577 Bacteria 3302
152 Ga0068857_100187210 3300005577 Unclassified 1885
153 Ga0068854_100050338 3300005578 Bacteria 2980
154 Ga0068854_100057303 3300005578 Bacteria 2810
155 Ga0068856_100030372 3300005614 Bacteria 5283
156 Ga0068856_100140724 3300005614 Bacteria 2420
157 Ga0068856_100199924 3300005614 Bacteria 2013
158 Ga0068852_100000460 3300005616 Bacteria 26906
159 Ga0068852_100005237 3300005616 Bacteria 9250
160 Ga0068852_100153054 3300005616 Bacteria 2146
161 Ga0068859_100000620 3300005617 Bacteria 35497
162 Ga0068859_100007242 3300005617 Bacteria 11253
163 Ga0068859_100085924 3300005617 Unclassified 3191
164 Ga0068864_100015413 3300005618 Bacteria 6356
165 Ga0068864_100034999 3300005618 Bacteria 4274
166 Ga0068864_100039686 3300005618 Bacteria 4024
167 Ga0068864_100086279 3300005618 Bacteria 2761
168 Ga0068864_100172900 3300005618 Bacteria 1971
169 Ga0068866_10005900 3300005718 Bacteria 5090
170 Ga0068866_10028230 3300005718 Bacteria 2672
171 Ga0068861_100012731 3300005719 Bacteria 5871
172 Ga0068861_100021936 3300005719 Bacteria 4594
173 Ga0068861_100145425 3300005719 Bacteria 1940
174 Ga0068851_10006509 3300005834 Bacteria 5333
175 Ga0068851_10046052 3300005834 Bacteria 2206
176 Ga0068851_10052377 3300005834 Bacteria 2075
177 Ga0068851_10085264 3300005834 Bacteria 1655
178 Ga0068863_100022535 3300005841 Bacteria 6014
179 Ga0068863_100045188 3300005841 Bacteria 4180
180 Ga0068863_100071975 3300005841 Bacteria 3271
181 Ga0068863_100123674 3300005841 Bacteria 2468
182 Ga0068858_100070745 3300005842 Bacteria 3234
183 Ga0068858_100142847 3300005842 Bacteria 2247
184 Ga0068858_100346297 3300005842 Bacteria 1423
185 Ga0068860_100000394 3300005843 Bacteria 57127
186 Ga0068860_100014820 3300005843 Bacteria 7626
187 Ga0068860_100031932 3300005843 Bacteria 5062
188 Ga0068860_100394524 3300005843 Bacteria 1368
189 Ga0081540_1004387 3300005983 Bacteria 10781
190 Ga0081539_10000714 3300005985 Bacteria 66625
191 Ga0075366_10000017 3300006195 Bacteria 63599
192 Ga0075366_10001639 3300006195 Bacteria 11231
193 Ga0075366_10014674 3300006195 Bacteria 4478
194 Ga0075366_10064609 3300006195 Bacteria 2176
195 Ga0097621_100000359 3300006237 Bacteria 31567
196 Ga0097621_100005579 3300006237 Bacteria 8871
197 Ga0097621_100015918 3300006237 Bacteria 5672
198 Ga0097621_100019163 3300006237 Bacteria 5246
199 Ga0097621_100048701 3300006237 Bacteria 3440
200 Ga0097621_100219561 3300006237 Bacteria 1656
201 Ga0068871_100001167 3300006358 Bacteria 17651
202 Ga0068871_100005004 3300006358 Bacteria 9260
203 Ga0068871_100092328 3300006358 Bacteria 2525
204 Ga0068871_100355306 3300006358 Bacteria 1297
205 Ga0075428_100013338 3300006844 Bacteria 9143
206 Ga0075428_100313052 3300006844 Bacteria 1687
207 Ga0075430_100000960 3300006846 Bacteria 22735
208 Ga0075431_100003991 3300006847 Bacteria 14378
209 Ga0075431_100063071 3300006847 Bacteria 3824
210 Ga0075429_100000723 3300006880 Bacteria 25874
211 Ga0068865_100012266 3300006881 Bacteria 5390
212 Ga0068865_100037589 3300006881 Bacteria 3270
213 Ga0068865_100095899 3300006881 Bacteria 2162
214 Ga0068865_100115717 3300006881 Bacteria 1985
215 Ga0097620_100000620 3300006931 Bacteria 35497
216 Ga0097620_100007242 3300006931 Bacteria 11253
217 Ga0097620_100085931 3300006931 Unclassified 3191
218 Ga0079104_1000256 3300006946 Bacteria 71046
219 Ga0105244_10000025 3300009036 Bacteria 217877
220 Ga0105240_10008191 3300009093 Bacteria 14980
221 Ga0105240_10020065 3300009093 Bacteria 8922
222 Ga0105240_10025004 3300009093 Bacteria 7860
223 Ga0105240_10049773 3300009093 Bacteria 5286
224 Ga0105240_10150950 3300009093 Bacteria 2767
225 Ga0105240_10184558 3300009093 Bacteria 2458
226 Ga0111539_10030151 3300009094 Bacteria 6596
227 Ga0111539_10390477 3300009094 Bacteria 1621
228 Ga0105245_10091171 3300009098 Bacteria 2804
229 Ga0105247_10000619 3300009101 Bacteria 28588
230 Ga0114129_10041957 3300009147 Bacteria 6442
231 Ga0114129_10120630 3300009147 Bacteria 3610
232 Ga0105243_10000009 3300009148 Bacteria 354419
233 Ga0105241_10000252 3300009174 Bacteria 40539
234 Ga0105241_10002136 3300009174 Bacteria 14943
235 Ga0105241_10019869 3300009174 Bacteria 4958
236 Ga0105241_10092250 3300009174 Bacteria 2391
237 Ga0105241_10186770 3300009174 Unclassified 1723
238 Ga0105242_10031774 3300009176 Bacteria 4220
239 Ga0105242_10041383 3300009176 Bacteria 3716
240 Ga0105242_10053818 3300009176 Bacteria 3288
241 Ga0105242_10498683 3300009176 Bacteria 1158
242 Ga0105248_10033685 3300009177 Bacteria 5724
243 Ga0105248_10510547 3300009177 Bacteria 1355
244 Ga0105237_10000191 3300009545 Bacteria 87065
245 Ga0105237_10000938 3300009545 Bacteria 39240
246 Ga0105237_10006188 3300009545 Bacteria 13363
247 Ga0105237_10008039 3300009545 Bacteria 11472
248 Ga0105237_10008044 3300009545 Bacteria 11467
249 Ga0105237_10012420 3300009545 Bacteria 8977
250 Ga0105237_10034602 3300009545 Bacteria 5115
251 Ga0105237_10128039 3300009545 Bacteria 2533
252 Ga0105238_10004065 3300009551 Bacteria 14503
253 Ga0105238_10023581 3300009551 Bacteria 6270
254 Ga0105238_10139933 3300009551 Bacteria 2397
255 Ga0105249_10001117 3300009553 Bacteria 23873
256 Ga0105249_10001306 3300009553 Bacteria 21852
257 Ga0105249_10017168 3300009553 Bacteria 6425
258 Ga0105249_10028284 3300009553 Bacteria 5060
259 Ga0105249_10079924 3300009553 Bacteria 3036
260 Ga0105249_10220478 3300009553 Unclassified 1866
261 Ga0105239_10003738 3300010375 Bacteria 18534
262 Ga0105239_10006447 3300010375 Bacteria 13611
263 Ga0105239_10006468 3300010375 Bacteria 13590
264 Ga0105239_10013262 3300010375 Bacteria 9159
265 Ga0105239_10018690 3300010375 Bacteria 7656
266 Ga0105246_10085720 3300011119 Bacteria 2256
267 Ga0105246_10165860 3300011119 Bacteria 1687
268 Ga0157373_10005562 3300013100 Bacteria 9445
269 Ga0157373_10021611 3300013100 Unclassified 4672
270 Ga0157373_10058618 3300013100 Unclassified 2729
271 Ga0157373_10091764 3300013100 Bacteria 2139
272 Ga0157371_10010282 3300013102 Bacteria 7299
273 Ga0157371_10010327 3300013102 Bacteria 7286
274 Ga0157371_10157541 3300013102 Bacteria 1621
275 Ga0157370_10010610 3300013104 Bacteria 9697
276 Ga0157370_10013171 3300013104 Bacteria 8529
277 Ga0157370_10029357 3300013104 Bacteria 5397
278 Ga0157370_10204091 3300013104 Bacteria 1833
279 Ga0157370_10344279 3300013104 Bacteria 1374
280 Ga0157369_10006913 3300013105 Bacteria 13093
281 Ga0157369_10058404 3300013105 Bacteria 4162
282 Ga0157374_10000011 3300013296 Bacteria 466749
283 Ga0157374_10004430 3300013296 Bacteria 11807
284 Ga0157374_10009692 3300013296 Bacteria 8270
285 Ga0157374_10197668 3300013296 Bacteria 1968
286 Ga0157374_10289602 3300013296 Bacteria 1618
287 Ga0157374_10548456 3300013296 Bacteria 1164
288 Ga0157378_10007261 3300013297 Bacteria 9675
289 Ga0157378_10061615 3300013297 Bacteria 3349
290 Ga0157378_10066657 3300013297 Unclassified 3225
291 Ga0157378_10269177 3300013297 Bacteria 1638
292 Ga0163162_10001000 3300013306 Bacteria 26251
293 Ga0163162_10007147 3300013306 Bacteria 10837
294 Ga0163162_10103635 3300013306 Bacteria 2939
295 Ga0163162_10126262 3300013306 Bacteria 2664
296 Ga0163162_10194665 3300013306 Bacteria 2156
297 Ga0157372_10001585 3300013307 Bacteria 24755
298 Ga0157372_10012413 3300013307 Bacteria 9079
299 Ga0157372_10022925 3300013307 Bacteria 6762
300 Ga0157372_10034739 3300013307 Bacteria 5546
301 Ga0157372_10077080 3300013307 Bacteria 3764
302 Ga0157372_10083286 3300013307 Bacteria 3623
303 Ga0157372_10115305 3300013307 Unclassified 3080
304 Ga0157372_10154852 3300013307 Bacteria 2647
305 Ga0157372_10293439 3300013307 Bacteria 1891
306 Ga0157375_10002200 3300013308 Bacteria 16851
307 Ga0157375_10043524 3300013308 Bacteria 4355
308 Ga0157375_10127417 3300013308 Bacteria 2662
309 Ga0157375_10160772 3300013308 Unclassified 2387
310 Ga0157375_10176974 3300013308 Bacteria 2283
311 Ga0157375_10415969 3300013308 Bacteria 1511
312 Ga0163163_10000831 3300014325 Bacteria 26270
313 Ga0163163_10545822 3300014325 Bacteria 1221
314 Ga0157380_10000295 3300014326 Bacteria 29994
315 Ga0157380_10003690 3300014326 Bacteria 10535
316 Ga0157380_10006038 3300014326 Bacteria 8484
317 Ga0157380_10007843 3300014326 Bacteria 7600
318 Ga0157380_10137672 3300014326 Bacteria 2092
319 Ga0157380_10193763 3300014326 Bacteria 1797
320 Ga0157380_10211019 3300014326 Bacteria 1730
321 Ga0157380_10453299 3300014326 Bacteria 1232
322 Ga0157377_10116447 3300014745 Bacteria 1614
323 Ga0157379_10010412 3300014968 Bacteria 8103
324 Ga0157379_10016392 3300014968 Bacteria 6517
325 Ga0157379_10199582 3300014968 Bacteria 1809
326 Ga0157379_10318506 3300014968 Bacteria 1420
327 Ga0157376_10000938 3300014969 Bacteria 18935
328 Ga0157376_10002924 3300014969 Bacteria 11719
329 Ga0157376_10046953 3300014969 Bacteria 3564
330 Ga0157376_10079127 3300014969 Bacteria 2817
331 Ga0157376_10158982 3300014969 Bacteria 2046
332 Ga0182005_1000017 3300015265 Bacteria 331828
333 Ga0163161_10000014 3300017792 Bacteria 258440
334 Ga0163161_10003336 3300017792 Bacteria 11258
335 Ga0163161_10020278 3300017792 Bacteria 4664
336 Ga0163161_10051257 3300017792 Bacteria 2989
337 Ga0163161_10124095 3300017792 Bacteria 1943
338 Ga0209436_100091 3300025208 Bacteria 44391
339 Ga0209646_1000031 3300025246 Bacteria 381260
340 Ga0209026_1000019 3300025250 Bacteria 381260
341 Ga0209130_1000333 3300025284 Bacteria 54192
342 Ga0209758_1001097 3300025297 Bacteria 35040
343 Ga0207426_1000024 3300025302 Bacteria 534075
344 Ga0207426_1000059 3300025302 Bacteria 363842
345 Ga0207426_1000691 3300025302 Bacteria 40521
346 Ga0207656_10019824 3300025321 Bacteria 2664
347 Ga0207656_10045420 3300025321 Bacteria 1880
348 Ga0207655_1000003 3300025728 Bacteria 1081376
349 Ga0207710_10004843 3300025900 Bacteria 5838
350 Ga0207680_10043718 3300025903 Unclassified 2629
351 Ga0207680_10055071 3300025903 Bacteria 2395
352 Ga0207647_10000096 3300025904 Bacteria 67468
353 Ga0207685_10066048 3300025905 Bacteria 1450
354 Ga0207645_10002123 3300025907 Bacteria 15868
355 Ga0207643_10053248 3300025908 Bacteria 2299
356 Ga0207643_10187738 3300025908 Bacteria 1253
357 Ga0207705_10203833 3300025909 Bacteria 1499
358 Ga0207654_10006725 3300025911 Bacteria 5780
359 Ga0207654_10012351 3300025911 Bacteria 4377
360 Ga0207707_10004370 3300025912 Bacteria 12497
361 Ga0207707_10045387 3300025912 Bacteria 3830
362 Ga0207695_10000212 3300025913 Bacteria 156450
363 Ga0207695_10001387 3300025913 Bacteria 40927
364 Ga0207695_10037303 3300025913 Bacteria 5245
365 Ga0207695_10057600 3300025913 Bacteria 4036
366 Ga0207671_10001331 3300025914 Bacteria 28876
367 Ga0207671_10001357 3300025914 Bacteria 28586
368 Ga0207671_10001792 3300025914 Bacteria 24073
369 Ga0207671_10022086 3300025914 Bacteria 4816
370 Ga0207671_10023899 3300025914 Bacteria 4603
371 Ga0207671_10040837 3300025914 Bacteria 3433
372 Ga0207671_10057849 3300025914 Bacteria 2874
373 Ga0207662_10114215 3300025918 Bacteria 1687
374 Ga0207657_10005058 3300025919 Bacteria 13836
375 Ga0207657_10024210 3300025919 Bacteria 5632
376 Ga0207649_10000517 3300025920 Bacteria 27099
377 Ga0207649_10042501 3300025920 Unclassified 2773
378 Ga0207649_10169274 3300025920 Bacteria 1520
379 Ga0207652_10011840 3300025921 Bacteria 7036
380 Ga0207652_10216432 3300025921 Bacteria 1726
381 Ga0207681_10020339 3300025923 Bacteria 4204
382 Ga0207681_10093448 3300025923 Unclassified 2153
383 Ga0207694_10078063 3300025924 Bacteria 2595
384 Ga0207650_10094137 3300025925 Bacteria 2294
385 Ga0207659_10020402 3300025926 Bacteria 4380
386 Ga0207659_10088658 3300025926 Bacteria 2305
387 Ga0207644_10014077 3300025931 Bacteria 5349
388 Ga0207690_10267819 3300025932 Bacteria 1326
389 Ga0207706_10001896 3300025933 Bacteria 20531
390 Ga0207706_10008919 3300025933 Bacteria 9232
391 Ga0207686_10003596 3300025934 Bacteria 8305
392 Ga0207709_10000026 3300025935 Bacteria 354467
393 Ga0207670_10022409 3300025936 Bacteria 3914
394 Ga0207669_10140389 3300025937 Bacteria 1676
395 Ga0207704_10064983 3300025938 Unclassified 2282
396 Ga0207691_10030881 3300025940 Bacteria 5003
397 Ga0207691_10041641 3300025940 Unclassified 4239
398 Ga0207691_10045858 3300025940 Bacteria 4018
399 Ga0207689_10002065 3300025942 Bacteria 18954
400 Ga0207689_10002750 3300025942 Bacteria 16259
401 Ga0207689_10023984 3300025942 Bacteria 5118
402 Ga0207689_10053043 3300025942 Bacteria 3340
403 Ga0207689_10078622 3300025942 Bacteria 2711
404 Ga0207661_10001812 3300025944 Bacteria 14604
405 Ga0207661_10010041 3300025944 Bacteria 6802
406 Ga0207661_10284543 3300025944 Bacteria 1478
407 Ga0207679_10000091 3300025945 Bacteria 78725
408 Ga0207679_10036462 3300025945 Bacteria 3488
409 Ga0207667_10000414 3300025949 Bacteria 57815
410 Ga0207667_10006924 3300025949 Bacteria 13699
411 Ga0207667_10008497 3300025949 Bacteria 12190
412 Ga0207667_10022188 3300025949 Bacteria 7021
413 Ga0207667_10045879 3300025949 Bacteria 4627
414 Ga0207651_10009976 3300025960 Bacteria 5235
415 Ga0207651_10024166 3300025960 Unclassified 3754
416 Ga0207651_10033617 3300025960 Bacteria 3310
417 Ga0207651_10053609 3300025960 Bacteria 2758
418 Ga0207651_10063786 3300025960 Unclassified 2575
419 Ga0207712_10000725 3300025961 Bacteria 25158
420 Ga0207712_10000915 3300025961 Bacteria 21389
421 Ga0207712_10001923 3300025961 Bacteria 13655
422 Ga0207712_10016389 3300025961 Bacteria 4797
423 Ga0207712_10101099 3300025961 Bacteria 2143
424 Ga0207668_10136275 3300025972 Bacteria 1881
425 Ga0207640_10053742 3300025981 Bacteria 2630
426 Ga0207640_10328775 3300025981 Bacteria 1220
427 Ga0207658_10025912 3300025986 Bacteria 4108
428 Ga0207658_10026833 3300025986 Bacteria 4042
429 Ga0207658_10086364 3300025986 Unclassified 2419
430 Ga0207658_10135087 3300025986 Bacteria 1987
431 Ga0207677_10101709 3300026023 Bacteria 2117
432 Ga0207703_10020625 3300026035 Bacteria 5155
433 Ga0207639_10004779 3300026041 Bacteria 9134
434 Ga0207639_10085621 3300026041 Bacteria 2507
435 Ga0207639_10092413 3300026041 Bacteria 2425
436 Ga0207678_10050208 3300026067 Bacteria 3604
437 Ga0207708_10353361 3300026075 Bacteria 1206
438 Ga0207702_10011662 3300026078 Bacteria 7321
439 Ga0207702_10174712 3300026078 Bacteria 1973
440 Ga0207702_10289456 3300026078 Bacteria 1551
441 Ga0207641_10002004 3300026088 Bacteria 19426
442 Ga0207641_10039756 3300026088 Bacteria 3935
443 Ga0207641_10084252 3300026088 Bacteria 2767
444 Ga0207641_10090078 3300026088 Bacteria 2682
445 Ga0207641_10158141 3300026088 Bacteria 2058
446 Ga0207648_10001340 3300026089 Bacteria 27318
447 Ga0207648_10001507 3300026089 Bacteria 25668
448 Ga0207648_10022209 3300026089 Bacteria 5700
449 Ga0207648_10272762 3300026089 Unclassified 1511
450 Ga0207676_10017907 3300026095 Bacteria 5141
451 Ga0207676_10021806 3300026095 Bacteria 4704
452 Ga0207676_10137961 3300026095 Bacteria 2084
453 Ga0207676_10365803 3300026095 Bacteria 1338
454 Ga0207674_10006954 3300026116 Bacteria 13246
455 Ga0207674_10020844 3300026116 Bacteria 7074
456 Ga0207674_10079222 3300026116 Bacteria 3290
457 Ga0207674_10084698 3300026116 Bacteria 3167
458 Ga0207674_10192364 3300026116 Bacteria 1990
459 Ga0207675_100003521 3300026118 Bacteria 15283
460 Ga0207675_100020709 3300026118 Bacteria 6132
461 Ga0207675_100022252 3300026118 Bacteria 5903
462 Ga0207675_100048083 3300026118 Bacteria 3982
463 Ga0207675_100055083 3300026118 Bacteria 3710
464 Ga0207675_100124453 3300026118 Bacteria 2442
465 Ga0207675_100234511 3300026118 Bacteria 1771
466 Ga0207683_10002163 3300026121 Bacteria 17263
467 Ga0207698_10000539 3300026142 Bacteria 21930
468 Ga0207698_10004422 3300026142 Bacteria 8564
469 Ga0207698_10045981 3300026142 Bacteria 3292
470 Ga0209281_1000115 3300027111 Bacteria 210393
471 Ga0268266_10000068 3300028379 Bacteria 241100
472 Ga0268266_10122070 3300028379 Unclassified 2319
473 Ga0268264_10000559 3300028381 Bacteria 45910
474 Ga0268264_10017234 3300028381 Bacteria 5917
475 Ga0268264_10050501 3300028381 Bacteria 3463
476 Ga0307515_10000001 3300028794 Bacteria 4259510
477 Ga0307515_10000012 3300028794 Bacteria 582232
478 Ga0307515_10001810 3300028794 Bacteria 47689
479 Ga0307515_10002270 3300028794 Bacteria 42110
480 Ga0307515_10156850 3300028794 Bacteria 2344
481 Ga0316177_1089742 3300030731 Bacteria 1721
482 Ga0265327_10000059 3300031251 Bacteria 236935
483 Ga0265327_10000199 3300031251 Bacteria 125838
484 Ga0265327_10032218 3300031251 Bacteria 2936
485 Ga0307513_10043985 3300031456 Bacteria 4897
486 Ga0307408_100000856 3300031548 Bacteria 23954
487 Ga0307408_100013451 3300031548 Bacteria 5431
488 Ga0307405_10000004 3300031731 Bacteria 444977
489 Ga0307405_10100442 3300031731 Bacteria 1939
490 Ga0307413_10000007 3300031824 Bacteria 65102
491 Ga0307413_10017033 3300031824 Bacteria 3775
492 Ga0307413_10019663 3300031824 Bacteria 3575
493 Ga0307410_10000120 3300031852 Bacteria 27455
494 Ga0307410_10007574 3300031852 Bacteria 5955
495 Ga0307406_10000011 3300031901 Bacteria 112730
496 Ga0307406_10144483 3300031901 Bacteria 1689
497 Ga0307407_10009643 3300031903 Bacteria 4507
498 Ga0307412_10004038 3300031911 Bacteria 8178
499 Ga0307416_100001392 3300032002 Bacteria 13100
500 Ga0307416_100016391 3300032002 Bacteria 5150
501 Ga0307416_100065853 3300032002 Unclassified 2980
502 Ga0307414_10000014 3300032004 Bacteria 302974
503 Ga0307414_10007685 3300032004 Bacteria 6072
504 Ga0307414_10008348 3300032004 Bacteria 5866
505 Ga0307411_10000033 3300032005 Bacteria 45514
506 Ga0307411_10029017 3300032005 Bacteria 3373
507 Ga0307415_100003538 3300032126 Bacteria 7968
508 Ga0307415_100004256 3300032126 Bacteria 7401
509 Ga0307510_10102177 3300033180 Bacteria 2650
510 Ga0373934_0080323 3300035086 Bacteria 1310
511 Ga0373946_0070590 3300035171 Bacteria 1508
512 Ga0316574_0234993 3300035398 Bacteria 1172
513 Ga0395900_0003671 3300037418 Bacteria 16502
514 Ga0395900_0065448 3300037418 Bacteria 3734
515 Ga0395898_0201579 3300037466 Bacteria 1900
516 Ga0395905_0006214 3300037471 Bacteria 12056
517 Ga0395905_0199579 3300037471 Bacteria 1875
518 Ga0395901_0074733 3300038443 Bacteria 3535
519 Ga0439436_0000350 3300041404 Bacteria 11404
520 Ga0439439_0011292 3300041406 Bacteria 2148
521 Ga0451837_0682610 3300041494 Bacteria 1922
522 Ga0439457_000130 3300042014 Bacteria 18863
523 Ga0439457_024499 3300042014 Bacteria 1335
524 Ga0450894_003099 3300042131 Bacteria 2193
525 Ga0451577_0148156 3300042876 Unclassified 2111
526 Ga0466969_0000356 3300044656 Bacteria 25182
527 Ga0466972_0000026 3300044658 Bacteria 184739
528 Ga0466972_0000047 3300044658 Bacteria 122901
529 Ga0466972_0001885 3300044658 Bacteria 10291
530 Ga0466966_0000038 3300044684 Bacteria 97255
531 Ga0453684_0001806 3300044712 Bacteria 56712
532 Ga0453684_0021742 3300044712 Bacteria 9564
533 Ga0453684_0118592 3300044712 Bacteria 3200
534 Ga0453684_0431476 3300044712 Bacteria 1470
535 Ga0466968_0016485 3300044735 Bacteria 2943
536 Ga0466968_0072521 3300044735 Bacteria 1501
537 Ga0466968_0075604 3300044735 Unclassified 1473
538 Ga0466970_0000091 3300044765 Bacteria 38259
539 Ga0466957_0000329 3300044842 Bacteria 23093
540 Ga0466957_0000739 3300044842 Bacteria 16704
541 Ga0466959_0000289 3300045049 Bacteria 30468
542 Ga0451576_0000003 3300045051 Bacteria 1550573
543 Ga0495638_0016015 3300046460 Bacteria 5025
544 Ga0495638_0081989 3300046460 Bacteria 1957
545 Ga0495651_0151850 3300046462 Bacteria 1669
546 Ga0495653_0109404 3300046463 Bacteria 1989
547 Ga0495650_0000081 3300046471 Bacteria 240957
548 Ga0495585_0000950 3300046492 Bacteria 24426
549 Ga0495628_0147456 3300046516 Bacteria 1793
550 Ga0495643_0027265 3300046522 Bacteria 3213
551 Ga0495648_0002523 3300046524 Bacteria 16787
552 Ga0495609_0003529 3300046538 Bacteria 8912
553 Ga0495633_0000026 3300046558 Bacteria 204722
554 Ga0495668_0000054 3300046616 Bacteria 203960
555 Ga0495668_0001528 3300046616 Bacteria 21968
556 Ga0495625_0000168 3300046660 Bacteria 102626
557 Ga0495625_0001205 3300046660 Bacteria 32862
558 Ga0495625_0103299 3300046660 Bacteria 1955
559 Ga0495625_0105718 3300046660 Bacteria 1928
560 Ga0495658_0007766 3300046683 Bacteria 5310
561 Ga0495649_0048889 3300046694 Bacteria 2298
562 Ga0495672_0030404 3300047320 Bacteria 3389
563 Ga0495680_0182403 3300047322 Bacteria 1514
564 Ga0495687_000058 3300047443 Bacteria 185830
565 Ga0495686_0150112 3300047472 Bacteria 1369
566 Ga0496106_0056974 3300048909 Bacteria 2955
567 Ga0496111_0125380 3300048914 Bacteria 1898
568 Ga0496114_0038907 3300048917 Unclassified 3936
569 Ga0496116_0000002 3300048919 Bacteria 920291
570 Ga0496116_0025953 3300048919 Bacteria 4295
571 Ga0496121_0143642 3300048924 Bacteria 1767
572 Ga0496125_0000007 3300048928 Bacteria 715355
573 Ga0496126_0046451 3300048929 Bacteria 3982
574 Ga0496126_0312642 3300048929 Bacteria 1293
575 Ga0495682_0016019 3300049460 Bacteria 2837
576 Ga0501032_0011039 3300049569 Bacteria 6493
577 Ga0501032_0142832 3300049569 Bacteria 1576
578 Ga0501034_0072688 3300049571 Bacteria 3448
579 Ga0501036_0046476 3300049572 Bacteria 3676
580 Ga0501037_0091082 3300049573 Bacteria 2205
581 Ga0501038_0047620 3300049574 Bacteria 3713
582 Ga0501040_0022226 3300049576 Bacteria 4244
583 Ga0501043_0002152 3300049579 Bacteria 16797
584 Ga0501043_0016289 3300049579 Bacteria 5829
585 Ga0501043_0127082 3300049579 Unclassified 1999
586 Ga0501046_0041183 3300049580 Bacteria 3687
587 Ga0501046_0051262 3300049580 Bacteria 3257
588 Ga0501047_0032624 3300049581 Bacteria 5028
589 Ga0501047_0037183 3300049581 Bacteria 4707
590 Ga0501047_0073494 3300049581 Bacteria 3292
591 Ga0501047_0218087 3300049581 Bacteria 1764
592 Ga0501048_0029256 3300049582 Bacteria 3997
593 Ga0501067_0075771 3300049583 Bacteria 1864
594 Ga0501068_0034965 3300049584 Bacteria 2999
595 Ga0501070_0072073 3300049586 Bacteria 2860
596 Ga0501072_0065688 3300049588 Unclassified 2861
597 Ga0501074_0021945 3300049590 Bacteria 4636
598 Ga0501202_000230 3300049652 Bacteria 7373
599 Ga0501249_000015 3300049679 Bacteria 124336
600 Ga0501249_000664 3300049679 Bacteria 7877
601 Ga0501219_000020 3300049703 Bacteria 25032
602 Ga0501225_0011909 3300049705 Bacteria 2446
603 Ga0501079_0008887 3300049741 Bacteria 7607
604 Ga0501079_0034323 3300049741 Bacteria 3904
605 Ga0501080_0039205 3300049742 Bacteria 4421
606 Ga0501080_0127762 3300049742 Bacteria 2353
607 Ga0501241_008741 3300049758 Bacteria 1848
608 Ga0501264_000187 3300049761 Bacteria 9940
609 Ga0501035_0023552 3300049822 Bacteria 5649
610 Ga0501044_0005008 3300049823 Bacteria 14790
611 Ga0501044_0028917 3300049823 Bacteria 5846
612 Ga0501044_0041171 3300049823 Bacteria 4810
613 Ga0501044_0069430 3300049823 Bacteria 3587
614 Ga0501284_00030 3300050005 Bacteria 71858
615 nmdc:mga0k408_65980_c1 3300050493 Bacteria 2107
616 nmdc:mga0k408_81_c1 3300050493 Bacteria 45236
617 nmdc:mga0k408_9076_c1 3300050493 Bacteria 5352
618 nmdc:mga05p37_32575_c1 3300050507 Bacteria 6374
619 nmdc:mga09592_998_c1 3300050508 Bacteria 22420
620 nmdc:mga0qj67_14877_c1 3300050509 Bacteria 5886
621 nmdc:mga06r32_26115_c1 3300050510 Bacteria 5441
622 nmdc:mga08y16_72331_c1 3300050511 Bacteria 3593
623 Ga0500578_0000469 3300053086 Bacteria 49263
624 Ga0500578_0137110 3300053086 Bacteria 1531
625 Ga0500647_0087718 3300053091 Bacteria 1491
626 Ga0500583_0000182 3300053092 Bacteria 25516
627 Ga0500583_0000288 3300053092 Bacteria 17461
628 Ga0500583_0072611 3300053092 Bacteria 1648
629 Ga0500641_0002301 3300053096 Bacteria 6777
630 Ga0500641_0018407 3300053096 Bacteria 2627
631 Ga0500650_0050089 3300053098 Bacteria 1939
632 Ga0500562_000005 3300053108 Bacteria 266746
633 Ga0500594_0015338 3300053118 Bacteria 1847
634 Ga0500594_0019407 3300053118 Bacteria 1685
635 Ga0500614_007348 3300053123 Bacteria 2322
636 Ga0500618_000016 3300053125 Bacteria 164049
637 Ga0500652_006537 3300053131 Bacteria 3760
638 Ga0500559_0051831 3300053136 Bacteria 1813
639 Ga0500568_0005771 3300053139 Bacteria 6335
640 Ga0500589_003476 3300053147 Bacteria 5674
641 Ga0500622_0001399 3300053156 Bacteria 19440
642 Ga0500622_0001705 3300053156 Bacteria 17048
643 Ga0500622_0011213 3300053156 Bacteria 4891
644 Ga0500622_0024966 3300053156 Bacteria 3159
645 Ga0500627_0071077 3300053158 Bacteria 1542
646 Ga0500611_000039 3300053727 Bacteria 68825
647 Ga0500645_009542 3300053730 Bacteria 3255
648 Ga0501084_0019472 3300054114 Bacteria 5654
649 Ga0501084_0102931 3300054114 Bacteria 2398

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10115305 Ga0157372_101153052 268
2 3300013297 Ga0157378_10007261 Ga0157378_100072613 271
3 3300005339 Ga0070660_100013028 Ga0070660_1000130285 286
4 3300049573 Ga0501037_0091082 Ga0501037_0091082_1275_2192 287
5 3300005335 Ga0070666_10240820 Ga0070666_102408201 301
6 3300005718 Ga0068866_10028230 Ga0068866_100282302 301
7 3300005842 Ga0068858_100346297 Ga0068858_1003462972 301
8 3300009093 Ga0105240_10049773 Ga0105240_100497731 301
9 3300009545 Ga0105237_10000938 Ga0105237_1000093832 301
10 3300010375 Ga0105239_10006447 Ga0105239_100064475 301
11 3300028381 Ga0268264_10050501 Ga0268264_100505012 301
12 3300005327 Ga0070658_10186103 Ga0070658_101861032 303
13 3300025909 Ga0207705_10203833 Ga0207705_102038331 303
14 3300005343 Ga0070687_100064062 Ga0070687_1000640622 306
15 3300005364 Ga0070673_100039851 Ga0070673_1000398513 306
16 3300005365 Ga0070688_100063656 Ga0070688_1000636562 306
17 3300005466 Ga0070685_10019407 Ga0070685_100194071 306
18 3300005617 Ga0068859_100007242 Ga0068859_1000072427 306
19 3300005618 Ga0068864_100015413 Ga0068864_1000154133 306
20 3300005618 Ga0068864_100172900 Ga0068864_1001729002 306
21 3300005719 Ga0068861_100145425 Ga0068861_1001454253 306
22 3300005842 Ga0068858_100142847 Ga0068858_1001428473 306
23 3300005843 Ga0068860_100031932 Ga0068860_1000319324 306
24 3300006931 Ga0097620_100007242 Ga0097620_1000072427 306
25 3300009101 Ga0105247_10000619 Ga0105247_100006192 306
26 3300025900 Ga0207710_10004843 Ga0207710_100048432 306
27 3300025918 Ga0207662_10114215 Ga0207662_101142152 306
28 3300025960 Ga0207651_10053609 Ga0207651_100536092 306
29 3300025961 Ga0207712_10000725 Ga0207712_100007255 306
30 3300026095 Ga0207676_10017907 Ga0207676_100179073 306
31 3300026116 Ga0207674_10192364 Ga0207674_101923642 306
32 3300005338 Ga0068868_100390529 Ga0068868_1003905291 308
33 3300006195 Ga0075366_10000017 Ga0075366_1000001748 308
34 3300013308 Ga0157375_10176974 Ga0157375_101769742 308
35 3300025925 Ga0207650_10094137 Ga0207650_100941374 308
36 3300050493 nmdc:mga0k408_81_c1 nmdc:mga0k408_81_c1_21230_22351 308
37 3300053091 Ga0500647_0087718 Ga0500647_0087718_85_1110 308
38 3300046660 Ga0495625_0105718 Ga0495625_0105718_481_1602 309
39 3300014326 Ga0157380_10193763 Ga0157380_101937632 310
40 3300014326 Ga0157380_10453299 Ga0157380_104532991 310
41 3300044735 Ga0466968_0075604 Ga0466968_0075604_386_1417 310
42 3300025961 Ga0207712_10000915 Ga0207712_100009158 311
43 3300003322 rootL2_10060108 rootL2_100601086 312
44 3300005548 Ga0070665_100000014 Ga0070665_100000014420 312
45 3300005843 Ga0068860_100000394 Ga0068860_10000039433 312
46 3300025911 Ga0207654_10006725 Ga0207654_100067255 312
47 3300025913 Ga0207695_10001387 Ga0207695_100013879 312
48 3300025914 Ga0207671_10001331 Ga0207671_1000133116 312
49 3300028379 Ga0268266_10000068 Ga0268266_1000006815 312
50 3300028381 Ga0268264_10000559 Ga0268264_1000055924 312
51 3300037418 Ga0395900_0003671 Ga0395900_0003671_9384_10505 313
52 3300044658 Ga0466972_0000026 Ga0466972_0000026_51588_52712 313
53 3300044765 Ga0466970_0000091 Ga0466970_0000091_33310_34434 313
54 3300005329 Ga0070683_100002583 Ga0070683_10000258311 314
55 3300005334 Ga0068869_100018710 Ga0068869_1000187104 314
56 3300005366 Ga0070659_100042015 Ga0070659_1000420152 314
57 3300005455 Ga0070663_100305307 Ga0070663_1003053071 314
58 3300005563 Ga0068855_100006230 Ga0068855_1000062308 314
59 3300009553 Ga0105249_10001117 Ga0105249_1000111711 314
60 3300013100 Ga0157373_10058618 Ga0157373_100586182 314
61 3300025913 Ga0207695_10000212 Ga0207695_10000212121 314
62 3300025942 Ga0207689_10053043 Ga0207689_100530432 314
63 3300025944 Ga0207661_10001812 Ga0207661_1000181211 314
64 3300025949 Ga0207667_10000414 Ga0207667_1000041448 314
65 3300025981 Ga0207640_10328775 Ga0207640_103287751 314
66 3300026118 Ga0207675_100048083 Ga0207675_1000480832 314
67 3300037418 Ga0395900_0065448 Ga0395900_0065448_591_1712 314
68 3300037471 Ga0395905_0199579 Ga0395905_0199579_642_1763 314
69 3300038443 Ga0395901_0074733 Ga0395901_0074733_1776_2897 314
70 3300049581 Ga0501047_0037183 Ga0501047_0037183_2621_3622 314
71 3300049583 Ga0501067_0075771 Ga0501067_0075771_209_1210 314
72 3300049586 Ga0501070_0072073 Ga0501070_0072073_843_1844 314
73 3300049590 Ga0501074_0021945 Ga0501074_0021945_3008_4009 314
74 3300049822 Ga0501035_0023552 Ga0501035_0023552_468_1469 314
75 3300049823 Ga0501044_0028917 Ga0501044_0028917_3345_4346 314
76 3300053125 Ga0500618_000016 Ga0500618_000016_132624_133745 314
77 3300009094 Ga0111539_10390477 Ga0111539_103904771 315
78 3300028794 Ga0307515_10002270 Ga0307515_1000227027 315
79 3300046462 Ga0495651_0151850 Ga0495651_0151850_41_1162 315
80 3300046492 Ga0495585_0000950 Ga0495585_0000950_17791_18912 315
81 3300046538 Ga0495609_0003529 Ga0495609_0003529_5087_6208 315
82 3300046616 Ga0495668_0000054 Ga0495668_0000054_45513_46634 315
83 3300046660 Ga0495625_0001205 Ga0495625_0001205_16958_18079 315
84 3300046683 Ga0495658_0007766 Ga0495658_0007766_3850_4971 315
85 3300049460 Ga0495682_0016019 Ga0495682_0016019_1156_2277 315
86 3300050511 nmdc:mga08y16_72331_c1 nmdc:mga08y16_72331_c1_406_1524 315
87 3300053123 Ga0500614_007348 Ga0500614_007348_510_1631 315
88 3300005331 Ga0070670_100103128 Ga0070670_1001031282 316
89 3300005339 Ga0070660_100024051 Ga0070660_1000240513 316
90 3300005563 Ga0068855_100084962 Ga0068855_1000849622 316
91 3300009093 Ga0105240_10150950 Ga0105240_101509502 316
92 3300025919 Ga0207657_10024210 Ga0207657_100242103 316
93 3300025923 Ga0207681_10093448 Ga0207681_100934482 316
94 3300025926 Ga0207659_10020402 Ga0207659_100204022 316
95 3300025940 Ga0207691_10045858 Ga0207691_100458583 316
96 3300028794 Ga0307515_10001810 Ga0307515_1000181036 316
97 3300046558 Ga0495633_0000026 Ga0495633_0000026_79721_80842 316
98 3300046660 Ga0495625_0000168 Ga0495625_0000168_73839_74960 316
99 3300003322 rootL2_10105470 rootL2_101054703 317
100 3300005330 Ga0070690_100056863 Ga0070690_1000568632 317
101 3300005331 Ga0070670_100040716 Ga0070670_1000407162 317
102 3300005543 Ga0070672_100088937 Ga0070672_1000889372 317
103 3300005577 Ga0068857_100040610 Ga0068857_1000406103 317
104 3300005834 Ga0068851_10046052 Ga0068851_100460523 317
105 3300005834 Ga0068851_10085264 Ga0068851_100852642 317
106 3300006237 Ga0097621_100219561 Ga0097621_1002195612 317
107 3300006881 Ga0068865_100037589 Ga0068865_1000375893 317
108 3300009553 Ga0105249_10079924 Ga0105249_100799242 317
109 3300013297 Ga0157378_10066657 Ga0157378_100666572 317
110 3300013308 Ga0157375_10043524 Ga0157375_100435242 317
111 3300014325 Ga0163163_10545822 Ga0163163_105458222 317
112 3300014969 Ga0157376_10046953 Ga0157376_100469533 317
113 3300025321 Ga0207656_10019824 Ga0207656_100198242 317
114 3300025321 Ga0207656_10045420 Ga0207656_100454202 317
115 3300025920 Ga0207649_10042501 Ga0207649_100425012 317
116 3300025933 Ga0207706_10008919 Ga0207706_100089193 317
117 3300025934 Ga0207686_10003596 Ga0207686_100035966 317
118 3300025936 Ga0207670_10022409 Ga0207670_100224092 317
119 3300025945 Ga0207679_10036462 Ga0207679_100364622 317
120 3300025961 Ga0207712_10101099 Ga0207712_101010992 317
121 3300026023 Ga0207677_10101709 Ga0207677_101017092 317
122 3300026035 Ga0207703_10020625 Ga0207703_100206252 317
123 3300001989 JGI24739J22299_10035425 JGI24739J22299_100354251 318
124 3300013102 Ga0157371_10157541 Ga0157371_101575412 318
125 3300005367 Ga0070667_100049812 Ga0070667_1000498122 319
126 3300026118 Ga0207675_100003521 Ga0207675_1000035214 319
127 3300028794 Ga0307515_10000001 Ga0307515_100000012030 319
128 3300049580 Ga0501046_0041183 Ga0501046_0041183_948_2015 319
129 3300049581 Ga0501047_0073494 Ga0501047_0073494_381_1448 319
130 3300049741 Ga0501079_0008887 Ga0501079_0008887_6515_7582 319
131 3300049742 Ga0501080_0127762 Ga0501080_0127762_466_1533 319
132 3300049823 Ga0501044_0041171 Ga0501044_0041171_2322_3389 319
133 3300053727 Ga0500611_000039 Ga0500611_000039_49965_50981 319
134 3300054114 Ga0501084_0019472 Ga0501084_0019472_2770_3837 319
135 3300005355 Ga0070671_100045530 Ga0070671_1000455302 320
136 3300005539 Ga0068853_100112909 Ga0068853_1001129092 320
137 3300005834 Ga0068851_10006509 Ga0068851_100065092 320
138 3300006358 Ga0068871_100092328 Ga0068871_1000923282 320
139 3300013308 Ga0157375_10127417 Ga0157375_101274172 320
140 3300014968 Ga0157379_10318506 Ga0157379_103185061 320
141 3300026041 Ga0207639_10085621 Ga0207639_100856213 320
142 3300005329 Ga0070683_100014557 Ga0070683_1000145571 321
143 3300005334 Ga0068869_100002467 Ga0068869_1000024673 321
144 3300005335 Ga0070666_10013725 Ga0070666_100137253 321
145 3300005335 Ga0070666_10091233 Ga0070666_100912332 321
146 3300005338 Ga0068868_100071496 Ga0068868_1000714962 321
147 3300005340 Ga0070689_100029970 Ga0070689_1000299701 321
148 3300005344 Ga0070661_100023047 Ga0070661_1000230472 321
149 3300005344 Ga0070661_100201233 Ga0070661_1002012331 321
150 3300005364 Ga0070673_100065303 Ga0070673_1000653032 321
151 3300005365 Ga0070688_100008316 Ga0070688_1000083164 321
152 3300005365 Ga0070688_100013987 Ga0070688_1000139873 321
153 3300005367 Ga0070667_100031584 Ga0070667_1000315842 321
154 3300005367 Ga0070667_100065563 Ga0070667_1000655633 321
155 3300005457 Ga0070662_100005807 Ga0070662_1000058075 321
156 3300005535 Ga0070684_100010934 Ga0070684_1000109345 321
157 3300005535 Ga0070684_100233094 Ga0070684_1002330941 321
158 3300005539 Ga0068853_100058967 Ga0068853_1000589673 321
159 3300005564 Ga0070664_100075864 Ga0070664_1000758643 321
160 3300005616 Ga0068852_100153054 Ga0068852_1001530542 321
161 3300005618 Ga0068864_100034999 Ga0068864_1000349992 321
162 3300005618 Ga0068864_100039686 Ga0068864_1000396862 321
163 3300005841 Ga0068863_100022535 Ga0068863_1000225352 321
164 3300005842 Ga0068858_100070745 Ga0068858_1000707452 321
165 3300006881 Ga0068865_100115717 Ga0068865_1001157172 321
166 3300009177 Ga0105248_10510547 Ga0105248_105105472 321
167 3300009553 Ga0105249_10017168 Ga0105249_100171686 321
168 3300013296 Ga0157374_10197668 Ga0157374_101976682 321
169 3300013306 Ga0163162_10126262 Ga0163162_101262622 321
170 3300014968 Ga0157379_10016392 Ga0157379_100163926 321
171 3300017792 Ga0163161_10124095 Ga0163161_101240952 321
172 3300025905 Ga0207685_10066048 Ga0207685_100660481 321
173 3300025920 Ga0207649_10169274 Ga0207649_101692742 321
174 3300025926 Ga0207659_10088658 Ga0207659_100886582 321
175 3300025940 Ga0207691_10030881 Ga0207691_100308812 321
176 3300025942 Ga0207689_10002750 Ga0207689_100027505 321
177 3300025942 Ga0207689_10023984 Ga0207689_100239841 321
178 3300025986 Ga0207658_10135087 Ga0207658_101350872 321
179 3300026088 Ga0207641_10002004 Ga0207641_1000200416 321
180 3300026089 Ga0207648_10022209 Ga0207648_100222092 321
181 3300026095 Ga0207676_10365803 Ga0207676_103658031 321
182 3300026116 Ga0207674_10020844 Ga0207674_100208445 321
183 3300047472 Ga0495686_0150112 Ga0495686_0150112_69_1094 321
184 3300053730 Ga0500645_009542 Ga0500645_009542_603_1628 321
185 iso_pu_bacteria 2818991444 2819589804 321
186 iso_pu_bacteria 2914759650 2914762346 321
187 3300003322 rootL2_10213233 rootL2_102132331 322
188 3300005288 Ga0065714_10083948 Ga0065714_100839482 322
189 3300005290 Ga0065712_10115534 Ga0065712_101155342 322
190 3300005544 Ga0070686_100095597 Ga0070686_1000955972 322
191 3300005617 Ga0068859_100085924 Ga0068859_1000859242 322
192 3300005841 Ga0068863_100123674 Ga0068863_1001236741 322
193 3300006237 Ga0097621_100019163 Ga0097621_1000191632 322
194 3300006931 Ga0097620_100085931 Ga0097620_1000859313 322
195 3300009553 Ga0105249_10220478 Ga0105249_102204782 322
196 3300025908 Ga0207643_10187738 Ga0207643_101877381 322
197 3300025942 Ga0207689_10078622 Ga0207689_100786222 322
198 3300025960 Ga0207651_10009976 Ga0207651_100099762 322
199 3300026075 Ga0207708_10353361 Ga0207708_103533611 322
200 3300026088 Ga0207641_10158141 Ga0207641_101581412 322
201 3300026095 Ga0207676_10021806 Ga0207676_100218062 322
202 3300047320 Ga0495672_0030404 Ga0495672_0030404_1172_2224 322
203 iso_pu_bacteria 2721755487 2722726059 322
204 iso_pu_bacteria 2904780799 2904782676 322
205 iso_pu_bacteria 2919177583 2919180286 322
206 3300003322 rootL2_10283016 rootL2_102830161 323
207 3300003323 rootH1_10129548 rootH1_101295482 323
208 3300005295 Ga0065707_10120143 Ga0065707_101201431 323
209 3300005327 Ga0070658_10204591 Ga0070658_102045912 323
210 3300005337 Ga0070682_100000121 Ga0070682_10000012154 323
211 3300005539 Ga0068853_100214820 Ga0068853_1002148202 323
212 3300013100 Ga0157373_10021611 Ga0157373_100216113 323
213 3300044712 Ga0453684_0431476 Ga0453684_0431476_15_1097 323
214 3300049705 Ga0501225_0011909 Ga0501225_0011909_680_1711 323
215 iso_pu_bacteria 2887375801 2887378098 323
216 3300002459 JGI24751J29686_10000655 JGI24751J29686_100006554 324
217 3300005331 Ga0070670_100040014 Ga0070670_1000400143 324
218 3300005539 Ga0068853_100044698 Ga0068853_1000446983 324
219 3300005719 Ga0068861_100012731 Ga0068861_1000127314 324
220 3300009174 Ga0105241_10092250 Ga0105241_100922502 324
221 3300009545 Ga0105237_10008039 Ga0105237_100080392 324
222 3300009553 Ga0105249_10001306 Ga0105249_100013065 324
223 3300010375 Ga0105239_10006468 Ga0105239_100064687 324
224 3300025921 Ga0207652_10011840 Ga0207652_100118404 324
225 3300025961 Ga0207712_10001923 Ga0207712_100019236 324
226 3300026118 Ga0207675_100022252 Ga0207675_1000222524 324
227 3300026142 Ga0207698_10045981 Ga0207698_100459813 324
228 3300030731 Ga0316177_1089742 Ga0316177_10897422 324
229 3300042131 Ga0450894_003099 Ga0450894_003099_346_1467 324
230 3300049579 Ga0501043_0127082 Ga0501043_0127082_248_1279 324
231 3300053108 Ga0500562_000005 Ga0500562_000005_201275_202384 324
232 3300053156 Ga0500622_0001705 Ga0500622_0001705_14271_15380 324
233 iso_pu_bacteria 2929154850 2929160006 324
234 3300005337 Ga0070682_100096896 Ga0070682_1000968962 325
235 3300005353 Ga0070669_100224026 Ga0070669_1002240262 325
236 3300005459 Ga0068867_100304831 Ga0068867_1003048311 325
237 3300005719 Ga0068861_100021936 Ga0068861_1000219364 325
238 3300006358 Ga0068871_100355306 Ga0068871_1003553062 325
239 3300006846 Ga0075430_100000960 Ga0075430_1000009605 325
240 3300006847 Ga0075431_100063071 Ga0075431_1000630712 325
241 3300009545 Ga0105237_10034602 Ga0105237_100346022 325
242 3300013104 Ga0157370_10013171 Ga0157370_100131712 325
243 3300013297 Ga0157378_10061615 Ga0157378_100616154 325
244 3300025903 Ga0207680_10043718 Ga0207680_100437182 325
245 3300025914 Ga0207671_10022086 Ga0207671_100220862 325
246 3300025961 Ga0207712_10016389 Ga0207712_100163891 325
247 3300026118 Ga0207675_100124453 Ga0207675_1001244531 325
248 3300031548 Ga0307408_100000856 Ga0307408_1000008562 325
249 3300031824 Ga0307413_10017033 Ga0307413_100170332 325
250 3300031852 Ga0307410_10000120 Ga0307410_1000012029 325
251 3300031901 Ga0307406_10000011 Ga0307406_1000001118 325
252 3300031903 Ga0307407_10009643 Ga0307407_100096431 325
253 3300032004 Ga0307414_10000014 Ga0307414_10000014158 325
254 3300032005 Ga0307411_10029017 Ga0307411_100290172 325
255 3300049569 Ga0501032_0011039 Ga0501032_0011039_1166_2275 325
256 3300049572 Ga0501036_0046476 Ga0501036_0046476_531_1640 325
257 3300049574 Ga0501038_0047620 Ga0501038_0047620_1725_2834 325
258 3300049579 Ga0501043_0002152 Ga0501043_0002152_5808_6920 325
259 3300049579 Ga0501043_0016289 Ga0501043_0016289_665_1774 325
260 3300049580 Ga0501046_0051262 Ga0501046_0051262_209_1318 325
261 3300049581 Ga0501047_0218087 Ga0501047_0218087_474_1586 325
262 3300049582 Ga0501048_0029256 Ga0501048_0029256_1871_2980 325
263 3300049584 Ga0501068_0034965 Ga0501068_0034965_1321_2430 325
264 3300049588 Ga0501072_0065688 Ga0501072_0065688_986_2179 325
265 3300049741 Ga0501079_0034323 Ga0501079_0034323_515_1624 325
266 3300049742 Ga0501080_0039205 Ga0501080_0039205_820_1929 325
267 3300049758 Ga0501241_008741 Ga0501241_008741_565_1746 325
268 3300050509 nmdc:mga0qj67_14877_c1 nmdc:mga0qj67_14877_c1_4557_5591 325
269 3300050510 nmdc:mga06r32_26115_c1 nmdc:mga06r32_26115_c1_105_1139 325
270 3300054114 Ga0501084_0102931 Ga0501084_0102931_647_1756 325
271 2162886007 SwRhRL2b_contig_2641798 SwRhRL2b_0475.00003030 326
272 3300003320 rootH2_10022930 rootH2_1002293020 326
273 3300005289 Ga0065704_10072160 Ga0065704_100721603 326
274 3300005563 Ga0068855_100057963 Ga0068855_1000579633 326
275 3300005577 Ga0068857_100002762 Ga0068857_10000276211 326
276 3300005578 Ga0068854_100050338 Ga0068854_1000503384 326
277 3300005614 Ga0068856_100140724 Ga0068856_1001407242 326
278 3300005616 Ga0068852_100005237 Ga0068852_1000052376 326
279 3300005983 Ga0081540_1004387 Ga0081540_10043875 326
280 3300006195 Ga0075366_10001639 Ga0075366_100016394 326
281 3300006195 Ga0075366_10064609 Ga0075366_100646092 326
282 3300009093 Ga0105240_10020065 Ga0105240_100200656 326
283 3300009093 Ga0105240_10184558 Ga0105240_101845581 326
284 3300009148 Ga0105243_10000009 Ga0105243_1000000984 326
285 3300009174 Ga0105241_10002136 Ga0105241_100021369 326
286 3300009545 Ga0105237_10006188 Ga0105237_100061885 326
287 3300009551 Ga0105238_10004065 Ga0105238_100040656 326
288 3300009551 Ga0105238_10023581 Ga0105238_100235813 326
289 3300009551 Ga0105238_10139933 Ga0105238_101399331 326
290 3300010375 Ga0105239_10013262 Ga0105239_100132625 326
291 3300013104 Ga0157370_10010610 Ga0157370_100106104 326
292 3300013105 Ga0157369_10058404 Ga0157369_100584041 326
293 3300013306 Ga0163162_10007147 Ga0163162_100071478 326
294 3300013307 Ga0157372_10001585 Ga0157372_1000158515 326
295 3300013307 Ga0157372_10034739 Ga0157372_100347394 326
296 3300013307 Ga0157372_10293439 Ga0157372_102934392 326
297 3300025924 Ga0207694_10078063 Ga0207694_100780633 326
298 3300025932 Ga0207690_10267819 Ga0207690_102678192 326
299 3300025949 Ga0207667_10006924 Ga0207667_1000692411 326
300 3300025981 Ga0207640_10053742 Ga0207640_100537422 326
301 3300026078 Ga0207702_10289456 Ga0207702_102894562 326
302 3300026142 Ga0207698_10000539 Ga0207698_1000053914 326
303 3300031251 Ga0265327_10000199 Ga0265327_100001995 326
304 3300042876 Ga0451577_0148156 Ga0451577_0148156_460_1581 326
305 3300044658 Ga0466972_0001885 Ga0466972_0001885_244_1365 326
306 3300044735 Ga0466968_0072521 Ga0466968_0072521_267_1388 326
307 3300046460 Ga0495638_0016015 Ga0495638_0016015_2906_4027 326
308 3300046460 Ga0495638_0081989 Ga0495638_0081989_301_1413 326
309 3300046524 Ga0495648_0002523 Ga0495648_0002523_1963_3084 326
310 3300046660 Ga0495625_0103299 Ga0495625_0103299_690_1811 326
311 3300047443 Ga0495687_000058 Ga0495687_000058_64541_65662 326
312 3300048919 Ga0496116_0025953 Ga0496116_0025953_542_1582 326
313 3300048929 Ga0496126_0312642 Ga0496126_0312642_113_1153 326
314 3300053096 Ga0500641_0018407 Ga0500641_0018407_378_1415 326
315 3300053139 Ga0500568_0005771 Ga0500568_0005771_4285_5406 326
316 3300053156 Ga0500622_0001399 Ga0500622_0001399_3137_4258 326
317 3300053156 Ga0500622_0011213 Ga0500622_0011213_3099_4139 326
318 3300005327 Ga0070658_10227206 Ga0070658_102272062 327
319 3300005617 Ga0068859_100000620 Ga0068859_10000062018 327
320 3300006931 Ga0097620_100000620 Ga0097620_10000062018 327
321 3300009545 Ga0105237_10000191 Ga0105237_1000019119 327
322 3300025908 Ga0207643_10053248 Ga0207643_100532482 327
323 3300025914 Ga0207671_10001357 Ga0207671_1000135712 327
324 3300032004 Ga0307414_10008348 Ga0307414_100083486 327
325 3300046522 Ga0495643_0027265 Ga0495643_0027265_826_1989 327
326 3300002737 JGI25162J39368_1000258 JGI25162J39368_100025831 328
327 3300003323 rootH1_10190552 rootH1_101905523 328
328 3300003354 JGI25160J50197_1002148 JGI25160J50197_10021483 328
329 3300005327 Ga0070658_10011999 Ga0070658_100119992 328
330 3300005329 Ga0070683_100003463 Ga0070683_1000034638 328
331 3300005330 Ga0070690_100017866 Ga0070690_1000178662 328
332 3300005330 Ga0070690_100047972 Ga0070690_1000479722 328
333 3300005331 Ga0070670_100048124 Ga0070670_1000481244 328
334 3300005335 Ga0070666_10018557 Ga0070666_100185575 328
335 3300005335 Ga0070666_10065281 Ga0070666_100652812 328
336 3300005338 Ga0068868_100003164 Ga0068868_1000031643 328
337 3300005338 Ga0068868_100037742 Ga0068868_1000377424 328
338 3300005339 Ga0070660_100101803 Ga0070660_1001018032 328
339 3300005340 Ga0070689_100066581 Ga0070689_1000665811 328
340 3300005344 Ga0070661_100000111 Ga0070661_10000011147 328
341 3300005344 Ga0070661_100024199 Ga0070661_1000241992 328
342 3300005355 Ga0070671_100001071 Ga0070671_1000010718 328
343 3300005364 Ga0070673_100051667 Ga0070673_1000516671 328
344 3300005366 Ga0070659_100004992 Ga0070659_1000049924 328
345 3300005367 Ga0070667_100006052 Ga0070667_1000060526 328
346 3300005457 Ga0070662_100007166 Ga0070662_1000071666 328
347 3300005459 Ga0068867_100039839 Ga0068867_1000398391 328
348 3300005530 Ga0070679_100157899 Ga0070679_1001578992 328
349 3300005535 Ga0070684_100000105 Ga0070684_10000010513 328
350 3300005535 Ga0070684_100042770 Ga0070684_1000427704 328
351 3300005539 Ga0068853_100003177 Ga0068853_1000031775 328
352 3300005539 Ga0068853_100317114 Ga0068853_1003171141 328
353 3300005563 Ga0068855_100023086 Ga0068855_1000230869 328
354 3300005563 Ga0068855_100095453 Ga0068855_1000954532 328
355 3300005563 Ga0068855_100117596 Ga0068855_1001175962 328
356 3300005564 Ga0070664_100000838 Ga0070664_1000008383 328
357 3300005564 Ga0070664_100035238 Ga0070664_1000352385 328
358 3300005564 Ga0070664_100197599 Ga0070664_1001975992 328
359 3300005577 Ga0068857_100005990 Ga0068857_1000059904 328
360 3300005577 Ga0068857_100062804 Ga0068857_1000628042 328
361 3300005578 Ga0068854_100057303 Ga0068854_1000573034 328
362 3300005614 Ga0068856_100030372 Ga0068856_1000303722 328
363 3300005834 Ga0068851_10052377 Ga0068851_100523772 328
364 3300005843 Ga0068860_100394524 Ga0068860_1003945241 328
365 3300005985 Ga0081539_10000714 Ga0081539_1000071421 328
366 3300006237 Ga0097621_100000359 Ga0097621_10000035920 328
367 3300006237 Ga0097621_100048701 Ga0097621_1000487012 328
368 3300006358 Ga0068871_100001167 Ga0068871_1000011676 328
369 3300006358 Ga0068871_100005004 Ga0068871_1000050046 328
370 3300006844 Ga0075428_100013338 Ga0075428_1000133384 328
371 3300006844 Ga0075428_100313052 Ga0075428_1003130522 328
372 3300006880 Ga0075429_100000723 Ga0075429_1000007237 328
373 3300009093 Ga0105240_10008191 Ga0105240_1000819110 328
374 3300009174 Ga0105241_10186770 Ga0105241_101867702 328
375 3300009176 Ga0105242_10041383 Ga0105242_100413832 328
376 3300009176 Ga0105242_10053818 Ga0105242_100538182 328
377 3300009176 Ga0105242_10498683 Ga0105242_104986831 328
378 3300009177 Ga0105248_10033685 Ga0105248_100336855 328
379 3300009545 Ga0105237_10012420 Ga0105237_100124206 328
380 3300009545 Ga0105237_10128039 Ga0105237_101280392 328
381 3300010375 Ga0105239_10018690 Ga0105239_100186902 328
382 3300011119 Ga0105246_10085720 Ga0105246_100857202 328
383 3300011119 Ga0105246_10165860 Ga0105246_101658602 328
384 3300013100 Ga0157373_10005562 Ga0157373_100055624 328
385 3300013102 Ga0157371_10010327 Ga0157371_100103276 328
386 3300013105 Ga0157369_10006913 Ga0157369_100069136 328
387 3300013296 Ga0157374_10000011 Ga0157374_10000011118 328
388 3300013296 Ga0157374_10004430 Ga0157374_100044308 328
389 3300013296 Ga0157374_10009692 Ga0157374_100096924 328
390 3300013296 Ga0157374_10289602 Ga0157374_102896021 328
391 3300013296 Ga0157374_10548456 Ga0157374_105484562 328
392 3300013297 Ga0157378_10269177 Ga0157378_102691772 328
393 3300013306 Ga0163162_10001000 Ga0163162_1000100021 328
394 3300013306 Ga0163162_10103635 Ga0163162_101036353 328
395 3300013306 Ga0163162_10194665 Ga0163162_101946652 328
396 3300013307 Ga0157372_10012413 Ga0157372_100124135 328
397 3300013307 Ga0157372_10077080 Ga0157372_100770804 328
398 3300013308 Ga0157375_10002200 Ga0157375_100022005 328
399 3300013308 Ga0157375_10160772 Ga0157375_101607721 328
400 3300013308 Ga0157375_10415969 Ga0157375_104159692 328
401 3300014325 Ga0163163_10000831 Ga0163163_1000083112 328
402 3300014326 Ga0157380_10211019 Ga0157380_102110192 328
403 3300014968 Ga0157379_10010412 Ga0157379_100104122 328
404 3300014968 Ga0157379_10199582 Ga0157379_101995822 328
405 3300014969 Ga0157376_10002924 Ga0157376_100029246 328
406 3300014969 Ga0157376_10079127 Ga0157376_100791272 328
407 3300014969 Ga0157376_10158982 Ga0157376_101589822 328
408 3300017792 Ga0163161_10003336 Ga0163161_100033366 328
409 3300017792 Ga0163161_10051257 Ga0163161_100512572 328
410 3300025302 Ga0207426_1000059 Ga0207426_1000059114 328
411 3300025903 Ga0207680_10055071 Ga0207680_100550712 328
412 3300025914 Ga0207671_10001792 Ga0207671_1000179216 328
413 3300025914 Ga0207671_10023899 Ga0207671_100238993 328
414 3300025914 Ga0207671_10057849 Ga0207671_100578492 328
415 3300025919 Ga0207657_10005058 Ga0207657_100050584 328
416 3300025920 Ga0207649_10000517 Ga0207649_100005178 328
417 3300025921 Ga0207652_10216432 Ga0207652_102164322 328
418 3300025931 Ga0207644_10014077 Ga0207644_100140772 328
419 3300025933 Ga0207706_10001896 Ga0207706_1000189614 328
420 3300025938 Ga0207704_10064983 Ga0207704_100649832 328
421 3300025944 Ga0207661_10010041 Ga0207661_100100412 328
422 3300025944 Ga0207661_10284543 Ga0207661_102845432 328
423 3300025945 Ga0207679_10000091 Ga0207679_1000009137 328
424 3300025949 Ga0207667_10022188 Ga0207667_100221885 328
425 3300025949 Ga0207667_10045879 Ga0207667_100458795 328
426 3300025960 Ga0207651_10033617 Ga0207651_100336171 328
427 3300025960 Ga0207651_10063786 Ga0207651_100637862 328
428 3300025986 Ga0207658_10086364 Ga0207658_100863642 328
429 3300026041 Ga0207639_10004779 Ga0207639_100047796 328
430 3300026067 Ga0207678_10050208 Ga0207678_100502081 328
431 3300026078 Ga0207702_10011662 Ga0207702_100116626 328
432 3300026088 Ga0207641_10090078 Ga0207641_100900782 328
433 3300026089 Ga0207648_10272762 Ga0207648_102727622 328
434 3300026095 Ga0207676_10137961 Ga0207676_101379612 328
435 3300026116 Ga0207674_10006954 Ga0207674_1000695411 328
436 3300026116 Ga0207674_10079222 Ga0207674_100792224 328
437 3300026118 Ga0207675_100055083 Ga0207675_1000550833 328
438 3300031251 Ga0265327_10000059 Ga0265327_10000059156 328
439 3300035086 Ga0373934_0080323 Ga0373934_0080323_30_1163 328
440 3300035171 Ga0373946_0070590 Ga0373946_0070590_227_1270 328
441 3300044712 Ga0453684_0001806 Ga0453684_0001806_23030_24157 328
442 3300044712 Ga0453684_0021742 Ga0453684_0021742_2419_3549 328
443 3300046463 Ga0495653_0109404 Ga0495653_0109404_17_1150 328
444 3300046471 Ga0495650_0000081 Ga0495650_0000081_134986_136191 328
445 3300046516 Ga0495628_0147456 Ga0495628_0147456_336_1469 328
446 3300046694 Ga0495649_0048889 Ga0495649_0048889_551_1678 328
447 3300048909 Ga0496106_0056974 Ga0496106_0056974_427_1551 328
448 3300048914 Ga0496111_0125380 Ga0496111_0125380_678_1811 328
449 3300048917 Ga0496114_0038907 Ga0496114_0038907_491_1615 328
450 3300050508 nmdc:mga09592_998_c1 nmdc:mga09592_998_c1_16960_18078 328
451 iso_pu_bacteria 2911138879 2911141341 328
452 iso_pu_bacteria 2919437846 2919440304 328
453 3300002738 JGI25154J39366_1000006 JGI25154J39366_1000006153 329
454 3300003215 JGI25153J46596_10000485 JGI25153J46596_100004853 329
455 3300003320 rootH2_10081840 rootH2_100818401 329
456 3300003322 rootL2_10050502 rootL2_100505021 329
457 3300003323 rootH1_10060702 rootH1_100607024 329
458 3300005328 Ga0070676_10061023 Ga0070676_100610232 329
459 3300005458 Ga0070681_10035895 Ga0070681_100358953 329
460 3300005459 Ga0068867_100052616 Ga0068867_1000526162 329
461 3300005563 Ga0068855_100026647 Ga0068855_1000266473 329
462 3300005614 Ga0068856_100199924 Ga0068856_1001999242 329
463 3300005618 Ga0068864_100086279 Ga0068864_1000862792 329
464 3300005718 Ga0068866_10005900 Ga0068866_100059003 329
465 3300005843 Ga0068860_100014820 Ga0068860_1000148206 329
466 3300006195 Ga0075366_10014674 Ga0075366_100146743 329
467 3300006881 Ga0068865_100095899 Ga0068865_1000958992 329
468 3300009093 Ga0105240_10025004 Ga0105240_100250045 329
469 3300009147 Ga0114129_10041957 Ga0114129_100419573 329
470 3300009174 Ga0105241_10019869 Ga0105241_100198694 329
471 3300009545 Ga0105237_10008044 Ga0105237_100080442 329
472 3300010375 Ga0105239_10003738 Ga0105239_100037382 329
473 3300013100 Ga0157373_10091764 Ga0157373_100917643 329
474 3300013307 Ga0157372_10022925 Ga0157372_100229253 329
475 3300013307 Ga0157372_10083286 Ga0157372_100832862 329
476 3300014745 Ga0157377_10116447 Ga0157377_101164471 329
477 3300014969 Ga0157376_10000938 Ga0157376_100009386 329
478 3300015265 Ga0182005_1000017 Ga0182005_100001793 329
479 3300017792 Ga0163161_10020278 Ga0163161_100202783 329
480 3300025208 Ga0209436_100091 Ga0209436_1000916 329
481 3300025246 Ga0209646_1000031 Ga0209646_1000031184 329
482 3300025250 Ga0209026_1000019 Ga0209026_1000019184 329
483 3300025284 Ga0209130_1000333 Ga0209130_100033328 329
484 3300025297 Ga0209758_1001097 Ga0209758_10010978 329
485 3300025302 Ga0207426_1000024 Ga0207426_1000024357 329
486 3300025302 Ga0207426_1000691 Ga0207426_100069113 329
487 3300025912 Ga0207707_10045387 Ga0207707_100453873 329
488 3300025913 Ga0207695_10057600 Ga0207695_100576002 329
489 3300025937 Ga0207669_10140389 Ga0207669_101403891 329
490 3300025949 Ga0207667_10008497 Ga0207667_100084977 329
491 3300026041 Ga0207639_10092413 Ga0207639_100924132 329
492 3300026078 Ga0207702_10174712 Ga0207702_101747122 329
493 3300026089 Ga0207648_10001507 Ga0207648_1000150723 329
494 3300026116 Ga0207674_10084698 Ga0207674_100846983 329
495 3300026118 Ga0207675_100234511 Ga0207675_1002345112 329
496 3300028381 Ga0268264_10017234 Ga0268264_100172343 329
497 3300037471 Ga0395905_0006214 Ga0395905_0006214_8464_9660 329
498 3300044656 Ga0466969_0000356 Ga0466969_0000356_8784_9905 329
499 3300044658 Ga0466972_0000047 Ga0466972_0000047_6757_7878 329
500 3300044684 Ga0466966_0000038 Ga0466966_0000038_63203_64324 329
501 3300044712 Ga0453684_0118592 Ga0453684_0118592_1868_2914 329
502 3300044735 Ga0466968_0016485 Ga0466968_0016485_306_1427 329
503 3300044842 Ga0466957_0000329 Ga0466957_0000329_19070_20191 329
504 3300044842 Ga0466957_0000739 Ga0466957_0000739_309_1430 329
505 3300045049 Ga0466959_0000289 Ga0466959_0000289_20994_22115 329
506 3300046616 Ga0495668_0001528 Ga0495668_0001528_2782_3903 329
507 3300049569 Ga0501032_0142832 Ga0501032_0142832_339_1466 329
508 3300049571 Ga0501034_0072688 Ga0501034_0072688_102_1226 329
509 3300049581 Ga0501047_0032624 Ga0501047_0032624_3011_4132 329
510 3300049823 Ga0501044_0005008 Ga0501044_0005008_1314_2435 329
511 3300049823 Ga0501044_0069430 Ga0501044_0069430_2398_3525 329
512 3300050493 nmdc:mga0k408_9076_c1 nmdc:mga0k408_9076_c1_1840_2961 329
513 3300050507 nmdc:mga05p37_32575_c1 nmdc:mga05p37_32575_c1_3001_4122 329
514 3300053086 Ga0500578_0137110 Ga0500578_0137110_318_1439 329
515 3300053136 Ga0500559_0051831 Ga0500559_0051831_44_1165 329
516 iso_pu_bacteria 2818991442 2819575196 329
517 iso_pu_bacteria 2818991460 2819677179 329
518 iso_pu_bacteria 2840677318 2840679022 329
519 iso_pu_bacteria 2883068021 2883070301 329
520 iso_pu_bacteria 2896085136 2896086835 329
521 iso_pu_bacteria 2896109856 2896112821 329
522 iso_pu_bacteria 8003151029 8003152055 329
523 3300001979 JGI24740J21852_10014041 JGI24740J21852_100140413 330
524 3300003320 rootH2_10085143 rootH2_100851433 330
525 3300003322 rootL2_10192099 rootL2_101920991 330
526 3300003323 rootH1_10046997 rootH1_1004699715 330
527 3300003323 rootH1_10205811 rootH1_102058115 330
528 3300005366 Ga0070659_100003782 Ga0070659_1000037822 330
529 3300005367 Ga0070667_100037265 Ga0070667_1000372652 330
530 3300005367 Ga0070667_100098839 Ga0070667_1000988392 330
531 3300005616 Ga0068852_100000460 Ga0068852_10000046011 330
532 3300005841 Ga0068863_100071975 Ga0068863_1000719752 330
533 3300009176 Ga0105242_10031774 Ga0105242_100317742 330
534 3300009553 Ga0105249_10028284 Ga0105249_100282842 330
535 3300013102 Ga0157371_10010282 Ga0157371_100102823 330
536 3300013104 Ga0157370_10204091 Ga0157370_102040912 330
537 3300013307 Ga0157372_10154852 Ga0157372_101548523 330
538 3300025904 Ga0207647_10000096 Ga0207647_1000009632 330
539 3300025914 Ga0207671_10040837 Ga0207671_100408371 330
540 3300025986 Ga0207658_10025912 Ga0207658_100259122 330
541 3300025986 Ga0207658_10026833 Ga0207658_100268333 330
542 3300026088 Ga0207641_10084252 Ga0207641_100842523 330
543 3300026142 Ga0207698_10004422 Ga0207698_100044222 330
544 3300031251 Ga0265327_10032218 Ga0265327_100322182 330
545 3300031456 Ga0307513_10043985 Ga0307513_100439853 330
546 3300041404 Ga0439436_0000350 Ga0439436_0000350_3369_4493 330
547 3300041406 Ga0439439_0011292 Ga0439439_0011292_553_1677 330
548 3300042014 Ga0439457_000130 Ga0439457_000130_8593_9717 330
549 3300047322 Ga0495680_0182403 Ga0495680_0182403_54_1253 330
550 3300050493 nmdc:mga0k408_65980_c1 nmdc:mga0k408_65980_c1_381_1505 330
551 3300053086 Ga0500578_0000469 Ga0500578_0000469_6829_7953 330
552 3300053092 Ga0500583_0000182 Ga0500583_0000182_3008_4132 330
553 3300053092 Ga0500583_0000288 Ga0500583_0000288_1360_2484 330
554 3300053098 Ga0500650_0050089 Ga0500650_0050089_712_1836 330
555 3300053131 Ga0500652_006537 Ga0500652_006537_792_1919 330
556 3300053147 Ga0500589_003476 Ga0500589_003476_1898_3022 330
557 iso_pu_bacteria 2522125168 2522552008 330
558 iso_pu_bacteria 2738541278 2738725860 330
559 iso_pu_bacteria 2739367866 2740031932 330
560 iso_pu_bacteria 2890737413 2890738498 330
561 iso_pu_bacteria 2929177148 2929177415 330
562 iso_pu_bacteria 2945977869 2945979782 330
563 iso_pu_bacteria 2946013367 2946014351 330
564 3300003316 rootH1_10037394 rootH1_100373942 331
565 3300005328 Ga0070676_10017971 Ga0070676_100179712 331
566 3300005338 Ga0068868_100017935 Ga0068868_1000179352 331
567 3300005347 Ga0070668_100048430 Ga0070668_1000484301 331
568 3300005353 Ga0070669_100059867 Ga0070669_1000598672 331
569 3300005364 Ga0070673_100006098 Ga0070673_1000060986 331
570 3300005367 Ga0070667_100059798 Ga0070667_1000597982 331
571 3300005459 Ga0068867_100016665 Ga0068867_1000166654 331
572 3300005466 Ga0070685_10016650 Ga0070685_100166502 331
573 3300005543 Ga0070672_100050493 Ga0070672_1000504933 331
574 3300005548 Ga0070665_100005140 Ga0070665_1000051408 331
575 3300005577 Ga0068857_100187210 Ga0068857_1001872101 331
576 3300006237 Ga0097621_100005579 Ga0097621_1000055795 331
577 3300006847 Ga0075431_100003991 Ga0075431_1000039913 331
578 3300006881 Ga0068865_100012266 Ga0068865_1000122662 331
579 3300009094 Ga0111539_10030151 Ga0111539_100301513 331
580 3300009147 Ga0114129_10120630 Ga0114129_101206302 331
581 3300014326 Ga0157380_10006038 Ga0157380_100060383 331
582 3300014326 Ga0157380_10137672 Ga0157380_101376722 331
583 3300025907 Ga0207645_10002123 Ga0207645_1000212310 331
584 3300025923 Ga0207681_10020339 Ga0207681_100203393 331
585 3300025942 Ga0207689_10002065 Ga0207689_100020657 331
586 3300025960 Ga0207651_10024166 Ga0207651_100241662 331
587 3300025972 Ga0207668_10136275 Ga0207668_101362752 331
588 3300026089 Ga0207648_10001340 Ga0207648_100013407 331
589 3300026118 Ga0207675_100020709 Ga0207675_1000207094 331
590 3300026121 Ga0207683_10002163 Ga0207683_1000216311 331
591 3300028379 Ga0268266_10122070 Ga0268266_101220701 331
592 3300028794 Ga0307515_10000012 Ga0307515_10000012338 331
593 3300028794 Ga0307515_10156850 Ga0307515_101568502 331
594 3300031548 Ga0307408_100013451 Ga0307408_1000134514 331
595 3300031731 Ga0307405_10000004 Ga0307405_10000004166 331
596 3300031731 Ga0307405_10100442 Ga0307405_101004421 331
597 3300031852 Ga0307410_10007574 Ga0307410_100075744 331
598 3300031911 Ga0307412_10004038 Ga0307412_100040387 331
599 3300032002 Ga0307416_100016391 Ga0307416_1000163915 331
600 3300032002 Ga0307416_100065853 Ga0307416_1000658532 331
601 3300032126 Ga0307415_100003538 Ga0307415_1000035386 331
602 3300032126 Ga0307415_100004256 Ga0307415_1000042564 331
603 3300037466 Ga0395898_0201579 Ga0395898_0201579_143_1198 331
604 3300049652 Ga0501202_000230 Ga0501202_000230_5111_6166 331
605 3300049761 Ga0501264_000187 Ga0501264_000187_2678_3832 331
606 3300053156 Ga0500622_0024966 Ga0500622_0024966_1684_2814 331
607 iso_pu_bacteria 2884791551 2884797031 331
608 3300003316 rootH1_10007636 rootH1_100076369 332
609 3300003323 rootH1_10023266 rootH1_100232664 332
610 3300003323 rootH1_10023267 rootH1_100232673 332
611 3300003323 rootH1_10088110 rootH1_100881102 332
612 3300005290 Ga0065712_10073522 Ga0065712_100735223 332
613 3300005331 Ga0070670_100065603 Ga0070670_1000656032 332
614 3300005459 Ga0068867_100150006 Ga0068867_1001500062 332
615 3300005543 Ga0070672_100076134 Ga0070672_1000761342 332
616 3300006237 Ga0097621_100015918 Ga0097621_1000159183 332
617 3300013104 Ga0157370_10029357 Ga0157370_100293573 332
618 3300014326 Ga0157380_10003690 Ga0157380_100036905 332
619 3300014326 Ga0157380_10007843 Ga0157380_100078433 332
620 3300025935 Ga0207709_10000026 Ga0207709_1000002685 332
621 3300025940 Ga0207691_10041641 Ga0207691_100416414 332
622 3300031901 Ga0307406_10144483 Ga0307406_101444832 332
623 3300032004 Ga0307414_10007685 Ga0307414_100076855 332
624 3300041494 Ga0451837_0682610 Ga0451837_0682610_535_1665 332
625 3300042014 Ga0439457_024499 Ga0439457_024499_101_1249 332
626 3300045051 Ga0451576_0000003 Ga0451576_0000003_261764_262903 332
627 3300049576 Ga0501040_0022226 Ga0501040_0022226_457_1572 332
628 3300049703 Ga0501219_000020 Ga0501219_000020_21196_22329 332
629 3300050005 Ga0501284_00030 Ga0501284_00030_21667_22800 332
630 iso_pu_bacteria 2965320100 2965321747 332
631 iso_pu_bacteria 8036736890 8036738955 332
632 3300003316 rootH1_10058961 rootH1_100589612 333
633 3300005841 Ga0068863_100045188 Ga0068863_1000451884 333
634 3300009098 Ga0105245_10091171 Ga0105245_100911712 333
635 3300014326 Ga0157380_10000295 Ga0157380_1000029513 333
636 3300026088 Ga0207641_10039756 Ga0207641_100397562 333
637 3300048924 Ga0496121_0143642 Ga0496121_0143642_301_1365 333
638 3300053092 Ga0500583_0072611 Ga0500583_0072611_518_1612 333
639 iso_pu_bacteria 2896344016 2896347188 333
640 iso_pu_bacteria 2958512119 2958515042 333
641 3300005354 Ga0070675_100028857 Ga0070675_1000288574 334
642 3300006946 Ga0079104_1000256 Ga0079104_100025631 334
643 3300013104 Ga0157370_10344279 Ga0157370_103442792 334
644 3300027111 Ga0209281_1000115 Ga0209281_100011542 334
645 3300031824 Ga0307413_10000007 Ga0307413_1000000712 334
646 3300031824 Ga0307413_10019663 Ga0307413_100196631 334
647 3300032002 Ga0307416_100001392 Ga0307416_1000013925 334
648 3300032005 Ga0307411_10000033 Ga0307411_1000003328 334
649 3300048919 Ga0496116_0000002 Ga0496116_0000002_499284_500438 334
650 3300048928 Ga0496125_0000007 Ga0496125_0000007_500705_501784 334
651 3300005336 Ga0070680_100000268 Ga0070680_10000026818 335
652 3300005337 Ga0070682_100002103 Ga0070682_1000021033 335
653 3300005341 Ga0070691_10000271 Ga0070691_100002719 335
654 3300005366 Ga0070659_100221079 Ga0070659_1002210791 335
655 3300005458 Ga0070681_10060332 Ga0070681_100603323 335
656 3300005530 Ga0070679_100037756 Ga0070679_1000377562 335
657 3300005563 Ga0068855_100011315 Ga0068855_1000113153 335
658 3300009174 Ga0105241_10000252 Ga0105241_1000025213 335
659 3300025911 Ga0207654_10012351 Ga0207654_100123512 335
660 3300025912 Ga0207707_10004370 Ga0207707_100043709 335
661 3300025913 Ga0207695_10037303 Ga0207695_100373031 335
662 3300033180 Ga0307510_10102177 Ga0307510_101021773 335
663 3300035398 Ga0316574_0234993 Ga0316574_0234993_22_1155 335
664 3300049679 Ga0501249_000015 Ga0501249_000015_93445_94527 335
665 3300049679 Ga0501249_000664 Ga0501249_000664_3546_4679 335
666 3300053096 Ga0500641_0002301 Ga0500641_0002301_1873_2955 335
667 3300053118 Ga0500594_0015338 Ga0500594_0015338_436_1518 335
668 3300053158 Ga0500627_0071077 Ga0500627_0071077_18_1100 335
669 3300005337 Ga0070682_100053130 Ga0070682_1000531301 336
670 3300009036 Ga0105244_10000025 Ga0105244_10000025100 336
671 3300017792 Ga0163161_10000014 Ga0163161_1000001419 336
672 3300025728 Ga0207655_1000003 Ga0207655_1000003577 336
673 3300048929 Ga0496126_0046451 Ga0496126_0046451_2770_3924 336
674 3300053118 Ga0500594_0019407 Ga0500594_0019407_366_1427 336
675 2162886007 SwRhRL2b_contig_1665027 SwRhRL2b_0885.00004140 337
676 3300005289 Ga0065704_10070489 Ga0065704_100704893 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

33

208

0.89

PF06969

HemN_C

HemN C-terminal domain

330

403

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1olt-assembly1.cif.gz_A coproporphyrinogen iii oxidase (hemn) from escherichia coli is a radical sam enzyme. 0.8313 5 330
1olt-assembly1.cif.gz_A coproporphyrinogen iii oxidase (hemn) from escherichia coli is a radical sam enzyme. 0.8051 5 330
7n7i-assembly3.cif.gz_C x-ray crystal structure of viperin-like enzyme from trichoderma virens 0.7429 12 131
4rtb-assembly1.cif.gz_A x-ray structure of the fefe-hydrogenase maturase hydg from carboxydothermus hydrogenoformans 0.7295 8 134
5exk-assembly6.cif.gz_K crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate 0.726 27 145
ID Description Score Start End Superfamily
af_Q9HA92_43_208_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9244 7 143 3.20.20.70
af_Q54VE8_28_212_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9052 5 145 3.20.20.70
af_P9WP73_8_223_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.8732 8 170 3.80.30.20
af_Q5SUV1_33_283_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8724 8 201 3.20.20.70
af_Q2FXY9_297_360_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8672 256 319 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q6AHA5-F1-model_v4 Coproporphyrinogen III oxidase 0.9903 260 331
AF-A0A519RAU5-F1-model_v4 Radical SAM protein 0.985 2 110 GO:0003824
GO:0005737
GO:0006779
GO:0051539
AF-A0A645C5G4-F1-model_v4 HemN C-terminal domain-containing protein 0.9685 215 332 GO:0005737
GO:0006779
GO:0051539
AF-A0A559NTG7-F1-model_v4 Heme chaperone HemW 0.9611 3 335 GO:0004109
GO:0005737
GO:0006779
GO:0046872
GO:0051539
AF-A0A352FB89-F1-model_v4 HemN C-terminal domain-containing protein 0.9584 260 332

Feature Viewer

pLDDT pTM Quality
87.74 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map