F474545

General Info

Members Datasets Scaffolds Average Seq Length
676 208 676 290

Family's Representative Sequence

Representative Sequence 3300046642|Ga0495634_0048008|Ga0495634_0048008_939_1907
Length 322
Sequence MSNVSGFWSNIAAAPDRSAENQEIDMRSAIAGVAIIVTVCSASLAAQWPKHQAPGVPRDADGRVRMDAPTPRLPDGKPDLSGNWIRFRGEGAFTAPELGGLVRNQAAAAQTPAPPADXSSPPIAAFWELGANVPGGLPLTPWAADLKKQRMAINDKDNPDANCLPMGLTQFHTHGQPRKIMQNSGVIAIMYEANYGLRYIYLDGRALPPPGSVAPFWYGYSVGRWEGDTLVVETNNLRGAETSPNDGWLDVRGSPYTEQARFIERIRRPTYGKLEIDLTVEDPKAYTKPFTVRINQQISPDDEIIEFICNENQQFRRRVKID

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.74
Rhizosphere 98.96
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2450520 2162886007 Bacteria 1652
2 JGI24746J21847_1009169 3300001977 Bacteria 1482
3 JGI25406J46586_10001063 3300003203 Bacteria 12883
4 JGI25406J46586_10007609 3300003203 Bacteria 4931
5 Ga0065712_10081022 3300005290 Bacteria 3047
6 Ga0065712_10083559 3300005290 Bacteria 2827
7 Ga0065712_10097622 3300005290 Bacteria 2124
8 Ga0065707_10100544 3300005295 Unclassified 2904
9 Ga0070676_10008646 3300005328 Bacteria 5491
10 Ga0070676_10019382 3300005328 Bacteria 3784
11 Ga0070676_10025553 3300005328 Bacteria 3339
12 Ga0070676_10262806 3300005328 Unclassified 1156
13 Ga0070690_100011719 3300005330 Bacteria 5138
14 Ga0070690_100016542 3300005330 Bacteria 4421
15 Ga0070690_100055681 3300005330 Bacteria 2533
16 Ga0070670_100003610 3300005331 Bacteria 12874
17 Ga0070670_100011107 3300005331 Bacteria 7694
18 Ga0070670_100013237 3300005331 Bacteria 7067
19 Ga0070670_100247134 3300005331 Bacteria 1554
20 Ga0070677_10003864 3300005333 Bacteria 4855
21 Ga0070677_10008361 3300005333 Bacteria 3479
22 Ga0070677_10015657 3300005333 Unclassified 2688
23 Ga0068869_100002654 3300005334 Bacteria 10804
24 Ga0068869_100009363 3300005334 Bacteria 6355
25 Ga0068869_100041913 3300005334 Bacteria 3280
26 Ga0068869_100044457 3300005334 Bacteria 3194
27 Ga0068869_100056857 3300005334 Bacteria 2854
28 Ga0068869_100061499 3300005334 Bacteria 2755
29 Ga0068869_100093838 3300005334 Bacteria 2261
30 Ga0068869_100103843 3300005334 Bacteria 2154
31 Ga0068869_100209863 3300005334 Unclassified 1539
32 Ga0070666_10130704 3300005335 Bacteria 1745
33 Ga0068868_100005627 3300005338 Bacteria 8816
34 Ga0068868_100067165 3300005338 Bacteria 2853
35 Ga0068868_100090910 3300005338 Bacteria 2459
36 Ga0070689_100059652 3300005340 Unclassified 2966
37 Ga0070689_100240479 3300005340 Bacteria 1491
38 Ga0070661_100079775 3300005344 Bacteria 2415
39 Ga0070692_10131378 3300005345 Unclassified 1407
40 Ga0070669_100008384 3300005353 Bacteria 7374
41 Ga0070669_100029313 3300005353 Bacteria 3967
42 Ga0070669_100031606 3300005353 Bacteria 3824
43 Ga0070669_100037887 3300005353 Bacteria 3499
44 Ga0070669_100041601 3300005353 Unclassified 3342
45 Ga0070669_100158971 3300005353 Bacteria 1754
46 Ga0070669_100185901 3300005353 Bacteria 1628
47 Ga0070669_100354672 3300005353 Bacteria 1191
48 Ga0070675_100001766 3300005354 Bacteria 15937
49 Ga0070675_100003474 3300005354 Bacteria 11947
50 Ga0070675_100003808 3300005354 Bacteria 11452
51 Ga0070675_100009464 3300005354 Bacteria 7584
52 Ga0070675_100011430 3300005354 Bacteria 6948
53 Ga0070675_100015188 3300005354 Bacteria 6081
54 Ga0070675_100020373 3300005354 Bacteria 5293
55 Ga0070675_100050279 3300005354 Bacteria 3422
56 Ga0070675_100124936 3300005354 Bacteria 2188
57 Ga0070675_100147705 3300005354 Unclassified 2014
58 Ga0070675_100161630 3300005354 Bacteria 1926
59 Ga0070675_100320178 3300005354 Unclassified 1370
60 Ga0070671_100235256 3300005355 Viruses 1555
61 Ga0070671_100251600 3300005355 Bacteria 1501
62 Ga0070674_100000107 3300005356 Bacteria 39103
63 Ga0070674_100000133 3300005356 Bacteria 34091
64 Ga0070674_100008932 3300005356 Bacteria 5986
65 Ga0070674_100034226 3300005356 Bacteria 3391
66 Ga0070674_100037477 3300005356 Unclassified 3261
67 Ga0070674_100058877 3300005356 Unclassified 2672
68 Ga0070674_100120486 3300005356 Bacteria 1942
69 Ga0070674_100217101 3300005356 Bacteria 1486
70 Ga0070674_100358583 3300005356 Bacteria 1180
71 Ga0070673_100004621 3300005364 Bacteria 8726
72 Ga0070673_100129633 3300005364 Unclassified 2114
73 Ga0070673_100173279 3300005364 Bacteria 1843
74 Ga0070673_100253777 3300005364 Unclassified 1534
75 Ga0070688_100018631 3300005365 Bacteria 4009
76 Ga0070688_100026973 3300005365 Bacteria 3418
77 Ga0070688_100027650 3300005365 Bacteria 3379
78 Ga0070688_100045596 3300005365 Bacteria 2710
79 Ga0070688_100090334 3300005365 Bacteria 2000
80 Ga0070688_100387107 3300005365 Bacteria 1032
81 Ga0070659_100446266 3300005366 Unclassified 1097
82 Ga0070667_100016163 3300005367 Bacteria 6174
83 Ga0070667_100019853 3300005367 Bacteria 5576
84 Ga0070667_100019984 3300005367 Bacteria 5559
85 Ga0070667_100292675 3300005367 Bacteria 1465
86 Ga0070667_100374091 3300005367 Bacteria 1293
87 Ga0070667_100439717 3300005367 Bacteria 1191
88 Ga0070713_100003664 3300005436 Bacteria 10172
89 Ga0070701_10010641 3300005438 Bacteria 4078
90 Ga0070701_10116253 3300005438 Bacteria 1501
91 Ga0070701_10268681 3300005438 Bacteria 1037
92 Ga0070711_100077247 3300005439 Bacteria 2363
93 Ga0070700_100000833 3300005441 Bacteria 15192
94 Ga0070700_100005699 3300005441 Bacteria 6609
95 Ga0070700_100118859 3300005441 Bacteria 1768
96 Ga0070700_100162692 3300005441 Bacteria 1538
97 Ga0070700_100202552 3300005441 Bacteria 1395
98 Ga0070663_100044452 3300005455 Bacteria 3132
99 Ga0070663_100416793 3300005455 Unclassified 1101
100 Ga0070678_100019918 3300005456 Bacteria 4389
101 Ga0070678_100025309 3300005456 Unclassified 3990
102 Ga0070678_100184906 3300005456 Bacteria 1709
103 Ga0070662_100095725 3300005457 Bacteria 2238
104 Ga0070662_100102943 3300005457 Unclassified 2164
105 Ga0070662_100147978 3300005457 Bacteria 1826
106 Ga0070662_100327435 3300005457 Bacteria 1251
107 Ga0070662_100541552 3300005457 Bacteria 975
108 Ga0068867_100000229 3300005459 Bacteria 36660
109 Ga0068867_100011607 3300005459 Bacteria 6220
110 Ga0068867_100039682 3300005459 Bacteria 3433
111 Ga0068867_100055871 3300005459 Bacteria 2920
112 Ga0068867_100069789 3300005459 Bacteria 2625
113 Ga0068867_100156989 3300005459 Bacteria 1792
114 Ga0070685_10004711 3300005466 Bacteria 6902
115 Ga0070685_10009319 3300005466 Bacteria 5067
116 Ga0070685_10034529 3300005466 Unclassified 2849
117 Ga0070685_10168334 3300005466 Bacteria 1402
118 Ga0070707_100051050 3300005468 Bacteria 3964
119 Ga0070699_100297831 3300005518 Bacteria 1447
120 Ga0070672_100001789 3300005543 Bacteria 13449
121 Ga0070672_100005375 3300005543 Bacteria 8487
122 Ga0070672_100027729 3300005543 Unclassified 4227
123 Ga0070672_100027805 3300005543 Bacteria 4222
124 Ga0070672_100042658 3300005543 Bacteria 3493
125 Ga0070672_100082606 3300005543 Bacteria 2577
126 Ga0070672_100211694 3300005543 Bacteria 1623
127 Ga0070672_100293166 3300005543 Bacteria 1378
128 Ga0070686_100169390 3300005544 Bacteria 1543
129 Ga0070686_100257450 3300005544 Bacteria 1277
130 Ga0070696_100232334 3300005546 Unclassified 1388
131 Ga0070696_100290922 3300005546 Bacteria 1248
132 Ga0070665_100026145 3300005548 Bacteria 5877
133 Ga0070665_100346881 3300005548 Bacteria 1490
134 Ga0070665_100495536 3300005548 Bacteria 1233
135 Ga0070665_100543588 3300005548 Bacteria 1174
136 Ga0070664_100001335 3300005564 Bacteria 19670
137 Ga0070664_100005088 3300005564 Bacteria 10546
138 Ga0070664_100007256 3300005564 Bacteria 8935
139 Ga0070664_100024185 3300005564 Bacteria 5023
140 Ga0070664_100116084 3300005564 Bacteria 2340
141 Ga0070664_100266974 3300005564 Viruses 1541
142 Ga0070664_100594443 3300005564 Unclassified 1026
143 Ga0068857_100101000 3300005577 Bacteria 2588
144 Ga0068854_100070505 3300005578 Bacteria 2555
145 Ga0070702_100129074 3300005615 Bacteria 1594
146 Ga0070702_100213273 3300005615 Bacteria 1286
147 Ga0068852_100334088 3300005616 Bacteria 1475
148 Ga0068859_100001842 3300005617 Bacteria 21574
149 Ga0068859_100019594 3300005617 Bacteria 6796
150 Ga0068859_100044623 3300005617 Bacteria 4454
151 Ga0068859_100055531 3300005617 Bacteria 3985
152 Ga0068859_100072491 3300005617 Bacteria 3481
153 Ga0068859_100082383 3300005617 Bacteria 3260
154 Ga0068859_100202153 3300005617 Bacteria 2072
155 Ga0068859_100202736 3300005617 Bacteria 2069
156 Ga0068859_100429443 3300005617 Bacteria 1417
157 Ga0068859_100463883 3300005617 Bacteria 1362
158 Ga0068859_100552689 3300005617 Bacteria 1246
159 Ga0068859_100601842 3300005617 Unclassified 1192
160 Ga0068864_100022045 3300005618 Bacteria 5338
161 Ga0068864_100213763 3300005618 Unclassified 1777
162 Ga0068864_100344377 3300005618 Unclassified 1405
163 Ga0068866_10008287 3300005718 Bacteria 4374
164 Ga0068866_10129378 3300005718 Bacteria 1434
165 Ga0068861_100011926 3300005719 Bacteria 6052
166 Ga0068861_100017412 3300005719 Bacteria 5101
167 Ga0068861_100033380 3300005719 Bacteria 3795
168 Ga0068861_100165426 3300005719 Bacteria 1828
169 Ga0068861_100419556 3300005719 Bacteria 1192
170 Ga0068870_10034313 3300005840 Bacteria 2596
171 Ga0068863_100004914 3300005841 Bacteria 13172
172 Ga0068863_100013933 3300005841 Bacteria 7751
173 Ga0068863_100039723 3300005841 Unclassified 4475
174 Ga0068863_100503649 3300005841 Unclassified 1193
175 Ga0068858_100011619 3300005842 Bacteria 8306
176 Ga0068858_100012888 3300005842 Bacteria 7883
177 Ga0068858_100028497 3300005842 Bacteria 5187
178 Ga0068858_100085009 3300005842 Bacteria 2943
179 Ga0068858_100182667 3300005842 Unclassified 1981
180 Ga0068858_100283187 3300005842 Bacteria 1579
181 Ga0068858_100302731 3300005842 Bacteria 1525
182 Ga0068858_100354288 3300005842 Unclassified 1406
183 Ga0068860_100010554 3300005843 Bacteria 9126
184 Ga0068860_100468255 3300005843 Unclassified 1255
185 Ga0068862_100258853 3300005844 Bacteria 1588
186 Ga0068862_100301972 3300005844 Bacteria 1473
187 Ga0068862_100451630 3300005844 Unclassified 1212
188 Ga0081455_10084939 3300005937 Bacteria 2582
189 Ga0081455_10103906 3300005937 Unclassified 2274
190 Ga0081539_10000122 3300005985 Bacteria 183393
191 Ga0081539_10000716 3300005985 Bacteria 66592
192 Ga0081539_10000802 3300005985 Bacteria 61172
193 Ga0081539_10004492 3300005985 Bacteria 15352
194 Ga0070712_100554178 3300006175 Unclassified 969
195 Ga0097621_100000879 3300006237 Bacteria 21139
196 Ga0097621_100057797 3300006237 Unclassified 3173
197 Ga0097621_100160380 3300006237 Bacteria 1933
198 Ga0068871_100001795 3300006358 Bacteria 14473
199 Ga0068871_100005649 3300006358 Bacteria 8774
200 Ga0068871_100009976 3300006358 Bacteria 6902
201 Ga0068871_100042792 3300006358 Bacteria 3638
202 Ga0068871_100118706 3300006358 Bacteria 2232
203 Ga0075428_100000223 3300006844 Bacteria 55138
204 Ga0075428_100003285 3300006844 Bacteria 17677
205 Ga0075428_100008182 3300006844 Bacteria 11602
206 Ga0075428_100049005 3300006844 Bacteria 4635
207 Ga0075428_100053226 3300006844 Bacteria 4435
208 Ga0075428_100068220 3300006844 Bacteria 3891
209 Ga0075428_100099759 3300006844 Bacteria 3166
210 Ga0075428_100120827 3300006844 Bacteria 2852
211 Ga0075428_100207298 3300006844 Unclassified 2119
212 Ga0075430_100000204 3300006846 Bacteria 40395
213 Ga0075430_100019847 3300006846 Bacteria 5717
214 Ga0075430_100029518 3300006846 Unclassified 4655
215 Ga0075430_100228424 3300006846 Unclassified 1543
216 Ga0075430_100259326 3300006846 Bacteria 1440
217 Ga0075431_100000010 3300006847 Bacteria 96359
218 Ga0075431_100011236 3300006847 Bacteria 9017
219 Ga0075431_100203598 3300006847 Bacteria 2024
220 Ga0075431_100302909 3300006847 Unclassified 1614
221 Ga0075433_10001031 3300006852 Bacteria 19878
222 Ga0075433_10005893 3300006852 Bacteria 9652
223 Ga0075433_10007405 3300006852 Bacteria 8712
224 Ga0075433_10021988 3300006852 Bacteria 5352
225 Ga0075433_10135957 3300006852 Bacteria 2185
226 Ga0075434_100003772 3300006871 Bacteria 13536
227 Ga0075434_100007227 3300006871 Bacteria 10276
228 Ga0075434_100008867 3300006871 Bacteria 9364
229 Ga0075434_100093482 3300006871 Bacteria 3011
230 Ga0075434_100106365 3300006871 Bacteria 2815
231 Ga0075434_100173501 3300006871 Bacteria 2176
232 Ga0075429_100005117 3300006880 Bacteria 11277
233 Ga0075429_100013114 3300006880 Bacteria 7191
234 Ga0075429_100072847 3300006880 Unclassified 2992
235 Ga0075429_100096396 3300006880 Bacteria 2580
236 Ga0075429_100171244 3300006880 Unclassified 1902
237 Ga0075429_100184361 3300006880 Unclassified 1829
238 Ga0075429_100193136 3300006880 Bacteria 1783
239 Ga0068865_100013702 3300006881 Bacteria 5134
240 Ga0068865_100017243 3300006881 Bacteria 4641
241 Ga0068865_100024156 3300006881 Bacteria 3985
242 Ga0068865_100034455 3300006881 Bacteria 3397
243 Ga0097620_100001842 3300006931 Bacteria 21574
244 Ga0097620_100019594 3300006931 Bacteria 6796
245 Ga0097620_100044626 3300006931 Bacteria 4454
246 Ga0097620_100055527 3300006931 Bacteria 3985
247 Ga0097620_100072493 3300006931 Bacteria 3481
248 Ga0097620_100082385 3300006931 Bacteria 3260
249 Ga0097620_100202155 3300006931 Bacteria 2072
250 Ga0097620_100202731 3300006931 Bacteria 2069
251 Ga0097620_100429436 3300006931 Bacteria 1417
252 Ga0097620_100463874 3300006931 Bacteria 1362
253 Ga0097620_100552690 3300006931 Bacteria 1246
254 Ga0097620_100601888 3300006931 Unclassified 1192
255 Ga0075435_100012783 3300007076 Bacteria 6220
256 Ga0075435_100027176 3300007076 Bacteria 4472
257 Ga0075435_100171294 3300007076 Bacteria 1831
258 Ga0111539_10000346 3300009094 Bacteria 57056
259 Ga0111539_10000987 3300009094 Bacteria 37268
260 Ga0111539_10049443 3300009094 Bacteria 5014
261 Ga0111539_10060260 3300009094 Unclassified 4498
262 Ga0111539_10079016 3300009094 Unclassified 3869
263 Ga0111539_10141248 3300009094 Bacteria 2819
264 Ga0111539_10170973 3300009094 Bacteria 2539
265 Ga0111539_10205013 3300009094 Bacteria 2299
266 Ga0105245_10211134 3300009098 Unclassified 1868
267 Ga0105247_10008052 3300009101 Bacteria 6438
268 Ga0105247_10011416 3300009101 Bacteria 5357
269 Ga0114129_10000654 3300009147 Bacteria 43309
270 Ga0114129_10017908 3300009147 Bacteria 10083
271 Ga0114129_10069891 3300009147 Unclassified 4895
272 Ga0114129_10166196 3300009147 Bacteria 3011
273 Ga0114129_10205067 3300009147 Unclassified 2668
274 Ga0114129_10315021 3300009147 Unclassified 2082
275 Ga0114129_10386991 3300009147 Bacteria 1846
276 Ga0114129_10741031 3300009147 Unclassified 1259
277 Ga0105243_10043964 3300009148 Bacteria 3503
278 Ga0105243_10316252 3300009148 Unclassified 1421
279 Ga0105243_10629241 3300009148 Bacteria 1037
280 Ga0105243_10643400 3300009148 Bacteria 1027
281 Ga0105242_10009191 3300009176 Bacteria 7585
282 Ga0105242_10050182 3300009176 Bacteria 3397
283 Ga0105248_10027945 3300009177 Bacteria 6281
284 Ga0105248_10035394 3300009177 Bacteria 5586
285 Ga0105248_10066475 3300009177 Bacteria 4048
286 Ga0105248_10073190 3300009177 Bacteria 3851
287 Ga0105248_10114919 3300009177 Bacteria 3036
288 Ga0105248_10118294 3300009177 Unclassified 2989
289 Ga0105248_10128786 3300009177 Bacteria 2855
290 Ga0105248_10557827 3300009177 Unclassified 1292
291 Ga0105248_10577393 3300009177 Unclassified 1268
292 Ga0105248_10709913 3300009177 Bacteria 1135
293 Ga0105249_10052113 3300009553 Bacteria 3736
294 Ga0105249_10226882 3300009553 Bacteria 1841
295 Ga0105246_10042110 3300011119 Unclassified 3091
296 Ga0105246_10094971 3300011119 Unclassified 2158
297 Ga0105246_10462653 3300011119 Bacteria 1069
298 Ga0157316_1002466 3300012510 Bacteria 1256
299 Ga0157374_10235803 3300013296 Bacteria 1798
300 Ga0157374_10430248 3300013296 Unclassified 1319
301 Ga0163162_10008793 3300013306 Bacteria 9820
302 Ga0163162_10052455 3300013306 Bacteria 4096
303 Ga0163162_10056395 3300013306 Bacteria 3957
304 Ga0163162_10463854 3300013306 Bacteria 1398
305 Ga0157375_10004613 3300013308 Bacteria 11975
306 Ga0157375_10029990 3300013308 Bacteria 5122
307 Ga0157375_10050419 3300013308 Unclassified 4083
308 Ga0157375_10117440 3300013308 Bacteria 2765
309 Ga0163163_10001210 3300014325 Bacteria 21828
310 Ga0163163_10006039 3300014325 Bacteria 10535
311 Ga0163163_10017312 3300014325 Bacteria 6720
312 Ga0163163_10075565 3300014325 Bacteria 3362
313 Ga0163163_10087319 3300014325 Bacteria 3129
314 Ga0163163_10145502 3300014325 Bacteria 2413
315 Ga0163163_10288277 3300014325 Unclassified 1694
316 Ga0163163_10371319 3300014325 Bacteria 1487
317 Ga0163163_10396017 3300014325 Bacteria 1439
318 Ga0157380_10009742 3300014326 Bacteria 6895
319 Ga0157380_10015280 3300014326 Bacteria 5640
320 Ga0157380_10015668 3300014326 Bacteria 5573
321 Ga0157380_10035858 3300014326 Bacteria 3834
322 Ga0157380_10073089 3300014326 Unclassified 2779
323 Ga0157380_10108759 3300014326 Bacteria 2325
324 Ga0157380_10172155 3300014326 Bacteria 1893
325 Ga0157380_10288644 3300014326 Unclassified 1505
326 Ga0157380_10678564 3300014326 Bacteria 1032
327 Ga0157380_10791419 3300014326 Bacteria 964
328 Ga0157377_10007267 3300014745 Bacteria 5339
329 Ga0157377_10040002 3300014745 Bacteria 2595
330 Ga0157379_10004091 3300014968 Bacteria 12441
331 Ga0157379_10038723 3300014968 Bacteria 4253
332 Ga0157379_10089302 3300014968 Bacteria 2764
333 Ga0157379_10178445 3300014968 Bacteria 1919
334 Ga0157379_10495435 3300014968 Bacteria 1132
335 Ga0157379_10500502 3300014968 Unclassified 1126
336 Ga0157376_10006843 3300014969 Bacteria 8073
337 Ga0157376_10016358 3300014969 Bacteria 5630
338 Ga0157376_10066183 3300014969 Unclassified 3054
339 Ga0157376_10078821 3300014969 Bacteria 2822
340 Ga0157376_10088978 3300014969 Bacteria 2669
341 Ga0157376_10137656 3300014969 Bacteria 2187
342 Ga0157376_10237151 3300014969 Unclassified 1697
343 Ga0163161_10016153 3300017792 Bacteria 5212
344 Ga0163161_10021887 3300017792 Bacteria 4496
345 Ga0163161_10156445 3300017792 Bacteria 1735
346 Ga0163161_10559124 3300017792 Unclassified 939
347 Ga0207697_10004040 3300025315 Bacteria 7099
348 Ga0207697_10006279 3300025315 Bacteria 5401
349 Ga0207682_10002025 3300025893 Bacteria 9170
350 Ga0207682_10002558 3300025893 Bacteria 8120
351 Ga0207682_10004725 3300025893 Bacteria 5651
352 Ga0207682_10012622 3300025893 Unclassified 3294
353 Ga0207642_10003899 3300025899 Bacteria 4756
354 Ga0207642_10008147 3300025899 Bacteria 3581
355 Ga0207710_10111340 3300025900 Bacteria 1300
356 Ga0207688_10010364 3300025901 Bacteria 5072
357 Ga0207680_10003226 3300025903 Bacteria 7675
358 Ga0207680_10081476 3300025903 Bacteria 2035
359 Ga0207680_10128487 3300025903 Bacteria 1667
360 Ga0207680_10132385 3300025903 Bacteria 1645
361 Ga0207680_10187124 3300025903 Unclassified 1403
362 Ga0207699_10002035 3300025906 Bacteria 9551
363 Ga0207645_10005120 3300025907 Bacteria 9591
364 Ga0207645_10006753 3300025907 Bacteria 8195
365 Ga0207645_10014571 3300025907 Bacteria 5257
366 Ga0207645_10016114 3300025907 Bacteria 4950
367 Ga0207645_10281197 3300025907 Bacteria 1105
368 Ga0207643_10002677 3300025908 Bacteria 9622
369 Ga0207643_10006940 3300025908 Bacteria 6073
370 Ga0207643_10008248 3300025908 Bacteria 5592
371 Ga0207643_10025416 3300025908 Bacteria 3273
372 Ga0207643_10191545 3300025908 Bacteria 1241
373 Ga0207663_10067844 3300025916 Unclassified 2289
374 Ga0207663_10101732 3300025916 Bacteria 1931
375 Ga0207662_10020193 3300025918 Bacteria 3800
376 Ga0207662_10054468 3300025918 Bacteria 2385
377 Ga0207662_10077898 3300025918 Bacteria 2017
378 Ga0207662_10292610 3300025918 Unclassified 1080
379 Ga0207649_10032852 3300025920 Bacteria 3096
380 Ga0207646_10002815 3300025922 Bacteria 20246
381 Ga0207681_10004954 3300025923 Bacteria 8181
382 Ga0207681_10018621 3300025923 Unclassified 4377
383 Ga0207681_10024808 3300025923 Bacteria 3850
384 Ga0207681_10027381 3300025923 Bacteria 3685
385 Ga0207681_10032692 3300025923 Bacteria 3407
386 Ga0207681_10102129 3300025923 Bacteria 2070
387 Ga0207650_10011611 3300025925 Bacteria 6067
388 Ga0207650_10023059 3300025925 Bacteria 4412
389 Ga0207650_10064006 3300025925 Bacteria 2752
390 Ga0207650_10146907 3300025925 Bacteria 1858
391 Ga0207650_10289887 3300025925 Bacteria 1334
392 Ga0207650_10362169 3300025925 Unclassified 1195
393 Ga0207650_10490317 3300025925 Bacteria 1026
394 Ga0207659_10000800 3300025926 Bacteria 18583
395 Ga0207659_10002171 3300025926 Bacteria 11657
396 Ga0207659_10011805 3300025926 Bacteria 5530
397 Ga0207659_10013317 3300025926 Bacteria 5263
398 Ga0207659_10021292 3300025926 Bacteria 4301
399 Ga0207659_10023385 3300025926 Bacteria 4123
400 Ga0207659_10029335 3300025926 Bacteria 3748
401 Ga0207659_10048561 3300025926 Bacteria 3007
402 Ga0207659_10138002 3300025926 Bacteria 1890
403 Ga0207659_10141832 3300025926 Bacteria 1866
404 Ga0207659_10249869 3300025926 Unclassified 1439
405 Ga0207659_10285691 3300025926 Bacteria 1350
406 Ga0207659_10367985 3300025926 Bacteria 1196
407 Ga0207659_10373495 3300025926 Bacteria 1188
408 Ga0207644_10046973 3300025931 Bacteria 3079
409 Ga0207644_10429218 3300025931 Bacteria 1084
410 Ga0207706_10034472 3300025933 Bacteria 4503
411 Ga0207706_10051823 3300025933 Unclassified 3623
412 Ga0207706_10163892 3300025933 Bacteria 1954
413 Ga0207706_10171224 3300025933 Bacteria 1908
414 Ga0207706_10338241 3300025933 Bacteria 1309
415 Ga0207686_10021133 3300025934 Bacteria 3730
416 Ga0207686_10027544 3300025934 Bacteria 3330
417 Ga0207709_10126532 3300025935 Bacteria 1734
418 Ga0207670_10030042 3300025936 Bacteria 3469
419 Ga0207670_10035154 3300025936 Bacteria 3246
420 Ga0207670_10080578 3300025936 Bacteria 2276
421 Ga0207670_10127714 3300025936 Bacteria 1858
422 Ga0207670_10238434 3300025936 Bacteria 1400
423 Ga0207670_10258955 3300025936 Bacteria 1348
424 Ga0207669_10003575 3300025937 Bacteria 6738
425 Ga0207669_10012777 3300025937 Bacteria 4141
426 Ga0207669_10012789 3300025937 Bacteria 4140
427 Ga0207669_10108875 3300025937 Bacteria 1851
428 Ga0207669_10210500 3300025937 Bacteria 1419
429 Ga0207704_10001885 3300025938 Bacteria 9385
430 Ga0207704_10017260 3300025938 Archaea 3736
431 Ga0207704_10031229 3300025938 Unclassified 2998
432 Ga0207704_10195677 3300025938 Bacteria 1474
433 Ga0207691_10002350 3300025940 Bacteria 18516
434 Ga0207691_10009685 3300025940 Bacteria 9242
435 Ga0207691_10015109 3300025940 Bacteria 7347
436 Ga0207691_10016451 3300025940 Bacteria 7022
437 Ga0207691_10020516 3300025940 Bacteria 6248
438 Ga0207691_10031212 3300025940 Bacteria 4975
439 Ga0207691_10054813 3300025940 Bacteria 3636
440 Ga0207691_10058048 3300025940 Unclassified 3520
441 Ga0207691_10076641 3300025940 Unclassified 3013
442 Ga0207711_10015481 3300025941 Bacteria 6330
443 Ga0207711_10072694 3300025941 Bacteria 2988
444 Ga0207711_10080801 3300025941 Bacteria 2840
445 Ga0207711_10091070 3300025941 Bacteria 2682
446 Ga0207711_10163033 3300025941 Bacteria 2019
447 Ga0207711_10206188 3300025941 Bacteria 1795
448 Ga0207711_10430852 3300025941 Unclassified 1227
449 Ga0207711_10647862 3300025941 Unclassified 985
450 Ga0207689_10002803 3300025942 Bacteria 16096
451 Ga0207689_10010817 3300025942 Bacteria 7852
452 Ga0207689_10012974 3300025942 Bacteria 7116
453 Ga0207689_10016858 3300025942 Bacteria 6182
454 Ga0207689_10062617 3300025942 Bacteria 3060
455 Ga0207689_10069550 3300025942 Bacteria 2893
456 Ga0207689_10077377 3300025942 Bacteria 2734
457 Ga0207689_10101890 3300025942 Bacteria 2358
458 Ga0207689_10168934 3300025942 Bacteria 1802
459 Ga0207689_10194752 3300025942 Unclassified 1672
460 Ga0207689_10336978 3300025942 Unclassified 1253
461 Ga0207679_10003529 3300025945 Bacteria 9682
462 Ga0207679_10022616 3300025945 Bacteria 4283
463 Ga0207679_10094671 3300025945 Bacteria 2320
464 Ga0207651_10026653 3300025960 Unclassified 3615
465 Ga0207651_10053539 3300025960 Bacteria 2759
466 Ga0207651_10087756 3300025960 Bacteria 2265
467 Ga0207651_10092233 3300025960 Bacteria 2220
468 Ga0207651_10112288 3300025960 Bacteria 2048
469 Ga0207651_10129468 3300025960 Bacteria 1929
470 Ga0207651_10240407 3300025960 Bacteria 1475
471 Ga0207651_10331124 3300025960 Unclassified 1276
472 Ga0207640_10022033 3300025981 Bacteria 3807
473 Ga0207658_10152857 3300025986 Bacteria 1882
474 Ga0207658_10226594 3300025986 Bacteria 1575
475 Ga0207658_10462225 3300025986 Bacteria 1125
476 Ga0207677_10008423 3300026023 Bacteria 5756
477 Ga0207677_10067822 3300026023 Bacteria 2501
478 Ga0207703_10069837 3300026035 Bacteria 2898
479 Ga0207703_10083709 3300026035 Bacteria 2666
480 Ga0207703_10095736 3300026035 Bacteria 2505
481 Ga0207703_10102189 3300026035 Bacteria 2432
482 Ga0207703_10115846 3300026035 Bacteria 2293
483 Ga0207703_10230172 3300026035 Unclassified 1661
484 Ga0207703_10344025 3300026035 Bacteria 1371
485 Ga0207678_10053545 3300026067 Bacteria 3477
486 Ga0207678_10247085 3300026067 Bacteria 1528
487 Ga0207678_10441175 3300026067 Unclassified 1131
488 Ga0207708_10003780 3300026075 Bacteria 11157
489 Ga0207708_10039136 3300026075 Unclassified 3612
490 Ga0207641_10002863 3300026088 Bacteria 15677
491 Ga0207641_10013185 3300026088 Bacteria 6777
492 Ga0207641_10037587 3300026088 Unclassified 4044
493 Ga0207641_10711705 3300026088 Unclassified 989
494 Ga0207648_10000650 3300026089 Bacteria 39002
495 Ga0207648_10004440 3300026089 Bacteria 14396
496 Ga0207648_10017814 3300026089 Bacteria 6446
497 Ga0207648_10065467 3300026089 Bacteria 3168
498 Ga0207648_10087168 3300026089 Bacteria 2724
499 Ga0207648_10121297 3300026089 Bacteria 2299
500 Ga0207648_10123665 3300026089 Unclassified 2275
501 Ga0207648_10152200 3300026089 Bacteria 2041
502 Ga0207676_10086046 3300026095 Bacteria 2567
503 Ga0207676_10188252 3300026095 Bacteria 1814
504 Ga0207676_10188951 3300026095 Bacteria 1811
505 Ga0207676_10589452 3300026095 Unclassified 1066
506 Ga0207675_100014394 3300026118 Bacteria 7374
507 Ga0207675_100016551 3300026118 Bacteria 6886
508 Ga0207675_100020005 3300026118 Bacteria 6246
509 Ga0207675_100028731 3300026118 Bacteria 5180
510 Ga0207675_100068340 3300026118 Unclassified 3321
511 Ga0207675_100372029 3300026118 Unclassified 1404
512 Ga0207675_100544983 3300026118 Bacteria 1159
513 Ga0207683_10034489 3300026121 Bacteria 4398
514 Ga0207683_10040128 3300026121 Bacteria 4083
515 Ga0207683_10134461 3300026121 Unclassified 2226
516 Ga0207683_10143724 3300026121 Bacteria 2150
517 Ga0207683_10178820 3300026121 Bacteria 1923
518 Ga0207683_10183753 3300026121 Bacteria 1897
519 Ga0207683_10196221 3300026121 Bacteria 1834
520 Ga0207683_10224592 3300026121 Bacteria 1712
521 Ga0209974_10027548 3300027876 Unclassified 1880
522 Ga0207428_10000618 3300027907 Bacteria 41972
523 Ga0207428_10001221 3300027907 Bacteria 27574
524 Ga0207428_10003565 3300027907 Bacteria 15040
525 Ga0207428_10009046 3300027907 Bacteria 8961
526 Ga0207428_10033873 3300027907 Bacteria 4190
527 Ga0207428_10066122 3300027907 Bacteria 2849
528 Ga0268266_10247723 3300028379 Unclassified 1647
529 Ga0268266_10322458 3300028379 Bacteria 1446
530 Ga0268265_10255247 3300028380 Bacteria 1556
531 Ga0268265_10266836 3300028380 Unclassified 1525
532 Ga0268265_10279838 3300028380 Bacteria 1492
533 Ga0268265_10414751 3300028380 Unclassified 1248
534 Ga0268264_10020334 3300028381 Bacteria 5425
535 Ga0268264_10044965 3300028381 Bacteria 3665
536 Ga0268264_10174838 3300028381 Bacteria 1945
537 Ga0268264_10209007 3300028381 Bacteria 1790
538 Ga0307405_10003681 3300031731 Archaea 7106
539 Ga0307410_10192067 3300031852 Unclassified 1553
540 Ga0307406_10082744 3300031901 Unclassified 2139
541 Ga0307407_10010413 3300031903 Unclassified 4384
542 Ga0307412_10045660 3300031911 Bacteria 2865
543 Ga0307409_100041913 3300031995 Unclassified 3424
544 Ga0307416_100357112 3300032002 Bacteria 1482
545 Ga0307414_10127830 3300032004 Bacteria 1967
546 Ga0307411_10053415 3300032005 Unclassified 2647
547 Ga0307415_100006236 3300032126 Bacteria 6407
548 Ga0373932_0018294 3300035112 Bacteria 1810
549 Ga0373936_0074540 3300035113 Unclassified 1404
550 Ga0373945_0069329 3300035116 Unclassified 1331
551 Ga0373953_0152935 3300035117 Bacteria 990
552 Ga0373956_0117948 3300035119 Bacteria 1238
553 Ga0373957_0034092 3300035120 Unclassified 1883
554 Ga0373946_0123435 3300035171 Unclassified 1184
555 Ga0373955_0106443 3300035172 Unclassified 1617
556 Ga0373924_0030575 3300035410 Unclassified 2159
557 Ga0373924_0046661 3300035410 Unclassified 1786
558 Ga0373935_0017730 3300035692 Unclassified 4325
559 Ga0373935_0256705 3300035692 Unclassified 1225
560 Ga0373947_0024439 3300035725 Unclassified 3521
561 Ga0373947_0079405 3300035725 Unclassified 2028
562 Ga0373937_0005432 3300036401 Bacteria 10909
563 Ga0373937_0035441 3300036401 Bacteria 4542
564 Ga0373937_0160740 3300036401 Bacteria 2106
565 Ga0373937_0186379 3300036401 Unclassified 1949
566 Ga0373925_0007527 3300037068 Bacteria 7939
567 Ga0436365_0431582 3300039437 Bacteria 2887
568 Ga0451853_0755240 3300041512 Unclassified 1481
569 Ga0439460_0044462 3300042461 Bacteria 1315
570 Ga0439440_0032211 3300042993 Bacteria 1244
571 Ga0451576_0187689 3300045051 Unclassified 2159
572 Ga0495592_0029266 3300046454 Bacteria 4171
573 Ga0495629_0105663 3300046459 Unclassified 1964
574 Ga0495651_0248618 3300046462 Unclassified 1216
575 Ga0495580_0056036 3300046472 Bacteria 2776
576 Ga0495594_0036300 3300046499 Bacteria 2688
577 Ga0495608_0019196 3300046511 Unclassified 4708
578 Ga0495618_0083401 3300046514 Bacteria 2042
579 Ga0495628_0093169 3300046516 Bacteria 2330
580 Ga0495628_0260231 3300046516 Unclassified 1293
581 Ga0495586_0230848 3300046535 Unclassified 1053
582 Ga0495621_0026072 3300046539 Bacteria 1968
583 Ga0495621_0081721 3300046539 Unclassified 1206
584 Ga0495645_0050308 3300046543 Unclassified 3034
585 Ga0495667_0000530 3300046559 Bacteria 24443
586 Ga0495656_0005020 3300046615 Bacteria 4559
587 Ga0495656_0065319 3300046615 Bacteria 1600
588 Ga0495634_0048008 3300046642 Unclassified 2876
589 Ga0495657_0002087 3300046675 Bacteria 16983
590 Ga0495599_0133187 3300046678 Bacteria 1543
591 Ga0495647_0036040 3300046681 Bacteria 1861
592 Ga0495613_0019352 3300046689 Bacteria 5075
593 Ga0495604_0051668 3300047317 Unclassified 3185
594 Ga0495674_0201208 3300047319 Unclassified 1652
595 Ga0495675_0082435 3300047444 Unclassified 2025
596 Ga0495684_0002524 3300047471 Bacteria 14592
597 Ga0495684_0286104 3300047471 Bacteria 1188
598 Ga0495602_0302115 3300048088 Unclassified 1171
599 Ga0496101_0008516 3300048904 Bacteria 6704
600 Ga0496104_0395668 3300048907 Bacteria 1294
601 Ga0496106_0025746 3300048909 Unclassified 4379
602 Ga0496114_0001268 3300048917 Bacteria 19064
603 Ga0496114_0272760 3300048917 Bacteria 1491
604 Ga0501036_0005722 3300049572 Bacteria 10082
605 Ga0501038_0064963 3300049574 Bacteria 3111
606 Ga0501039_0032334 3300049575 Unclassified 4033
607 Ga0501039_0347910 3300049575 Unclassified 1165
608 Ga0501040_0010271 3300049576 Bacteria 6123
609 Ga0501041_0010644 3300049577 Bacteria 5424
610 Ga0501042_0043694 3300049578 Bacteria 3191
611 Ga0501071_0008059 3300049587 Bacteria 6950
612 Ga0501072_0128557 3300049588 Bacteria 2019
613 Ga0501074_0406079 3300049590 Unclassified 966
614 Ga0501075_0048441 3300049591 Bacteria 3193
615 Ga0501076_0001241 3300049592 Bacteria 16979
616 Ga0501249_033419 3300049679 Bacteria 1152
617 Ga0501035_0289726 3300049822 Unclassified 1382
618 nmdc:mga05p37_110708_c1 3300050507 Unclassified 3378
619 nmdc:mga05p37_268349_c1 3300050507 Bacteria 2040
620 nmdc:mga05p37_275855_c1 3300050507 Bacteria 2007
621 nmdc:mga05p37_30050_c1 3300050507 Bacteria 6631
622 nmdc:mga05p37_40258_c1 3300050507 Bacteria 5738
623 nmdc:mga05p37_411408_c1 3300050507 Unclassified 1577
624 nmdc:mga05p37_94836_c1 3300050507 Unclassified 3676
625 nmdc:mga05p37_9724_c1 3300050507 Bacteria 6728
626 nmdc:mga09592_1217_c1 3300050508 Bacteria 20611
627 nmdc:mga09592_184646_c1 3300050508 Bacteria 1804
628 nmdc:mga09592_198780_c1 3300050508 Bacteria 1736
629 nmdc:mga09592_215750_c1 3300050508 Unclassified 1663
630 nmdc:mga09592_57285_c1 3300050508 Unclassified 3293
631 nmdc:mga09592_59566_c1 3300050508 Bacteria 3228
632 nmdc:mga0qj67_100580_c1 3300050509 Bacteria 2331
633 nmdc:mga0qj67_17914_c1 3300050509 Bacteria 5392
634 nmdc:mga0qj67_232516_c1 3300050509 Bacteria 1496
635 nmdc:mga0qj67_26512_c1 3300050509 Unclassified 4487
636 nmdc:mga0qj67_332683_c1 3300050509 Bacteria 1229
637 nmdc:mga0qj67_430_c1 3300050509 Bacteria 28700
638 nmdc:mga0qj67_562262_c1 3300050509 Bacteria 914
639 nmdc:mga06r32_164155_c1 3300050510 Unclassified 2204
640 nmdc:mga06r32_171_c1 3300050510 Bacteria 50226
641 nmdc:mga06r32_5796_c1 3300050510 Bacteria 11133
642 nmdc:mga06r32_662862_c1 3300050510 Bacteria 1011
643 nmdc:mga08y16_269604_c1 3300050511 Unclassified 1757
644 nmdc:mga08y16_30452_c1 3300050511 Bacteria 5680
645 nmdc:mga08y16_473_c1 3300050511 Bacteria 37040
646 nmdc:mga08y16_633_c1 3300050511 Bacteria 32997
647 nmdc:mga08y16_6501_c1 3300050511 Bacteria 12255
648 nmdc:mga08y16_75660_c1 3300050511 Unclassified 3510
649 nmdc:mga0n895_12520_c1 3300050512 Bacteria 7615
650 nmdc:mga0n895_143025_c1 3300050512 Unclassified 2421
651 nmdc:mga0n895_1801_c1 3300050512 Bacteria 16283
652 nmdc:mga0n895_206242_c1 3300050512 Bacteria 1996
653 nmdc:mga0n895_3812_c1 3300050512 Bacteria 12219
654 nmdc:mga0n895_522147_c1 3300050512 Bacteria 1195
655 nmdc:mga0n895_54647_c1 3300050512 Bacteria 3929
656 nmdc:mga0n895_60124_c1 3300050512 Bacteria 3749
657 nmdc:mga0n895_803252_c1 3300050512 Unclassified 931
658 nmdc:mga0n895_94925_c1 3300050512 Unclassified 2987
659 nmdc:mga0rr50_135205_c1 3300050513 Bacteria 1978
660 nmdc:mga0rr50_2248_c1 3300050513 Bacteria 10844
661 nmdc:mga0rr50_296796_c1 3300050513 Bacteria 1351
662 nmdc:mga0rr50_30897_c1 3300050513 Bacteria 3797
663 nmdc:mga0rr50_56630_c1 3300050513 Unclassified 2929
664 nmdc:mga0a205_436_c1 3300050515 Bacteria 32176
665 nmdc:mga0a205_46070_c1 3300050515 Bacteria 4205
666 nmdc:mga0a205_487909_c1 3300050515 Unclassified 1090
667 nmdc:mga0a205_51477_c1 3300050515 Bacteria 3976
668 nmdc:mga0a205_5202_c1 3300050515 Bacteria 11708
669 nmdc:mga0a205_677_c1 3300050515 Bacteria 27225
670 nmdc:mga0a205_79066_c1 3300050515 Bacteria 3178
671 nmdc:mga0a205_968_c1 3300050515 Bacteria 23716
672 Ga0495601_0005875 3300053077 Bacteria 7155
673 Ga0495601_0054841 3300053077 Bacteria 2522
674 Ga0495619_0005975 3300053085 Bacteria 7707
675 Ga0495619_0013570 3300053085 Bacteria 5134
676 Ga0501082_0034194 3300060353 Unclassified 4384

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046535 Ga0495586_0230848 Ga0495586_0230848_115_885 203
2 3300050512 nmdc:mga0n895_803252_c1 nmdc:mga0n895_803252_c1_85_879 212
3 3300048088 Ga0495602_0302115 Ga0495602_0302115_90_842 216
4 3300050509 nmdc:mga0qj67_562262_c1 nmdc:mga0qj67_562262_c1_18_794 217
5 3300017792 Ga0163161_10559124 Ga0163161_105591241 220
6 3300009094 Ga0111539_10079016 Ga0111539_100790162 221
7 3300014969 Ga0157376_10078821 Ga0157376_100788214 222
8 3300046615 Ga0495656_0065319 Ga0495656_0065319_106_900 222
9 3300049590 Ga0501074_0406079 Ga0501074_0406079_107_916 222
10 3300050509 nmdc:mga0qj67_332683_c1 nmdc:mga0qj67_332683_c1_398_1192 222
11 3300050510 nmdc:mga06r32_662862_c1 nmdc:mga06r32_662862_c1_44_844 222
12 3300035410 Ga0373924_0046661 Ga0373924_0046661_43_825 223
13 3300035692 Ga0373935_0256705 Ga0373935_0256705_417_1205 223
14 3300046472 Ga0495580_0056036 Ga0495580_0056036_51_824 223
15 3300006844 Ga0075428_100068220 Ga0075428_1000682202 227
16 3300009094 Ga0111539_10049443 Ga0111539_100494435 228
17 3300011119 Ga0105246_10462653 Ga0105246_104626531 228
18 3300014326 Ga0157380_10172155 Ga0157380_101721552 228
19 3300046539 Ga0495621_0026072 Ga0495621_0026072_521_1411 228
20 3300046615 Ga0495656_0005020 Ga0495656_0005020_1445_2335 228
21 3300050507 nmdc:mga05p37_275855_c1 nmdc:mga05p37_275855_c1_1086_1970 228
22 3300050508 nmdc:mga09592_184646_c1 nmdc:mga09592_184646_c1_160_1038 228
23 3300050511 nmdc:mga08y16_30452_c1 nmdc:mga08y16_30452_c1_3906_4784 229
24 3300026089 Ga0207648_10152200 Ga0207648_101522003 231
25 3300014326 Ga0157380_10678564 Ga0157380_106785642 233
26 3300009094 Ga0111539_10205013 Ga0111539_102050133 234
27 3300036401 Ga0373937_0186379 Ga0373937_0186379_300_1265 234
28 3300005354 Ga0070675_100161630 Ga0070675_1001616302 235
29 3300009147 Ga0114129_10017908 Ga0114129_100179084 235
30 3300025926 Ga0207659_10138002 Ga0207659_101380021 235
31 3300025931 Ga0207644_10429218 Ga0207644_104292182 235
32 3300050507 nmdc:mga05p37_110708_c1 nmdc:mga05p37_110708_c1_1321_2172 235
33 3300005719 Ga0068861_100419556 Ga0068861_1004195561 236
34 3300005543 Ga0070672_100027729 Ga0070672_1000277294 237
35 3300005564 Ga0070664_100116084 Ga0070664_1001160842 237
36 3300005618 Ga0068864_100344377 Ga0068864_1003443772 237
37 3300025940 Ga0207691_10054813 Ga0207691_100548135 237
38 3300025945 Ga0207679_10094671 Ga0207679_100946712 237
39 3300046499 Ga0495594_0036300 Ga0495594_0036300_1043_1921 237
40 3300005290 Ga0065712_10097622 Ga0065712_100976222 238
41 3300005331 Ga0070670_100247134 Ga0070670_1002471342 238
42 3300005353 Ga0070669_100185901 Ga0070669_1001859011 238
43 3300005365 Ga0070688_100090334 Ga0070688_1000903341 238
44 3300005441 Ga0070700_100202552 Ga0070700_1002025522 238
45 3300005457 Ga0070662_100541552 Ga0070662_1005415521 238
46 3300005617 Ga0068859_100082383 Ga0068859_1000823832 238
47 3300005844 Ga0068862_100301972 Ga0068862_1003019721 238
48 3300006931 Ga0097620_100082385 Ga0097620_1000823852 238
49 3300009101 Ga0105247_10011416 Ga0105247_100114164 238
50 3300014325 Ga0163163_10145502 Ga0163163_101455023 238
51 3300014968 Ga0157379_10089302 Ga0157379_100893023 238
52 3300014969 Ga0157376_10006843 Ga0157376_1000684310 238
53 3300028380 Ga0268265_10279838 Ga0268265_102798383 238
54 3300048907 Ga0496104_0395668 Ga0496104_0395668_372_1244 238
55 3300005356 Ga0070674_100217101 Ga0070674_1002171011 239
56 3300005543 Ga0070672_100293166 Ga0070672_1002931661 239
57 3300005616 Ga0068852_100334088 Ga0068852_1003340882 239
58 3300006358 Ga0068871_100005649 Ga0068871_1000056496 239
59 3300013308 Ga0157375_10050419 Ga0157375_100504194 239
60 3300026121 Ga0207683_10040128 Ga0207683_100401281 239
61 3300048917 Ga0496114_0272760 Ga0496114_0272760_484_1356 239
62 3300028380 Ga0268265_10266836 Ga0268265_102668361 240
63 3300005459 Ga0068867_100156989 Ga0068867_1001569893 241
64 3300009147 Ga0114129_10315021 Ga0114129_103150211 241
65 3300014325 Ga0163163_10087319 Ga0163163_100873192 241
66 3300025900 Ga0207710_10111340 Ga0207710_101113401 241
67 3300026089 Ga0207648_10123665 Ga0207648_101236653 241
68 3300050515 nmdc:mga0a205_487909_c1 nmdc:mga0a205_487909_c1_94_939 241
69 3300005354 Ga0070675_100020373 Ga0070675_1000203732 242
70 3300005354 Ga0070675_100124936 Ga0070675_1001249363 242
71 3300005365 Ga0070688_100387107 Ga0070688_1003871071 242
72 3300005459 Ga0068867_100055871 Ga0068867_1000558714 242
73 3300005544 Ga0070686_100257450 Ga0070686_1002574501 242
74 3300005617 Ga0068859_100429443 Ga0068859_1004294432 242
75 3300005617 Ga0068859_100552689 Ga0068859_1005526892 242
76 3300006844 Ga0075428_100049005 Ga0075428_1000490053 242
77 3300006931 Ga0097620_100429436 Ga0097620_1004294362 242
78 3300006931 Ga0097620_100552690 Ga0097620_1005526902 242
79 3300009094 Ga0111539_10000346 Ga0111539_1000034649 242
80 3300013308 Ga0157375_10117440 Ga0157375_101174404 242
81 3300025903 Ga0207680_10187124 Ga0207680_101871242 242
82 3300025960 Ga0207651_10053539 Ga0207651_100535392 242
83 3300026095 Ga0207676_10188252 Ga0207676_101882522 242
84 3300027907 Ga0207428_10066122 Ga0207428_100661222 242
85 3300050511 nmdc:mga08y16_633_c1 nmdc:mga08y16_633_c1_28877_29797 242
86 3300005295 Ga0065707_10100544 Ga0065707_101005442 243
87 3300005718 Ga0068866_10129378 Ga0068866_101293781 243
88 3300005842 Ga0068858_100283187 Ga0068858_1002831872 243
89 3300009148 Ga0105243_10629241 Ga0105243_106292411 243
90 3300005546 Ga0070696_100290922 Ga0070696_1002909222 244
91 3300014325 Ga0163163_10001210 Ga0163163_100012105 244
92 3300025925 Ga0207650_10362169 Ga0207650_103621691 244
93 3300035119 Ga0373956_0117948 Ga0373956_0117948_178_1035 244
94 3300036401 Ga0373937_0005432 Ga0373937_0005432_5989_6846 244
95 3300046511 Ga0495608_0019196 Ga0495608_0019196_2183_3040 244
96 3300046559 Ga0495667_0000530 Ga0495667_0000530_6639_7496 244
97 3300046675 Ga0495657_0002087 Ga0495657_0002087_5809_6666 244
98 3300047444 Ga0495675_0082435 Ga0495675_0082435_789_1646 244
99 3300053085 Ga0495619_0013570 Ga0495619_0013570_2510_3367 244
100 3300005457 Ga0070662_100102943 Ga0070662_1001029432 245
101 3300005617 Ga0068859_100044623 Ga0068859_1000446234 245
102 3300005842 Ga0068858_100354288 Ga0068858_1003542882 245
103 3300006931 Ga0097620_100044626 Ga0097620_1000446264 245
104 3300009098 Ga0105245_10211134 Ga0105245_102111341 245
105 3300009177 Ga0105248_10118294 Ga0105248_101182942 245
106 3300025960 Ga0207651_10026653 Ga0207651_100266533 245
107 3300026035 Ga0207703_10230172 Ga0207703_102301722 245
108 3300025933 Ga0207706_10338241 Ga0207706_103382411 246
109 3300039437 Ga0436365_0431582 Ga0436365_0431582_1009_1908 246
110 3300049575 Ga0501039_0347910 Ga0501039_0347910_209_1069 246
111 3300014326 Ga0157380_10791419 Ga0157380_107914191 248
112 3300017792 Ga0163161_10016153 Ga0163161_100161534 248
113 3300005518 Ga0070699_100297831 Ga0070699_1002978312 249
114 3300031731 Ga0307405_10003681 Ga0307405_100036814 249
115 3300031852 Ga0307410_10192067 Ga0307410_101920672 249
116 3300031901 Ga0307406_10082744 Ga0307406_100827442 249
117 3300031903 Ga0307407_10010413 Ga0307407_100104132 249
118 3300031995 Ga0307409_100041913 Ga0307409_1000419133 249
119 3300032005 Ga0307411_10053415 Ga0307411_100534153 249
120 3300005937 Ga0081455_10103906 Ga0081455_101039063 250
121 3300006852 Ga0075433_10001031 Ga0075433_100010319 250
122 3300006871 Ga0075434_100008867 Ga0075434_1000088679 250
123 3300006871 Ga0075434_100173501 Ga0075434_1001735012 250
124 3300007076 Ga0075435_100171294 Ga0075435_1001712942 250
125 3300009148 Ga0105243_10643400 Ga0105243_106434001 250
126 3300011119 Ga0105246_10042110 Ga0105246_100421102 250
127 3300025926 Ga0207659_10367985 Ga0207659_103679852 250
128 3300025941 Ga0207711_10206188 Ga0207711_102061882 250
129 3300025942 Ga0207689_10336978 Ga0207689_103369782 250
130 3300032002 Ga0307416_100357112 Ga0307416_1003571121 250
131 3300050512 nmdc:mga0n895_94925_c1 nmdc:mga0n895_94925_c1_737_1612 250
132 3300050513 nmdc:mga0rr50_56630_c1 nmdc:mga0rr50_56630_c1_1568_2437 250
133 3300050515 nmdc:mga0a205_968_c1 nmdc:mga0a205_968_c1_12349_13224 250
134 3300005331 Ga0070670_100003610 Ga0070670_1000036107 251
135 3300005564 Ga0070664_100007256 Ga0070664_1000072564 251
136 3300006844 Ga0075428_100008182 Ga0075428_1000081828 251
137 3300006852 Ga0075433_10135957 Ga0075433_101359572 251
138 3300006871 Ga0075434_100003772 Ga0075434_1000037729 251
139 3300006871 Ga0075434_100093482 Ga0075434_1000934823 251
140 3300007076 Ga0075435_100012783 Ga0075435_1000127834 251
141 3300014325 Ga0163163_10006039 Ga0163163_1000603911 251
142 3300025925 Ga0207650_10064006 Ga0207650_100640061 251
143 3300025945 Ga0207679_10022616 Ga0207679_100226162 251
144 3300032004 Ga0307414_10127830 Ga0307414_101278301 251
145 3300050512 nmdc:mga0n895_12520_c1 nmdc:mga0n895_12520_c1_2423_3256 251
146 3300050512 nmdc:mga0n895_206242_c1 nmdc:mga0n895_206242_c1_401_1318 251
147 3300050513 nmdc:mga0rr50_2248_c1 nmdc:mga0rr50_2248_c1_5282_6115 251
148 3300050515 nmdc:mga0a205_5202_c1 nmdc:mga0a205_5202_c1_4361_5194 251
149 3300005436 Ga0070713_100003664 Ga0070713_1000036643 252
150 3300005457 Ga0070662_100327435 Ga0070662_1003274352 252
151 3300005543 Ga0070672_100027805 Ga0070672_1000278052 252
152 3300025906 Ga0207699_10002035 Ga0207699_100020355 252
153 3300025940 Ga0207691_10058048 Ga0207691_100580482 252
154 3300050512 nmdc:mga0n895_1801_c1 nmdc:mga0n895_1801_c1_8168_9004 252
155 3300050515 nmdc:mga0a205_677_c1 nmdc:mga0a205_677_c1_22106_22942 252
156 3300009147 Ga0114129_10205067 Ga0114129_102050674 253
157 3300050507 nmdc:mga05p37_94836_c1 nmdc:mga05p37_94836_c1_1596_2501 253
158 3300005842 Ga0068858_100011619 Ga0068858_1000116196 254
159 3300009101 Ga0105247_10008052 Ga0105247_100080525 254
160 3300014326 Ga0157380_10035858 Ga0157380_100358583 254
161 3300014968 Ga0157379_10178445 Ga0157379_101784452 254
162 3300026035 Ga0207703_10083709 Ga0207703_100837091 254
163 3300028381 Ga0268264_10044965 Ga0268264_100449653 254
164 3300035113 Ga0373936_0074540 Ga0373936_0074540_170_1036 254
165 3300035116 Ga0373945_0069329 Ga0373945_0069329_131_997 254
166 3300035171 Ga0373946_0123435 Ga0373946_0123435_181_1047 254
167 3300035410 Ga0373924_0030575 Ga0373924_0030575_282_1148 254
168 3300035692 Ga0373935_0017730 Ga0373935_0017730_1671_2537 254
169 3300035725 Ga0373947_0024439 Ga0373947_0024439_730_1596 254
170 3300037068 Ga0373925_0007527 Ga0373925_0007527_2548_3414 254
171 3300025933 Ga0207706_10163892 Ga0207706_101638922 255
172 3300050507 nmdc:mga05p37_9724_c1 nmdc:mga05p37_9724_c1_5517_6407 255
173 3300050512 nmdc:mga0n895_60124_c1 nmdc:mga0n895_60124_c1_927_1817 255
174 3300050513 nmdc:mga0rr50_296796_c1 nmdc:mga0rr50_296796_c1_385_1275 255
175 3300050515 nmdc:mga0a205_46070_c1 nmdc:mga0a205_46070_c1_1105_1995 255
176 3300005844 Ga0068862_100258853 Ga0068862_1002588532 256
177 3300005985 Ga0081539_10000122 Ga0081539_10000122136 256
178 3300006846 Ga0075430_100259326 Ga0075430_1002593261 256
179 3300014745 Ga0157377_10040002 Ga0157377_100400022 256
180 3300014969 Ga0157376_10237151 Ga0157376_102371512 256
181 3300031911 Ga0307412_10045660 Ga0307412_100456603 256
182 3300032126 Ga0307415_100006236 Ga0307415_1000062365 256
183 3300005367 Ga0070667_100374091 Ga0070667_1003740911 257
184 3300005842 Ga0068858_100182667 Ga0068858_1001826671 257
185 3300009147 Ga0114129_10386991 Ga0114129_103869912 257
186 3300028380 Ga0268265_10255247 Ga0268265_102552472 257
187 3300050507 nmdc:mga05p37_268349_c1 nmdc:mga05p37_268349_c1_226_1143 257
188 3300005548 Ga0070665_100026145 Ga0070665_1000261455 258
189 3300006358 Ga0068871_100009976 Ga0068871_1000099765 258
190 3300006846 Ga0075430_100029518 Ga0075430_1000295183 258
191 3300006847 Ga0075431_100302909 Ga0075431_1003029092 258
192 3300006880 Ga0075429_100171244 Ga0075429_1001712443 258
193 3300006881 Ga0068865_100013702 Ga0068865_1000137022 258
194 3300025938 Ga0207704_10017260 Ga0207704_100172603 258
195 3300027907 Ga0207428_10003565 Ga0207428_100035652 258
196 3300046462 Ga0495651_0248618 Ga0495651_0248618_254_1144 258
197 3300046516 Ga0495628_0093169 Ga0495628_0093169_1405_2295 258
198 3300046543 Ga0495645_0050308 Ga0495645_0050308_762_1652 258
199 3300047317 Ga0495604_0051668 Ga0495604_0051668_690_1580 258
200 3300047319 Ga0495674_0201208 Ga0495674_0201208_512_1402 258
201 3300047471 Ga0495684_0002524 Ga0495684_0002524_12988_13878 258
202 3300049679 Ga0501249_033419 Ga0501249_033419_227_1138 258
203 3300050508 nmdc:mga09592_57285_c1 nmdc:mga09592_57285_c1_1928_2818 258
204 3300050509 nmdc:mga0qj67_26512_c1 nmdc:mga0qj67_26512_c1_1874_2764 258
205 3300050510 nmdc:mga06r32_164155_c1 nmdc:mga06r32_164155_c1_734_1624 258
206 3300050511 nmdc:mga08y16_473_c1 nmdc:mga08y16_473_c1_10857_11690 258
207 3300053077 Ga0495601_0005875 Ga0495601_0005875_805_1695 258
208 3300053085 Ga0495619_0005975 Ga0495619_0005975_6071_6961 258
209 3300005331 Ga0070670_100011107 Ga0070670_10001110710 259
210 3300005335 Ga0070666_10130704 Ga0070666_101307043 259
211 3300005338 Ga0068868_100005627 Ga0068868_1000056276 259
212 3300005354 Ga0070675_100003474 Ga0070675_1000034746 259
213 3300005354 Ga0070675_100320178 Ga0070675_1003201782 259
214 3300005356 Ga0070674_100120486 Ga0070674_1001204862 259
215 3300005367 Ga0070667_100019984 Ga0070667_1000199841 259
216 3300005466 Ga0070685_10004711 Ga0070685_100047112 259
217 3300005543 Ga0070672_100005375 Ga0070672_1000053756 259
218 3300005564 Ga0070664_100005088 Ga0070664_1000050886 259
219 3300005618 Ga0068864_100022045 Ga0068864_1000220459 259
220 3300005618 Ga0068864_100213763 Ga0068864_1002137632 259
221 3300005841 Ga0068863_100013933 Ga0068863_1000139335 259
222 3300006844 Ga0075428_100120827 Ga0075428_1001208272 259
223 3300009177 Ga0105248_10035394 Ga0105248_100353943 259
224 3300009177 Ga0105248_10577393 Ga0105248_105773931 259
225 3300013296 Ga0157374_10235803 Ga0157374_102358032 259
226 3300013306 Ga0163162_10008793 Ga0163162_100087938 259
227 3300013308 Ga0157375_10004613 Ga0157375_100046132 259
228 3300025903 Ga0207680_10003226 Ga0207680_100032265 259
229 3300025918 Ga0207662_10292610 Ga0207662_102926101 259
230 3300025920 Ga0207649_10032852 Ga0207649_100328524 259
231 3300025925 Ga0207650_10011611 Ga0207650_100116112 259
232 3300025926 Ga0207659_10000800 Ga0207659_1000080013 259
233 3300025926 Ga0207659_10249869 Ga0207659_102498692 259
234 3300025936 Ga0207670_10238434 Ga0207670_102384343 259
235 3300025937 Ga0207669_10210500 Ga0207669_102105002 259
236 3300025940 Ga0207691_10009685 Ga0207691_100096856 259
237 3300025941 Ga0207711_10430852 Ga0207711_104308521 259
238 3300025942 Ga0207689_10168934 Ga0207689_101689344 259
239 3300025945 Ga0207679_10003529 Ga0207679_100035293 259
240 3300026023 Ga0207677_10008423 Ga0207677_100084233 259
241 3300026088 Ga0207641_10037587 Ga0207641_100375873 259
242 3300026095 Ga0207676_10188951 Ga0207676_101889513 259
243 3300026095 Ga0207676_10589452 Ga0207676_105894522 259
244 3300035117 Ga0373953_0152935 Ga0373953_0152935_47_949 259
245 3300035120 Ga0373957_0034092 Ga0373957_0034092_757_1659 259
246 3300035172 Ga0373955_0106443 Ga0373955_0106443_600_1502 259
247 3300035725 Ga0373947_0079405 Ga0373947_0079405_149_1048 259
248 3300036401 Ga0373937_0035441 Ga0373937_0035441_1607_2509 259
249 3300046454 Ga0495592_0029266 Ga0495592_0029266_849_1751 259
250 3300046459 Ga0495629_0105663 Ga0495629_0105663_832_1731 259
251 3300046514 Ga0495618_0083401 Ga0495618_0083401_765_1667 259
252 3300046516 Ga0495628_0260231 Ga0495628_0260231_127_1029 259
253 3300046678 Ga0495599_0133187 Ga0495599_0133187_119_1021 259
254 3300046681 Ga0495647_0036040 Ga0495647_0036040_771_1673 259
255 3300046689 Ga0495613_0019352 Ga0495613_0019352_845_1747 259
256 3300047471 Ga0495684_0286104 Ga0495684_0286104_37_939 259
257 3300005290 Ga0065712_10083559 Ga0065712_100835592 260
258 3300005328 Ga0070676_10262806 Ga0070676_102628061 260
259 3300005331 Ga0070670_100013237 Ga0070670_1000132375 260
260 3300005333 Ga0070677_10015657 Ga0070677_100156572 260
261 3300005338 Ga0068868_100090910 Ga0068868_1000909102 260
262 3300005353 Ga0070669_100041601 Ga0070669_1000416013 260
263 3300005354 Ga0070675_100015188 Ga0070675_1000151885 260
264 3300005355 Ga0070671_100235256 Ga0070671_1002352562 260
265 3300005355 Ga0070671_100251600 Ga0070671_1002516002 260
266 3300005356 Ga0070674_100000133 Ga0070674_1000001332 260
267 3300005356 Ga0070674_100058877 Ga0070674_1000588771 260
268 3300005364 Ga0070673_100253777 Ga0070673_1002537772 260
269 3300005365 Ga0070688_100018631 Ga0070688_1000186313 260
270 3300005365 Ga0070688_100027650 Ga0070688_10002765011 260
271 3300005365 Ga0070688_100045596 Ga0070688_1000455962 260
272 3300005367 Ga0070667_100016163 Ga0070667_1000161633 260
273 3300005367 Ga0070667_100292675 Ga0070667_1002926752 260
274 3300005457 Ga0070662_100147978 Ga0070662_1001479782 260
275 3300005466 Ga0070685_10034529 Ga0070685_100345293 260
276 3300005548 Ga0070665_100346881 Ga0070665_1003468812 260
277 3300005564 Ga0070664_100266974 Ga0070664_1002669742 260
278 3300005564 Ga0070664_100594443 Ga0070664_1005944431 260
279 3300005577 Ga0068857_100101000 Ga0068857_1001010003 260
280 3300005615 Ga0070702_100129074 Ga0070702_1001290742 260
281 3300005617 Ga0068859_100001842 Ga0068859_10000184213 260
282 3300005617 Ga0068859_100019594 Ga0068859_1000195945 260
283 3300005617 Ga0068859_100601842 Ga0068859_1006018422 260
284 3300005841 Ga0068863_100039723 Ga0068863_1000397233 260
285 3300005841 Ga0068863_100503649 Ga0068863_1005036491 260
286 3300005842 Ga0068858_100085009 Ga0068858_1000850094 260
287 3300005843 Ga0068860_100010554 Ga0068860_1000105543 260
288 3300006358 Ga0068871_100042792 Ga0068871_1000427923 260
289 3300006880 Ga0075429_100184361 Ga0075429_1001843613 260
290 3300006881 Ga0068865_100034455 Ga0068865_1000344552 260
291 3300006931 Ga0097620_100001842 Ga0097620_10000184213 260
292 3300006931 Ga0097620_100019594 Ga0097620_1000195945 260
293 3300006931 Ga0097620_100601888 Ga0097620_1006018882 260
294 3300009094 Ga0111539_10060260 Ga0111539_100602606 260
295 3300009094 Ga0111539_10170973 Ga0111539_101709732 260
296 3300009177 Ga0105248_10027945 Ga0105248_100279454 260
297 3300009177 Ga0105248_10128786 Ga0105248_101287862 260
298 3300009553 Ga0105249_10226882 Ga0105249_102268824 260
299 3300013306 Ga0163162_10052455 Ga0163162_100524552 260
300 3300013308 Ga0157375_10029990 Ga0157375_100299902 260
301 3300014325 Ga0163163_10017312 Ga0163163_100173123 260
302 3300014325 Ga0163163_10371319 Ga0163163_103713191 260
303 3300014326 Ga0157380_10015280 Ga0157380_100152802 260
304 3300014968 Ga0157379_10004091 Ga0157379_100040918 260
305 3300014969 Ga0157376_10016358 Ga0157376_100163583 260
306 3300014969 Ga0157376_10088978 Ga0157376_100889783 260
307 3300025893 Ga0207682_10004725 Ga0207682_100047255 260
308 3300025893 Ga0207682_10012622 Ga0207682_100126223 260
309 3300025908 Ga0207643_10008248 Ga0207643_100082483 260
310 3300025923 Ga0207681_10032692 Ga0207681_100326923 260
311 3300025925 Ga0207650_10023059 Ga0207650_100230593 260
312 3300025925 Ga0207650_10146907 Ga0207650_101469072 260
313 3300025926 Ga0207659_10141832 Ga0207659_101418322 260
314 3300025926 Ga0207659_10285691 Ga0207659_102856912 260
315 3300025931 Ga0207644_10046973 Ga0207644_100469732 260
316 3300025933 Ga0207706_10051823 Ga0207706_100518233 260
317 3300025937 Ga0207669_10012777 Ga0207669_100127772 260
318 3300025938 Ga0207704_10031229 Ga0207704_100312293 260
319 3300025940 Ga0207691_10002350 Ga0207691_100023507 260
320 3300025941 Ga0207711_10015481 Ga0207711_100154813 260
321 3300025941 Ga0207711_10080801 Ga0207711_100808012 260
322 3300025960 Ga0207651_10087756 Ga0207651_100877562 260
323 3300025960 Ga0207651_10240407 Ga0207651_102404072 260
324 3300025986 Ga0207658_10226594 Ga0207658_102265942 260
325 3300026023 Ga0207677_10067822 Ga0207677_100678223 260
326 3300026035 Ga0207703_10115846 Ga0207703_101158462 260
327 3300026088 Ga0207641_10711705 Ga0207641_107117051 260
328 3300026089 Ga0207648_10121297 Ga0207648_101212972 260
329 3300026095 Ga0207676_10086046 Ga0207676_100860462 260
330 3300026118 Ga0207675_100068340 Ga0207675_1000683403 260
331 3300026121 Ga0207683_10196221 Ga0207683_101962212 260
332 3300028379 Ga0268266_10322458 Ga0268266_103224582 260
333 3300028381 Ga0268264_10020334 Ga0268264_100203343 260
334 3300005353 Ga0070669_100029313 Ga0070669_1000293133 261
335 3300005353 Ga0070669_100354672 Ga0070669_1003546721 261
336 3300005356 Ga0070674_100037477 Ga0070674_1000374772 261
337 3300005356 Ga0070674_100358583 Ga0070674_1003585831 261
338 3300005457 Ga0070662_100095725 Ga0070662_1000957252 261
339 3300005468 Ga0070707_100051050 Ga0070707_1000510502 261
340 3300006237 Ga0097621_100057797 Ga0097621_1000577974 261
341 3300006844 Ga0075428_100000223 Ga0075428_10000022310 261
342 3300006844 Ga0075428_100207298 Ga0075428_1002072982 261
343 3300006846 Ga0075430_100000204 Ga0075430_10000020426 261
344 3300006847 Ga0075431_100000010 Ga0075431_1000000109 261
345 3300006847 Ga0075431_100203598 Ga0075431_1002035982 261
346 3300006852 Ga0075433_10021988 Ga0075433_100219883 261
347 3300006880 Ga0075429_100013114 Ga0075429_1000131142 261
348 3300006880 Ga0075429_100072847 Ga0075429_1000728473 261
349 3300009147 Ga0114129_10000654 Ga0114129_1000065434 261
350 3300009147 Ga0114129_10069891 Ga0114129_100698912 261
351 3300009147 Ga0114129_10166196 Ga0114129_101661962 261
352 3300009147 Ga0114129_10741031 Ga0114129_107410311 261
353 3300009176 Ga0105242_10050182 Ga0105242_100501824 261
354 3300025903 Ga0207680_10081476 Ga0207680_100814762 261
355 3300025922 Ga0207646_10002815 Ga0207646_100028151 261
356 3300025934 Ga0207686_10027544 Ga0207686_100275443 261
357 3300025942 Ga0207689_10194752 Ga0207689_101947522 261
358 3300025960 Ga0207651_10331124 Ga0207651_103311241 261
359 3300042993 Ga0439440_0032211 Ga0439440_0032211_112_1002 261
360 3300050507 nmdc:mga05p37_30050_c1 nmdc:mga05p37_30050_c1_5400_6317 261
361 3300050507 nmdc:mga05p37_40258_c1 nmdc:mga05p37_40258_c1_3128_4018 261
362 3300050508 nmdc:mga09592_1217_c1 nmdc:mga09592_1217_c1_10506_11396 261
363 3300050509 nmdc:mga0qj67_430_c1 nmdc:mga0qj67_430_c1_18586_19476 261
364 3300050510 nmdc:mga06r32_171_c1 nmdc:mga06r32_171_c1_9219_10109 261
365 3300050512 nmdc:mga0n895_522147_c1 nmdc:mga0n895_522147_c1_235_1143 261
366 3300050513 nmdc:mga0rr50_135205_c1 nmdc:mga0rr50_135205_c1_18_935 261
367 3300001977 JGI24746J21847_1009169 JGI24746J21847_10091692 262
368 3300003203 JGI25406J46586_10001063 JGI25406J46586_100010637 262
369 3300003203 JGI25406J46586_10007609 JGI25406J46586_100076092 262
370 3300005290 Ga0065712_10081022 Ga0065712_100810222 262
371 3300005328 Ga0070676_10019382 Ga0070676_100193822 262
372 3300005330 Ga0070690_100011719 Ga0070690_1000117191 262
373 3300005333 Ga0070677_10003864 Ga0070677_100038643 262
374 3300005334 Ga0068869_100041913 Ga0068869_1000419132 262
375 3300005334 Ga0068869_100044457 Ga0068869_1000444571 262
376 3300005334 Ga0068869_100056857 Ga0068869_1000568572 262
377 3300005334 Ga0068869_100103843 Ga0068869_1001038432 262
378 3300005338 Ga0068868_100067165 Ga0068868_1000671653 262
379 3300005340 Ga0070689_100240479 Ga0070689_1002404792 262
380 3300005344 Ga0070661_100079775 Ga0070661_1000797751 262
381 3300005345 Ga0070692_10131378 Ga0070692_101313781 262
382 3300005353 Ga0070669_100031606 Ga0070669_1000316063 262
383 3300005354 Ga0070675_100001766 Ga0070675_10000176613 262
384 3300005354 Ga0070675_100003808 Ga0070675_1000038085 262
385 3300005354 Ga0070675_100011430 Ga0070675_1000114307 262
386 3300005356 Ga0070674_100008932 Ga0070674_1000089322 262
387 3300005356 Ga0070674_100034226 Ga0070674_1000342265 262
388 3300005365 Ga0070688_100026973 Ga0070688_1000269733 262
389 3300005366 Ga0070659_100446266 Ga0070659_1004462661 262
390 3300005367 Ga0070667_100439717 Ga0070667_1004397171 262
391 3300005438 Ga0070701_10116253 Ga0070701_101162532 262
392 3300005439 Ga0070711_100077247 Ga0070711_1000772474 262
393 3300005441 Ga0070700_100118859 Ga0070700_1001188591 262
394 3300005441 Ga0070700_100162692 Ga0070700_1001626921 262
395 3300005455 Ga0070663_100044452 Ga0070663_1000444522 262
396 3300005455 Ga0070663_100416793 Ga0070663_1004167931 262
397 3300005456 Ga0070678_100019918 Ga0070678_1000199182 262
398 3300005459 Ga0068867_100039682 Ga0068867_1000396821 262
399 3300005459 Ga0068867_100069789 Ga0068867_1000697893 262
400 3300005466 Ga0070685_10009319 Ga0070685_100093193 262
401 3300005543 Ga0070672_100042658 Ga0070672_1000426583 262
402 3300005543 Ga0070672_100082606 Ga0070672_1000826061 262
403 3300005546 Ga0070696_100232334 Ga0070696_1002323342 262
404 3300005548 Ga0070665_100495536 Ga0070665_1004955362 262
405 3300005548 Ga0070665_100543588 Ga0070665_1005435881 262
406 3300005564 Ga0070664_100001335 Ga0070664_10000133510 262
407 3300005617 Ga0068859_100055531 Ga0068859_1000555313 262
408 3300005617 Ga0068859_100202153 Ga0068859_1002021532 262
409 3300005617 Ga0068859_100202736 Ga0068859_1002027361 262
410 3300005719 Ga0068861_100017412 Ga0068861_1000174123 262
411 3300005840 Ga0068870_10034313 Ga0068870_100343132 262
412 3300005841 Ga0068863_100004914 Ga0068863_1000049149 262
413 3300005842 Ga0068858_100302731 Ga0068858_1003027312 262
414 3300005843 Ga0068860_100468255 Ga0068860_1004682552 262
415 3300005844 Ga0068862_100451630 Ga0068862_1004516301 262
416 3300005985 Ga0081539_10000802 Ga0081539_1000080246 262
417 3300005985 Ga0081539_10004492 Ga0081539_1000449211 262
418 3300006175 Ga0070712_100554178 Ga0070712_1005541781 262
419 3300006237 Ga0097621_100000879 Ga0097621_1000008797 262
420 3300006237 Ga0097621_100160380 Ga0097621_1001603801 262
421 3300006358 Ga0068871_100001795 Ga0068871_1000017959 262
422 3300006358 Ga0068871_100118706 Ga0068871_1001187063 262
423 3300006844 Ga0075428_100003285 Ga0075428_10000328515 262
424 3300006844 Ga0075428_100053226 Ga0075428_1000532262 262
425 3300006846 Ga0075430_100019847 Ga0075430_1000198475 262
426 3300006847 Ga0075431_100011236 Ga0075431_1000112364 262
427 3300006852 Ga0075433_10007405 Ga0075433_100074054 262
428 3300006871 Ga0075434_100007227 Ga0075434_1000072274 262
429 3300006871 Ga0075434_100106365 Ga0075434_1001063653 262
430 3300006880 Ga0075429_100005117 Ga0075429_1000051173 262
431 3300006880 Ga0075429_100096396 Ga0075429_1000963964 262
432 3300006880 Ga0075429_100193136 Ga0075429_1001931362 262
433 3300006931 Ga0097620_100055527 Ga0097620_1000555271 262
434 3300006931 Ga0097620_100202155 Ga0097620_1002021552 262
435 3300006931 Ga0097620_100202731 Ga0097620_1002027311 262
436 3300007076 Ga0075435_100027176 Ga0075435_1000271762 262
437 3300009094 Ga0111539_10141248 Ga0111539_101412483 262
438 3300009177 Ga0105248_10066475 Ga0105248_100664755 262
439 3300009177 Ga0105248_10557827 Ga0105248_105578272 262
440 3300009553 Ga0105249_10052113 Ga0105249_100521133 262
441 3300013296 Ga0157374_10430248 Ga0157374_104302482 262
442 3300013306 Ga0163162_10056395 Ga0163162_100563953 262
443 3300014325 Ga0163163_10396017 Ga0163163_103960172 262
444 3300014326 Ga0157380_10009742 Ga0157380_100097423 262
445 3300014745 Ga0157377_10007267 Ga0157377_100072673 262
446 3300014968 Ga0157379_10038723 Ga0157379_100387234 262
447 3300014969 Ga0157376_10137656 Ga0157376_101376562 262
448 3300017792 Ga0163161_10021887 Ga0163161_100218872 262
449 3300017792 Ga0163161_10156445 Ga0163161_101564453 262
450 3300025315 Ga0207697_10006279 Ga0207697_100062796 262
451 3300025893 Ga0207682_10002558 Ga0207682_100025585 262
452 3300025901 Ga0207688_10010364 Ga0207688_100103643 262
453 3300025903 Ga0207680_10132385 Ga0207680_101323852 262
454 3300025907 Ga0207645_10014571 Ga0207645_100145713 262
455 3300025908 Ga0207643_10006940 Ga0207643_100069402 262
456 3300025908 Ga0207643_10025416 Ga0207643_100254163 262
457 3300025916 Ga0207663_10067844 Ga0207663_100678442 262
458 3300025916 Ga0207663_10101732 Ga0207663_101017324 262
459 3300025918 Ga0207662_10054468 Ga0207662_100544682 262
460 3300025923 Ga0207681_10004954 Ga0207681_100049545 262
461 3300025925 Ga0207650_10289887 Ga0207650_102898872 262
462 3300025926 Ga0207659_10002171 Ga0207659_1000217112 262
463 3300025926 Ga0207659_10029335 Ga0207659_100293351 262
464 3300025926 Ga0207659_10373495 Ga0207659_103734952 262
465 3300025933 Ga0207706_10034472 Ga0207706_100344723 262
466 3300025936 Ga0207670_10030042 Ga0207670_100300422 262
467 3300025936 Ga0207670_10258955 Ga0207670_102589551 262
468 3300025937 Ga0207669_10012789 Ga0207669_100127895 262
469 3300025940 Ga0207691_10016451 Ga0207691_100164515 262
470 3300025940 Ga0207691_10076641 Ga0207691_100766413 262
471 3300025941 Ga0207711_10091070 Ga0207711_100910703 262
472 3300025941 Ga0207711_10647862 Ga0207711_106478621 262
473 3300025942 Ga0207689_10012974 Ga0207689_100129743 262
474 3300025942 Ga0207689_10069550 Ga0207689_100695502 262
475 3300025942 Ga0207689_10077377 Ga0207689_100773772 262
476 3300025942 Ga0207689_10101890 Ga0207689_101018902 262
477 3300025960 Ga0207651_10092233 Ga0207651_100922332 262
478 3300025960 Ga0207651_10129468 Ga0207651_101294682 262
479 3300025986 Ga0207658_10462225 Ga0207658_104622251 262
480 3300026035 Ga0207703_10069837 Ga0207703_100698373 262
481 3300026035 Ga0207703_10102189 Ga0207703_101021892 262
482 3300026067 Ga0207678_10053545 Ga0207678_100535453 262
483 3300026067 Ga0207678_10441175 Ga0207678_104411751 262
484 3300026088 Ga0207641_10002863 Ga0207641_100028635 262
485 3300026089 Ga0207648_10017814 Ga0207648_100178143 262
486 3300026089 Ga0207648_10065467 Ga0207648_100654672 262
487 3300026089 Ga0207648_10087168 Ga0207648_100871683 262
488 3300026118 Ga0207675_100016551 Ga0207675_1000165514 262
489 3300026118 Ga0207675_100544983 Ga0207675_1005449832 262
490 3300026121 Ga0207683_10034489 Ga0207683_100344892 262
491 3300026121 Ga0207683_10134461 Ga0207683_101344611 262
492 3300027907 Ga0207428_10000618 Ga0207428_1000061826 262
493 3300027907 Ga0207428_10001221 Ga0207428_1000122113 262
494 3300027907 Ga0207428_10033873 Ga0207428_100338733 262
495 3300028379 Ga0268266_10247723 Ga0268266_102477232 262
496 3300028380 Ga0268265_10414751 Ga0268265_104147512 262
497 3300028381 Ga0268264_10209007 Ga0268264_102090072 262
498 3300035112 Ga0373932_0018294 Ga0373932_0018294_708_1619 262
499 3300036401 Ga0373937_0160740 Ga0373937_0160740_239_1129 262
500 3300042461 Ga0439460_0044462 Ga0439460_0044462_286_1212 262
501 3300046539 Ga0495621_0081721 Ga0495621_0081721_239_1138 262
502 3300049572 Ga0501036_0005722 Ga0501036_0005722_6584_7513 262
503 3300049574 Ga0501038_0064963 Ga0501038_0064963_92_1021 262
504 3300049575 Ga0501039_0032334 Ga0501039_0032334_1763_2689 262
505 3300049576 Ga0501040_0010271 Ga0501040_0010271_3616_4545 262
506 3300049577 Ga0501041_0010644 Ga0501041_0010644_2086_3015 262
507 3300049578 Ga0501042_0043694 Ga0501042_0043694_2160_3089 262
508 3300049587 Ga0501071_0008059 Ga0501071_0008059_121_1050 262
509 3300049588 Ga0501072_0128557 Ga0501072_0128557_781_1710 262
510 3300049591 Ga0501075_0048441 Ga0501075_0048441_2161_3090 262
511 3300049592 Ga0501076_0001241 Ga0501076_0001241_3120_4049 262
512 3300049822 Ga0501035_0289726 Ga0501035_0289726_75_1004 262
513 3300050507 nmdc:mga05p37_411408_c1 nmdc:mga05p37_411408_c1_269_1183 262
514 3300050508 nmdc:mga09592_198780_c1 nmdc:mga09592_198780_c1_313_1224 262
515 3300050508 nmdc:mga09592_215750_c1 nmdc:mga09592_215750_c1_369_1283 262
516 3300050508 nmdc:mga09592_59566_c1 nmdc:mga09592_59566_c1_2138_3049 262
517 3300050509 nmdc:mga0qj67_100580_c1 nmdc:mga0qj67_100580_c1_896_1810 262
518 3300050509 nmdc:mga0qj67_17914_c1 nmdc:mga0qj67_17914_c1_198_1109 262
519 3300050510 nmdc:mga06r32_5796_c1 nmdc:mga06r32_5796_c1_5467_6378 262
520 3300050511 nmdc:mga08y16_6501_c1 nmdc:mga08y16_6501_c1_11277_12191 262
521 3300050512 nmdc:mga0n895_143025_c1 nmdc:mga0n895_143025_c1_58_969 262
522 3300050512 nmdc:mga0n895_3812_c1 nmdc:mga0n895_3812_c1_6452_7366 262
523 3300050513 nmdc:mga0rr50_30897_c1 nmdc:mga0rr50_30897_c1_2389_3303 262
524 3300050515 nmdc:mga0a205_436_c1 nmdc:mga0a205_436_c1_4254_5168 262
525 3300050515 nmdc:mga0a205_51477_c1 nmdc:mga0a205_51477_c1_239_1150 262
526 3300053077 Ga0495601_0054841 Ga0495601_0054841_1458_2348 262
527 3300060353 Ga0501082_0034194 Ga0501082_0034194_1182_2111 262
528 3300005330 Ga0070690_100055681 Ga0070690_1000556812 263
529 3300005334 Ga0068869_100061499 Ga0068869_1000614992 263
530 3300005334 Ga0068869_100093838 Ga0068869_1000938382 263
531 3300005334 Ga0068869_100209863 Ga0068869_1002098631 263
532 3300005353 Ga0070669_100037887 Ga0070669_1000378873 263
533 3300005353 Ga0070669_100158971 Ga0070669_1001589712 263
534 3300005354 Ga0070675_100147705 Ga0070675_1001477052 263
535 3300005356 Ga0070674_100000107 Ga0070674_1000001074 263
536 3300005364 Ga0070673_100129633 Ga0070673_1001296332 263
537 3300005367 Ga0070667_100019853 Ga0070667_1000198531 263
538 3300005438 Ga0070701_10268681 Ga0070701_102686811 263
539 3300005456 Ga0070678_100025309 Ga0070678_1000253093 263
540 3300005456 Ga0070678_100184906 Ga0070678_1001849061 263
541 3300005466 Ga0070685_10168334 Ga0070685_101683342 263
542 3300005543 Ga0070672_100211694 Ga0070672_1002116942 263
543 3300005544 Ga0070686_100169390 Ga0070686_1001693901 263
544 3300005564 Ga0070664_100024185 Ga0070664_1000241851 263
545 3300005617 Ga0068859_100072491 Ga0068859_1000724913 263
546 3300005617 Ga0068859_100463883 Ga0068859_1004638832 263
547 3300005719 Ga0068861_100165426 Ga0068861_1001654262 263
548 3300006852 Ga0075433_10005893 Ga0075433_100058932 263
549 3300006931 Ga0097620_100072493 Ga0097620_1000724933 263
550 3300006931 Ga0097620_100463874 Ga0097620_1004638742 263
551 3300009177 Ga0105248_10114919 Ga0105248_101149193 263
552 3300009177 Ga0105248_10709913 Ga0105248_107099132 263
553 3300011119 Ga0105246_10094971 Ga0105246_100949712 263
554 3300012510 Ga0157316_1002466 Ga0157316_10024662 263
555 3300013306 Ga0163162_10463854 Ga0163162_104638541 263
556 3300014325 Ga0163163_10075565 Ga0163163_100755651 263
557 3300014325 Ga0163163_10288277 Ga0163163_102882772 263
558 3300014326 Ga0157380_10015668 Ga0157380_100156684 263
559 3300014326 Ga0157380_10073089 Ga0157380_100730892 263
560 3300014326 Ga0157380_10288644 Ga0157380_102886442 263
561 3300014968 Ga0157379_10495435 Ga0157379_104954352 263
562 3300025315 Ga0207697_10004040 Ga0207697_100040406 263
563 3300025893 Ga0207682_10002025 Ga0207682_100020252 263
564 3300025907 Ga0207645_10006753 Ga0207645_100067533 263
565 3300025907 Ga0207645_10281197 Ga0207645_102811972 263
566 3300025908 Ga0207643_10002677 Ga0207643_100026775 263
567 3300025918 Ga0207662_10020193 Ga0207662_100201933 263
568 3300025918 Ga0207662_10077898 Ga0207662_100778981 263
569 3300025923 Ga0207681_10018621 Ga0207681_100186212 263
570 3300025923 Ga0207681_10102129 Ga0207681_101021292 263
571 3300025925 Ga0207650_10490317 Ga0207650_104903171 263
572 3300025926 Ga0207659_10011805 Ga0207659_100118053 263
573 3300025926 Ga0207659_10013317 Ga0207659_100133172 263
574 3300025926 Ga0207659_10023385 Ga0207659_100233852 263
575 3300025926 Ga0207659_10048561 Ga0207659_100485612 263
576 3300025936 Ga0207670_10080578 Ga0207670_100805781 263
577 3300025937 Ga0207669_10003575 Ga0207669_100035755 263
578 3300025940 Ga0207691_10015109 Ga0207691_100151094 263
579 3300025940 Ga0207691_10031212 Ga0207691_100312124 263
580 3300025941 Ga0207711_10072694 Ga0207711_100726943 263
581 3300025942 Ga0207689_10010817 Ga0207689_100108173 263
582 3300025942 Ga0207689_10062617 Ga0207689_100626173 263
583 3300025986 Ga0207658_10152857 Ga0207658_101528572 263
584 3300026067 Ga0207678_10247085 Ga0207678_102470851 263
585 3300026075 Ga0207708_10039136 Ga0207708_100391363 263
586 3300026088 Ga0207641_10013185 Ga0207641_100131856 263
587 3300026118 Ga0207675_100014394 Ga0207675_1000143946 263
588 3300026121 Ga0207683_10143724 Ga0207683_101437241 263
589 3300026121 Ga0207683_10178820 Ga0207683_101788201 263
590 3300027907 Ga0207428_10009046 Ga0207428_100090462 263
591 3300041512 Ga0451853_0755240 Ga0451853_0755240_158_1102 263
592 3300048904 Ga0496101_0008516 Ga0496101_0008516_2263_3165 263
593 3300048909 Ga0496106_0025746 Ga0496106_0025746_1810_2712 263
594 3300048917 Ga0496114_0001268 Ga0496114_0001268_956_1858 263
595 3300050511 nmdc:mga08y16_269604_c1 nmdc:mga08y16_269604_c1_754_1668 263
596 3300050511 nmdc:mga08y16_75660_c1 nmdc:mga08y16_75660_c1_558_1451 263
597 3300050515 nmdc:mga0a205_79066_c1 nmdc:mga0a205_79066_c1_43_936 263
598 3300005328 Ga0070676_10008646 Ga0070676_100086465 264
599 3300005328 Ga0070676_10025553 Ga0070676_100255534 264
600 3300005330 Ga0070690_100016542 Ga0070690_1000165423 264
601 3300005333 Ga0070677_10008361 Ga0070677_100083611 264
602 3300005334 Ga0068869_100002654 Ga0068869_10000265410 264
603 3300005334 Ga0068869_100009363 Ga0068869_1000093632 264
604 3300005340 Ga0070689_100059652 Ga0070689_1000596522 264
605 3300005353 Ga0070669_100008384 Ga0070669_1000083843 264
606 3300005354 Ga0070675_100009464 Ga0070675_1000094642 264
607 3300005354 Ga0070675_100050279 Ga0070675_1000502794 264
608 3300005364 Ga0070673_100004621 Ga0070673_1000046211 264
609 3300005364 Ga0070673_100173279 Ga0070673_1001732792 264
610 3300005438 Ga0070701_10010641 Ga0070701_100106412 264
611 3300005441 Ga0070700_100000833 Ga0070700_1000008332 264
612 3300005441 Ga0070700_100005699 Ga0070700_1000056993 264
613 3300005459 Ga0068867_100000229 Ga0068867_1000002299 264
614 3300005459 Ga0068867_100011607 Ga0068867_1000116074 264
615 3300005543 Ga0070672_100001789 Ga0070672_10000178912 264
616 3300005578 Ga0068854_100070505 Ga0068854_1000705053 264
617 3300005615 Ga0070702_100213273 Ga0070702_1002132731 264
618 3300005718 Ga0068866_10008287 Ga0068866_100082874 264
619 3300005719 Ga0068861_100011926 Ga0068861_1000119263 264
620 3300005719 Ga0068861_100033380 Ga0068861_1000333802 264
621 3300005842 Ga0068858_100012888 Ga0068858_1000128883 264
622 3300005842 Ga0068858_100028497 Ga0068858_1000284972 264
623 3300006844 Ga0075428_100099759 Ga0075428_1000997593 264
624 3300006846 Ga0075430_100228424 Ga0075430_1002284242 264
625 3300006881 Ga0068865_100017243 Ga0068865_1000172433 264
626 3300006881 Ga0068865_100024156 Ga0068865_1000241565 264
627 3300009148 Ga0105243_10043964 Ga0105243_100439645 264
628 3300009148 Ga0105243_10316252 Ga0105243_103162522 264
629 3300009176 Ga0105242_10009191 Ga0105242_100091913 264
630 3300014326 Ga0157380_10108759 Ga0157380_101087592 264
631 3300014968 Ga0157379_10500502 Ga0157379_105005022 264
632 3300025899 Ga0207642_10003899 Ga0207642_100038993 264
633 3300025899 Ga0207642_10008147 Ga0207642_100081472 264
634 3300025903 Ga0207680_10128487 Ga0207680_101284871 264
635 3300025907 Ga0207645_10005120 Ga0207645_100051202 264
636 3300025907 Ga0207645_10016114 Ga0207645_100161142 264
637 3300025908 Ga0207643_10191545 Ga0207643_101915451 264
638 3300025923 Ga0207681_10024808 Ga0207681_100248083 264
639 3300025923 Ga0207681_10027381 Ga0207681_100273813 264
640 3300025926 Ga0207659_10021292 Ga0207659_100212922 264
641 3300025933 Ga0207706_10171224 Ga0207706_101712242 264
642 3300025934 Ga0207686_10021133 Ga0207686_100211333 264
643 3300025935 Ga0207709_10126532 Ga0207709_101265322 264
644 3300025936 Ga0207670_10127714 Ga0207670_101277143 264
645 3300025937 Ga0207669_10108875 Ga0207669_101088753 264
646 3300025938 Ga0207704_10001885 Ga0207704_100018855 264
647 3300025938 Ga0207704_10195677 Ga0207704_101956772 264
648 3300025940 Ga0207691_10020516 Ga0207691_100205164 264
649 3300025941 Ga0207711_10163033 Ga0207711_101630333 264
650 3300025942 Ga0207689_10002803 Ga0207689_100028035 264
651 3300025942 Ga0207689_10016858 Ga0207689_100168586 264
652 3300025960 Ga0207651_10112288 Ga0207651_101122881 264
653 3300025981 Ga0207640_10022033 Ga0207640_100220332 264
654 3300026035 Ga0207703_10095736 Ga0207703_100957363 264
655 3300026035 Ga0207703_10344025 Ga0207703_103440252 264
656 3300026075 Ga0207708_10003780 Ga0207708_100037804 264
657 3300026089 Ga0207648_10000650 Ga0207648_1000065027 264
658 3300026089 Ga0207648_10004440 Ga0207648_1000444011 264
659 3300026118 Ga0207675_100020005 Ga0207675_1000200055 264
660 3300026118 Ga0207675_100028731 Ga0207675_1000287313 264
661 3300026118 Ga0207675_100372029 Ga0207675_1003720292 264
662 3300026121 Ga0207683_10183753 Ga0207683_101837533 264
663 3300026121 Ga0207683_10224592 Ga0207683_102245922 264
664 3300028381 Ga0268264_10174838 Ga0268264_101748382 264
665 3300045051 Ga0451576_0187689 Ga0451576_0187689_1233_2027 264
666 3300050509 nmdc:mga0qj67_232516_c1 nmdc:mga0qj67_232516_c1_309_1226 264
667 3300005937 Ga0081455_10084939 Ga0081455_100849392 265
668 3300005985 Ga0081539_10000716 Ga0081539_1000071629 265
669 3300025936 Ga0207670_10035154 Ga0207670_100351542 265
670 3300009177 Ga0105248_10073190 Ga0105248_100731902 267
671 3300014969 Ga0157376_10066183 Ga0157376_100661833 267
672 3300046642 Ga0495634_0048008 Ga0495634_0048008_939_1907 272
673 3300009094 Ga0111539_10000987 Ga0111539_1000098733 273
674 3300050512 nmdc:mga0n895_54647_c1 nmdc:mga0n895_54647_c1_983_1846 286
675 2162886007 SwRhRL2b_contig_2450520 SwRhRL2b_0301.00005750 293
676 3300027876 Ga0209974_10027548 Ga0209974_100275483 293

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wzf-assembly1.cif.gz_A structural and mechanism analysis of yunm 0.7929 228 272
1k81-assembly1.cif.gz_A nmr structure of the zinc-ribbon domain within translation initiation factor 2 subunit beta 0.7815 156 182
8ceo-assembly1.cif.gz_d yeast rna polymerase ii transcription pre-initiation complex with core mediator and the +1 nucleosome 0.7605 207 265
2egi-assembly1.cif.gz_A crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.7304 232 271
3hm0-assembly1.cif.gz_D crystal structure of probable thioesterase from bartonella henselae 0.7166 232 272
ID Description Score Start End Superfamily
af_Q54TW1_416_722_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.83 156 181 3.60.21.10
af_Q7XTY9_163_289_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.7944 228 253 2.60.40.200
3lm2B01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7912 160 182 3.30.420.40
3hm0D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7166 232 272 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7133 232 271 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V8N442-F1-model_v4 Uncharacterized protein 0.9449 161 278
AF-A0A2V8I653-F1-model_v4 Uncharacterized protein 0.9366 156 271
AF-A0A1F2S872-F1-model_v4 Uncharacterized protein 0.9257 148 281
AF-A0A2V8I2K0-F1-model_v4 Uncharacterized protein 0.9208 120 278
AF-A0A2V8I2K0-F1-model_v4 Uncharacterized protein 0.9152 120 278

Feature Viewer

pLDDT pTM Quality
78.16 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map