F474553

General Info

Members Datasets Scaffolds Average Seq Length
676 241 674 311

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0122747|Ga0501036_0122747_575_1597
Length 340
Sequence MITRIDRILTELPPPSDPDPDGAAAVQELMGGRFGELSTFMNYTFQSFNFRNRQGARPFYDLIANIAAEEFGHIELVATTINTMLSGASPTANGRAPKPSLRGVKGVGNPHHFLAGGQGALPQNSQGRPWNGDYVFSSGDLVEDLTHNFFLETGARNNKLKVYEMVEHPAARALTGYLLVRGGVHQVAYARALERLTGADLMKLFPSPRIPTAKIPECKPHIARGDHVRLYRYSPSDYLELAAVWNGPHPETGEELVVIDETPEGALAHDLPSQPAVFAPDYAPEEIADIATMLRTKAGLPKQPTGEVASEGASSRRSRSTARKPGAGGRRAKAGTGSRR

Samples

Sample ID Description Type Environment
1 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
2 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
84 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
153 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
235 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 0.89
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.51
Nodule 0
Rhizoplane 9.02
Rhizosphere 83.28
Stem 0
Stem Tuber 0
Unclassified 5.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005508 3300003203 Bacteria 5862
2 JGI25407J50210_10005900 3300003373 Bacteria 3029
3 JGI25407J50210_10006293 3300003373 Bacteria 2952
4 JGI25407J50210_10007416 3300003373 Unclassified 2746
5 JGI25407J50210_10020872 3300003373 Bacteria 1703
6 Ga0070676_10094962 3300005328 Bacteria 1833
7 Ga0070666_10001731 3300005335 Bacteria 13313
8 Ga0070680_100000377 3300005336 Bacteria 30109
9 Ga0070680_100270873 3300005336 Bacteria 1438
10 Ga0070682_100009338 3300005337 Bacteria 5552
11 Ga0070682_100028195 3300005337 Bacteria 3376
12 Ga0070682_100045514 3300005337 Bacteria 2720
13 Ga0070682_100243519 3300005337 Bacteria 1292
14 Ga0068868_100089099 3300005338 Bacteria 2484
15 Ga0068868_100262550 3300005338 Bacteria 1457
16 Ga0070689_100101211 3300005340 Bacteria 2280
17 Ga0070661_100062397 3300005344 Bacteria 2736
18 Ga0070661_100245909 3300005344 Bacteria 1379
19 Ga0070668_100048526 3300005347 Bacteria 3265
20 Ga0070668_100093329 3300005347 Bacteria 2375
21 Ga0070668_100160210 3300005347 Bacteria 1825
22 Ga0070674_100115428 3300005356 Bacteria 1979
23 Ga0070674_100300886 3300005356 Bacteria 1279
24 Ga0070673_100219937 3300005364 Bacteria 1643
25 Ga0070659_100049821 3300005366 Bacteria 3294
26 Ga0070659_100052652 3300005366 Bacteria 3202
27 Ga0070659_100375635 3300005366 Bacteria 1196
28 Ga0070667_100006217 3300005367 Bacteria 9936
29 Ga0070701_10073492 3300005438 Bacteria 1834
30 Ga0070711_100142960 3300005439 Bacteria 1796
31 Ga0070711_100208184 3300005439 Bacteria 1513
32 Ga0070705_100035123 3300005440 Bacteria 2808
33 Ga0070700_100038737 3300005441 Bacteria 2908
34 Ga0070700_100066220 3300005441 Bacteria 2292
35 Ga0070700_100386092 3300005441 Bacteria 1049
36 Ga0070694_100173209 3300005444 Bacteria 1591
37 Ga0070663_100115196 3300005455 Bacteria 2024
38 Ga0070663_100203071 3300005455 Bacteria 1548
39 Ga0070678_100005959 3300005456 Bacteria 7097
40 Ga0070678_100158411 3300005456 Bacteria 1831
41 Ga0070662_100003436 3300005457 Bacteria 9874
42 Ga0070681_10108608 3300005458 Bacteria 2715
43 Ga0070679_100001463 3300005530 Bacteria 20928
44 Ga0070679_100006632 3300005530 Bacteria 10794
45 Ga0070684_100052205 3300005535 Bacteria 3554
46 Ga0070684_100182268 3300005535 Bacteria 1909
47 Ga0070684_100227388 3300005535 Bacteria 1703
48 Ga0068853_100098586 3300005539 Bacteria 2581
49 Ga0070686_100114649 3300005544 Bacteria 1841
50 Ga0070665_100012257 3300005548 Bacteria 8642
51 Ga0070665_100036254 3300005548 Bacteria 4961
52 Ga0070665_100037474 3300005548 Bacteria 4877
53 Ga0070665_100113512 3300005548 Bacteria 2712
54 Ga0068855_100600422 3300005563 Bacteria 1187
55 Ga0070664_100079587 3300005564 Bacteria 2821
56 Ga0070664_100153089 3300005564 Bacteria 2037
57 Ga0068857_100164099 3300005577 Bacteria 2017
58 Ga0068854_100049607 3300005578 Bacteria 2999
59 Ga0068854_100207087 3300005578 Bacteria 1545
60 Ga0068856_100018280 3300005614 Bacteria 6796
61 Ga0068856_100023860 3300005614 Bacteria 5950
62 Ga0068856_100052107 3300005614 Bacteria 4035
63 Ga0068856_100170885 3300005614 Bacteria 2186
64 Ga0070702_100011574 3300005615 Bacteria 4391
65 Ga0070702_100017182 3300005615 Bacteria 3727
66 Ga0070702_100085052 3300005615 Bacteria 1904
67 Ga0068852_100002053 3300005616 Bacteria 13727
68 Ga0068852_100273727 3300005616 Bacteria 1626
69 Ga0068864_100126088 3300005618 Bacteria 2294
70 Ga0068866_10017369 3300005718 Bacteria 3235
71 Ga0068866_10187048 3300005718 Bacteria 1228
72 Ga0068861_100177847 3300005719 Bacteria 1768
73 Ga0068861_100215218 3300005719 Bacteria 1621
74 Ga0068858_100294091 3300005842 Bacteria 1548
75 Ga0068860_100091425 3300005843 Bacteria 2899
76 Ga0068862_100145332 3300005844 Bacteria 2107
77 Ga0081455_10005766 3300005937 Bacteria 13500
78 Ga0081455_10052151 3300005937 Bacteria 3504
79 Ga0081455_10126056 3300005937 Bacteria 2009
80 Ga0081538_10000118 3300005981 Bacteria 79260
81 Ga0081538_10000412 3300005981 Bacteria 48367
82 Ga0081538_10000761 3300005981 Bacteria 35201
83 Ga0081538_10001198 3300005981 Bacteria 27247
84 Ga0081538_10001226 3300005981 Bacteria 26905
85 Ga0081538_10001966 3300005981 Bacteria 20583
86 Ga0081538_10003093 3300005981 Bacteria 15824
87 Ga0081538_10003665 3300005981 Bacteria 14434
88 Ga0081538_10004687 3300005981 Bacteria 12526
89 Ga0081538_10004940 3300005981 Bacteria 12147
90 Ga0081538_10006114 3300005981 Bacteria 10692
91 Ga0081538_10006708 3300005981 Bacteria 10077
92 Ga0081538_10011012 3300005981 Bacteria 7358
93 Ga0081538_10012383 3300005981 Bacteria 6837
94 Ga0081538_10016899 3300005981 Bacteria 5566
95 Ga0081538_10022203 3300005981 Bacteria 4605
96 Ga0081538_10059746 3300005981 Bacteria 2199
97 Ga0081538_10074669 3300005981 Bacteria 1844
98 Ga0081540_1025569 3300005983 Bacteria 3393
99 Ga0081539_10000181 3300005985 Bacteria 148250
100 Ga0081539_10002286 3300005985 Bacteria 27753
101 Ga0081539_10005362 3300005985 Bacteria 13135
102 Ga0081539_10008446 3300005985 Bacteria 8974
103 Ga0075365_10017909 3300006038 Bacteria 4346
104 Ga0075365_10066553 3300006038 Bacteria 2418
105 Ga0075365_10092730 3300006038 Bacteria 2059
106 Ga0075365_10096809 3300006038 Bacteria 2017
107 Ga0075363_100144458 3300006048 Bacteria 1341
108 Ga0075363_100166102 3300006048 Bacteria 1251
109 Ga0075364_10009847 3300006051 Bacteria 5749
110 Ga0075364_10034197 3300006051 Bacteria 3278
111 Ga0070715_10027388 3300006163 Bacteria 2277
112 Ga0070715_10152025 3300006163 Bacteria 1135
113 Ga0070712_100050185 3300006175 Bacteria 2901
114 Ga0097621_100042024 3300006237 Bacteria 3682
115 Ga0068871_100068423 3300006358 Bacteria 2916
116 Ga0075428_100016123 3300006844 Bacteria 8259
117 Ga0075428_100113374 3300006844 Bacteria 2954
118 Ga0075428_100690508 3300006844 Bacteria 1087
119 Ga0075430_100041116 3300006846 Bacteria 3912
120 Ga0075430_100061698 3300006846 Bacteria 3150
121 Ga0075430_100070457 3300006846 Bacteria 2933
122 Ga0075431_100054563 3300006847 Bacteria 4121
123 Ga0075429_100083935 3300006880 Bacteria 2776
124 Ga0068865_100031397 3300006881 Bacteria 3542
125 Ga0105240_10094004 3300009093 Bacteria 3658
126 Ga0111539_10024265 3300009094 Bacteria 7446
127 Ga0111539_10052620 3300009094 Bacteria 4847
128 Ga0111539_10159476 3300009094 Bacteria 2638
129 Ga0111539_10520709 3300009094 Bacteria 1385
130 Ga0111539_10717123 3300009094 Bacteria 1164
131 Ga0105245_10011669 3300009098 Bacteria 7647
132 Ga0105245_10011707 3300009098 Bacteria 7634
133 Ga0105245_10013599 3300009098 Bacteria 7090
134 Ga0105245_10134055 3300009098 Bacteria 2326
135 Ga0105245_10604309 3300009098 Bacteria 1124
136 Ga0105247_10096510 3300009101 Bacteria 1884
137 Ga0105247_10179318 3300009101 Bacteria 1413
138 Ga0114129_10009215 3300009147 Bacteria 14076
139 Ga0114129_10045594 3300009147 Bacteria 6162
140 Ga0114129_10154324 3300009147 Bacteria 3141
141 Ga0114129_10469821 3300009147 Bacteria 1647
142 Ga0114129_10517162 3300009147 Bacteria 1557
143 Ga0105243_10027628 3300009148 Bacteria 4349
144 Ga0105243_10031322 3300009148 Bacteria 4100
145 Ga0105243_10090349 3300009148 Bacteria 2520
146 Ga0105243_10188412 3300009148 Bacteria 1800
147 Ga0105243_10229337 3300009148 Bacteria 1647
148 Ga0105243_10270036 3300009148 Bacteria 1527
149 Ga0105242_10003435 3300009176 Bacteria 12313
150 Ga0105242_10384214 3300009176 Bacteria 1306
151 Ga0105242_10425091 3300009176 Bacteria 1246
152 Ga0105242_10525359 3300009176 Bacteria 1130
153 Ga0105242_10537500 3300009176 Bacteria 1118
154 Ga0105248_10039635 3300009177 Bacteria 5279
155 Ga0105248_10367092 3300009177 Bacteria 1620
156 Ga0105237_10176225 3300009545 Bacteria 2138
157 Ga0105238_10008186 3300009551 Bacteria 10457
158 Ga0105238_10126326 3300009551 Bacteria 2536
159 Ga0105238_10554428 3300009551 Bacteria 1154
160 Ga0105249_10088299 3300009553 Bacteria 2896
161 Ga0105249_10109058 3300009553 Bacteria 2614
162 Ga0105249_10587921 3300009553 Bacteria 1167
163 Ga0105239_10103464 3300010375 Bacteria 3151
164 Ga0105239_10137793 3300010375 Bacteria 2717
165 Ga0105239_10287316 3300010375 Bacteria 1852
166 Ga0105239_10294474 3300010375 Bacteria 1827
167 Ga0105239_10310404 3300010375 Bacteria 1778
168 Ga0105239_10556173 3300010375 Bacteria 1307
169 Ga0157370_10210897 3300013104 Bacteria 1800
170 Ga0157369_10003461 3300013105 Bacteria 18728
171 Ga0157369_10374906 3300013105 Bacteria 1477
172 Ga0157369_10662815 3300013105 Bacteria 1076
173 Ga0157374_10005535 3300013296 Bacteria 10623
174 Ga0163162_10147760 3300013306 Bacteria 2467
175 Ga0157372_10003908 3300013307 Bacteria 16015
176 Ga0157372_10017098 3300013307 Bacteria 7785
177 Ga0157372_10083623 3300013307 Bacteria 3616
178 Ga0157375_10002684 3300013308 Bacteria 15420
179 Ga0157375_10237967 3300013308 Bacteria 1980
180 Ga0182008_10177910 3300014497 Bacteria 1076
181 Ga0157377_10022644 3300014745 Bacteria 3321
182 Ga0157377_10144646 3300014745 Bacteria 1464
183 Ga0157379_10002851 3300014968 Bacteria 14570
184 Ga0157376_10329940 3300014969 Bacteria 1453
185 Ga0157376_10496926 3300014969 Bacteria 1198
186 Ga0206353_11303487 3300020082 Bacteria 1150
187 Ga0206353_11573877 3300020082 Bacteria 1713
188 Ga0206353_11726145 3300020082 Bacteria 4272
189 Ga0213873_10005797 3300021358 Bacteria 2393
190 Ga0213874_10000194 3300021377 Bacteria 11051
191 Ga0213874_10004563 3300021377 Bacteria 3177
192 Ga0213874_10070137 3300021377 Bacteria 1116
193 Ga0213876_10035417 3300021384 Bacteria 2633
194 Ga0213876_10037113 3300021384 Bacteria 2570
195 Ga0213875_10041825 3300021388 Bacteria 2155
196 Ga0213875_10108527 3300021388 Bacteria 1295
197 Ga0224712_10005082 3300022467 Bacteria 3623
198 Ga0224712_10079041 3300022467 Bacteria 1353
199 Ga0224712_10169566 3300022467 Bacteria 978
200 Ga0207656_10045167 3300025321 Bacteria 1884
201 Ga0207688_10092123 3300025901 Bacteria 1741
202 Ga0207688_10119438 3300025901 Bacteria 1537
203 Ga0207680_10002563 3300025903 Bacteria 8470
204 Ga0207647_10034082 3300025904 Bacteria 3254
205 Ga0207705_10052426 3300025909 Bacteria 2937
206 Ga0207705_10249680 3300025909 Bacteria 1353
207 Ga0207707_10001967 3300025912 Bacteria 18672
208 Ga0207695_10131582 3300025913 Bacteria 2459
209 Ga0207693_10180948 3300025915 Bacteria 1659
210 Ga0207660_10012386 3300025917 Bacteria 5580
211 Ga0207662_10017897 3300025918 Bacteria 4013
212 Ga0207657_10208957 3300025919 Bacteria 1567
213 Ga0207649_10021303 3300025920 Bacteria 3729
214 Ga0207649_10321122 3300025920 Bacteria 1138
215 Ga0207652_10002299 3300025921 Bacteria 16199
216 Ga0207652_10059594 3300025921 Bacteria 3291
217 Ga0207687_10040262 3300025927 Bacteria 3203
218 Ga0207687_10099715 3300025927 Bacteria 2135
219 Ga0207687_10106685 3300025927 Bacteria 2071
220 Ga0207687_10118863 3300025927 Bacteria 1973
221 Ga0207687_10128792 3300025927 Bacteria 1904
222 Ga0207687_10133616 3300025927 Bacteria 1874
223 Ga0207690_10053114 3300025932 Bacteria 2717
224 Ga0207690_10154274 3300025932 Bacteria 1705
225 Ga0207686_10050907 3300025934 Bacteria 2578
226 Ga0207709_10021582 3300025935 Bacteria 3647
227 Ga0207704_10025467 3300025938 Bacteria 3228
228 Ga0207704_10150092 3300025938 Bacteria 1643
229 Ga0207691_10085028 3300025940 Bacteria 2839
230 Ga0207711_10199015 3300025941 Bacteria 1828
231 Ga0207661_10001506 3300025944 Bacteria 15789
232 Ga0207661_10093794 3300025944 Bacteria 2506
233 Ga0207679_10027539 3300025945 Bacteria 3932
234 Ga0207679_10126146 3300025945 Bacteria 2045
235 Ga0207679_10205774 3300025945 Bacteria 1647
236 Ga0207651_10439930 3300025960 Bacteria 1117
237 Ga0207712_10079965 3300025961 Bacteria 2376
238 Ga0207712_10411721 3300025961 Bacteria 1139
239 Ga0207668_10012905 3300025972 Bacteria 5130
240 Ga0207668_10095258 3300025972 Bacteria 2197
241 Ga0207668_10165151 3300025972 Bacteria 1730
242 Ga0207668_10171640 3300025972 Bacteria 1701
243 Ga0207668_10185421 3300025972 Bacteria 1645
244 Ga0207668_10229496 3300025972 Bacteria 1496
245 Ga0207640_10040498 3300025981 Bacteria 2956
246 Ga0207640_10190851 3300025981 Bacteria 1544
247 Ga0207658_10010603 3300025986 Bacteria 6263
248 Ga0207658_10114215 3300025986 Bacteria 2141
249 Ga0207703_10424681 3300026035 Bacteria 1237
250 Ga0207639_10048571 3300026041 Bacteria 3213
251 Ga0207639_10085495 3300026041 Bacteria 2508
252 Ga0207678_10038844 3300026067 Bacteria 4133
253 Ga0207678_10149064 3300026067 Bacteria 1997
254 Ga0207708_10034160 3300026075 Bacteria 3867
255 Ga0207708_10100514 3300026075 Bacteria 2238
256 Ga0207702_10004813 3300026078 Bacteria 11901
257 Ga0207702_10039380 3300026078 Bacteria 3960
258 Ga0207702_10140610 3300026078 Bacteria 2184
259 Ga0207702_10243415 3300026078 Bacteria 1686
260 Ga0207641_10513284 3300026088 Bacteria 1165
261 Ga0207648_10366143 3300026089 Bacteria 1301
262 Ga0207648_10465501 3300026089 Bacteria 1153
263 Ga0207676_10447750 3300026095 Bacteria 1217
264 Ga0207676_10511898 3300026095 Bacteria 1141
265 Ga0207674_10017500 3300026116 Bacteria 7819
266 Ga0207675_100030323 3300026118 Bacteria 5036
267 Ga0207675_100043207 3300026118 Bacteria 4209
268 Ga0207683_10000904 3300026121 Bacteria 27318
269 Ga0207683_10289236 3300026121 Bacteria 1498
270 Ga0207683_10498003 3300026121 Bacteria 1125
271 Ga0207698_10047788 3300026142 Bacteria 3245
272 Ga0207698_10124074 3300026142 Bacteria 2192
273 Ga0207698_10134589 3300026142 Bacteria 2118
274 Ga0207698_10313381 3300026142 Bacteria 1466
275 Ga0207428_10033790 3300027907 Bacteria 4195
276 Ga0207428_10249286 3300027907 Bacteria 1325
277 Ga0207428_10285006 3300027907 Bacteria 1225
278 Ga0268266_10001725 3300028379 Bacteria 25033
279 Ga0268266_10025080 3300028379 Bacteria 5075
280 Ga0268266_10036137 3300028379 Bacteria 4203
281 Ga0268266_10403040 3300028379 Bacteria 1293
282 Ga0268265_10364449 3300028380 Bacteria 1324
283 Ga0268264_10079767 3300028381 Bacteria 2793
284 Ga0307408_100082903 3300031548 Bacteria 2401
285 Ga0307405_10057739 3300031731 Bacteria 2439
286 Ga0307405_10114052 3300031731 Bacteria 1836
287 Ga0307413_10010236 3300031824 Bacteria 4536
288 Ga0307413_10056028 3300031824 Bacteria 2402
289 Ga0307413_10123563 3300031824 Bacteria 1758
290 Ga0307410_10012040 3300031852 Bacteria 4978
291 Ga0307410_10053395 3300031852 Bacteria 2735
292 Ga0307410_10264304 3300031852 Bacteria 1343
293 Ga0307406_10028555 3300031901 Bacteria 3371
294 Ga0307406_10094008 3300031901 Bacteria 2026
295 Ga0307406_10138584 3300031901 Bacteria 1719
296 Ga0307406_10370782 3300031901 Bacteria 1125
297 Ga0307406_10407587 3300031901 Bacteria 1079
298 Ga0307407_10018604 3300031903 Bacteria 3518
299 Ga0307407_10071469 3300031903 Bacteria 2066
300 Ga0307407_10090742 3300031903 Bacteria 1872
301 Ga0307412_10113760 3300031911 Bacteria 1937
302 Ga0307409_100000655 3300031995 Bacteria 15334
303 Ga0307409_100011147 3300031995 Bacteria 5646
304 Ga0307409_100121568 3300031995 Bacteria 2212
305 Ga0307409_100234667 3300031995 Bacteria 1665
306 Ga0307409_100521768 3300031995 Bacteria 1161
307 Ga0307416_100021508 3300032002 Bacteria 4633
308 Ga0307416_100035957 3300032002 Bacteria 3791
309 Ga0307416_100041122 3300032002 Bacteria 3598
310 Ga0307416_100083179 3300032002 Bacteria 2714
311 Ga0307416_100097413 3300032002 Bacteria 2547
312 Ga0307416_100104311 3300032002 Bacteria 2478
313 Ga0307416_100236167 3300032002 Bacteria 1767
314 Ga0307416_100321996 3300032002 Bacteria 1549
315 Ga0307416_100336211 3300032002 Bacteria 1520
316 Ga0307416_100356466 3300032002 Bacteria 1483
317 Ga0307416_100456345 3300032002 Bacteria 1332
318 Ga0307414_10007256 3300032004 Bacteria 6227
319 Ga0307414_10317682 3300032004 Bacteria 1324
320 Ga0307414_10499131 3300032004 Bacteria 1076
321 Ga0307411_10070932 3300032005 Bacteria 2359
322 Ga0307411_10232787 3300032005 Bacteria 1437
323 Ga0307415_100000531 3300032126 Bacteria 16623
324 Ga0307415_100018102 3300032126 Bacteria 4244
325 Ga0307415_100051609 3300032126 Bacteria 2792
326 Ga0307415_100100912 3300032126 Bacteria 2116
327 Ga0307415_100130455 3300032126 Bacteria 1902
328 Ga0307415_100231515 3300032126 Bacteria 1488
329 Ga0395899_0093690 3300037312 Bacteria 2174
330 Ga0395900_0111597 3300037418 Bacteria 2808
331 Ga0395900_0289067 3300037418 Bacteria 1628
332 Ga0395900_0324321 3300037418 Bacteria 1519
333 Ga0395898_0051651 3300037466 Bacteria 4019
334 Ga0395898_0178783 3300037466 Bacteria 2027
335 Ga0395898_0270790 3300037466 Bacteria 1620
336 Ga0395905_0044404 3300037471 Bacteria 4171
337 Ga0436364_0801814 3300037853 Bacteria 17054
338 Ga0436364_0888707 3300037853 Bacteria 2174
339 Ga0436364_0911658 3300037853 Bacteria 6802
340 Ga0436364_1492429 3300037853 Bacteria 2906
341 Ga0395901_0011145 3300038443 Bacteria 9110
342 Ga0395901_0078852 3300038443 Bacteria 3439
343 Ga0395901_0123458 3300038443 Bacteria 2721
344 Ga0395901_0208182 3300038443 Bacteria 2048
345 Ga0395901_0791978 3300038443 Bacteria 938
346 Ga0436365_0392863 3300039437 Bacteria 8115
347 Ga0436365_0440302 3300039437 Bacteria 2630
348 Ga0436365_0494652 3300039437 Bacteria 13610
349 Ga0436365_0855903 3300039437 Bacteria 2872
350 Ga0436365_0987560 3300039437 Bacteria 2176
351 Ga0436365_1294762 3300039437 Bacteria 9834
352 Ga0436365_1901512 3300039437 Bacteria 29147
353 Ga0436363_0101887 3300039450 Bacteria 3363
354 Ga0436363_0108530 3300039450 Bacteria 1350
355 Ga0436363_0151266 3300039450 Bacteria 15043
356 Ga0436363_0605788 3300039450 Bacteria 12820
357 Ga0436363_0820817 3300039450 Bacteria 1865
358 Ga0436362_0062100 3300039453 Bacteria 2617
359 Ga0436362_0264531 3300039453 Bacteria 1425
360 Ga0436362_0435205 3300039453 Bacteria 2105
361 Ga0436362_0668447 3300039453 Bacteria 1122
362 Ga0436362_0943907 3300039453 Bacteria 6000
363 Ga0439461_0001977 3300041410 Bacteria 3238
364 Ga0451798_0590354 3300041458 Bacteria 1289
365 Ga0451853_0007471 3300041512 Bacteria 2109
366 Ga0451853_2379236 3300041512 Archaea 2293
367 Ga0439448_0012121 3300042005 Bacteria 2575
368 Ga0439435_0018557 3300042436 Bacteria 1772
369 Ga0450918_003461 3300042531 Bacteria 2932
370 Ga0466965_0019495 3300044683 Bacteria 3256
371 Ga0466965_0035871 3300044683 Bacteria 2431
372 Ga0466963_0005462 3300044694 Bacteria 7442
373 Ga0466963_0006299 3300044694 Bacteria 7015
374 Ga0466963_0013615 3300044694 Bacteria 4999
375 Ga0466963_0040989 3300044694 Bacteria 3035
376 Ga0466963_0101156 3300044694 Bacteria 1973
377 Ga0466963_0170351 3300044694 Bacteria 1518
378 Ga0466963_0217703 3300044694 Bacteria 1337
379 Ga0466963_0280086 3300044694 Bacteria 1172
380 Ga0466963_0517836 3300044694 Bacteria 842
381 Ga0466964_0011611 3300044706 Bacteria 3330
382 Ga0466971_0070334 3300044719 Bacteria 1589
383 Ga0466968_0004627 3300044735 Bacteria 5146
384 Ga0466970_0132463 3300044765 Bacteria 1370
385 Ga0466957_0009461 3300044842 Bacteria 5564
386 Ga0466957_0041067 3300044842 Bacteria 2797
387 Ga0466957_0230048 3300044842 Bacteria 1227
388 Ga0466957_0256090 3300044842 Bacteria 1165
389 Ga0466960_0000005 3300044901 Bacteria 72219
390 Ga0466959_0050868 3300045049 Bacteria 3041
391 Ga0466959_0084022 3300045049 Bacteria 2292
392 Ga0466959_0086058 3300045049 Bacteria 2261
393 Ga0466959_0119662 3300045049 Bacteria 1873
394 Ga0466959_0131804 3300045049 Bacteria 1771
395 Ga0466958_0003457 3300045836 Bacteria 8193
396 Ga0466958_0010849 3300045836 Bacteria 5116
397 Ga0466958_0012328 3300045836 Bacteria 4841
398 Ga0466958_0259870 3300045836 Bacteria 1111
399 Ga0466967_0000503 3300045976 Bacteria 19151
400 Ga0466967_0006242 3300045976 Bacteria 8404
401 Ga0466967_0015486 3300045976 Bacteria 5977
402 Ga0466967_0043510 3300045976 Bacteria 3889
403 Ga0466967_0055287 3300045976 Bacteria 3496
404 Ga0466967_0059767 3300045976 Bacteria 3375
405 Ga0466967_0070822 3300045976 Bacteria 3120
406 Ga0466967_0094369 3300045976 Bacteria 2724
407 Ga0466967_0107032 3300045976 Bacteria 2564
408 Ga0466967_0221474 3300045976 Bacteria 1798
409 Ga0466967_0247806 3300045976 Bacteria 1701
410 Ga0466967_0251497 3300045976 Bacteria 1688
411 Ga0466967_0392825 3300045976 Bacteria 1348
412 Ga0495650_0000121 3300046471 Bacteria 183055
413 Ga0495625_0000032 3300046660 Bacteria 233135
414 Ga0495672_0020993 3300047320 Bacteria 4267
415 Ga0495672_0033312 3300047320 Bacteria 3192
416 Ga0496100_0002667 3300048903 Bacteria 9094
417 Ga0496100_0093713 3300048903 Bacteria 2055
418 Ga0496100_0225510 3300048903 Bacteria 1377
419 Ga0496101_0125818 3300048904 Bacteria 1942
420 Ga0496101_0146273 3300048904 Bacteria 1805
421 Ga0496101_0164381 3300048904 Bacteria 1703
422 Ga0496102_0051057 3300048905 Bacteria 3767
423 Ga0496102_0118769 3300048905 Bacteria 2468
424 Ga0496102_0250353 3300048905 Bacteria 1670
425 Ga0496103_0007811 3300048906 Bacteria 6357
426 Ga0496103_0029643 3300048906 Bacteria 3326
427 Ga0496103_0089230 3300048906 Bacteria 1945
428 Ga0496104_0008134 3300048907 Bacteria 9305
429 Ga0496104_0066553 3300048907 Bacteria 3421
430 Ga0496104_0073837 3300048907 Bacteria 3245
431 Ga0496104_0412103 3300048907 Bacteria 1263
432 Ga0496105_0002183 3300048908 Bacteria 14166
433 Ga0496105_0007438 3300048908 Bacteria 8477
434 Ga0496105_0213906 3300048908 Bacteria 1571
435 Ga0496106_0022070 3300048909 Bacteria 4728
436 Ga0496106_0048459 3300048909 Bacteria 3199
437 Ga0496106_0152753 3300048909 Bacteria 1822
438 Ga0496107_0011637 3300048910 Bacteria 6131
439 Ga0496107_0052903 3300048910 Bacteria 2929
440 Ga0496107_0116788 3300048910 Bacteria 1964
441 Ga0496108_0000894 3300048911 Bacteria 23226
442 Ga0496108_0007071 3300048911 Bacteria 9089
443 Ga0496108_0010239 3300048911 Bacteria 7614
444 Ga0496108_0024845 3300048911 Bacteria 4934
445 Ga0496108_0086717 3300048911 Bacteria 2658
446 Ga0496109_0000326 3300048912 Bacteria 44470
447 Ga0496109_0000753 3300048912 Bacteria 26958
448 Ga0496109_0006929 3300048912 Bacteria 9565
449 Ga0496109_0007731 3300048912 Bacteria 9103
450 Ga0496109_0011798 3300048912 Bacteria 7520
451 Ga0496109_0173795 3300048912 Bacteria 2022
452 Ga0496110_0002845 3300048913 Bacteria 13059
453 Ga0496110_0012777 3300048913 Bacteria 6915
454 Ga0496110_0047764 3300048913 Bacteria 3750
455 Ga0496110_0056058 3300048913 Bacteria 3468
456 Ga0496110_0189512 3300048913 Bacteria 1868
457 Ga0496110_0196101 3300048913 Bacteria 1834
458 Ga0496110_0203200 3300048913 Bacteria 1800
459 Ga0496110_0203770 3300048913 Bacteria 1798
460 Ga0496110_0350046 3300048913 Bacteria 1346
461 Ga0496111_0006374 3300048914 Bacteria 7658
462 Ga0496111_0007380 3300048914 Bacteria 7198
463 Ga0496111_0009574 3300048914 Bacteria 6472
464 Ga0496111_0079952 3300048914 Bacteria 2385
465 Ga0496111_0190100 3300048914 Bacteria 1526
466 Ga0496111_0234533 3300048914 Bacteria 1363
467 Ga0496111_0249828 3300048914 Bacteria 1317
468 Ga0496112_0011422 3300048915 Bacteria 8109
469 Ga0496112_0041071 3300048915 Bacteria 4525
470 Ga0496113_0013478 3300048916 Bacteria 5542
471 Ga0496113_0031402 3300048916 Bacteria 3855
472 Ga0496113_0097557 3300048916 Bacteria 2274
473 Ga0496114_0000990 3300048917 Bacteria 21267
474 Ga0496114_0036214 3300048917 Bacteria 4078
475 Ga0496115_0192488 3300048918 Unclassified 1685
476 Ga0496117_0000619 3300048920 Bacteria 57505
477 Ga0496118_0000766 3300048921 Bacteria 51540
478 Ga0496121_0002166 3300048924 Bacteria 30741
479 Ga0496121_0079255 3300048924 Bacteria 2608
480 Ga0496121_0255906 3300048924 Bacteria 1212
481 Ga0496124_0104612 3300048927 Bacteria 2289
482 Ga0496124_0121828 3300048927 Bacteria 2083
483 Ga0496126_0019683 3300048929 Bacteria 6642
484 Ga0496126_0061882 3300048929 Bacteria 3360
485 Ga0501031_0004357 3300049568 Bacteria 9158
486 Ga0501031_0017795 3300049568 Bacteria 4621
487 Ga0501031_0025420 3300049568 Bacteria 3861
488 Ga0501031_0032017 3300049568 Bacteria 3429
489 Ga0501031_0039685 3300049568 Bacteria 3073
490 Ga0501032_0004803 3300049569 Bacteria 10133
491 Ga0501032_0047954 3300049569 Bacteria 2884
492 Ga0501032_0166439 3300049569 Bacteria 1447
493 Ga0501033_0018958 3300049570 Bacteria 5200
494 Ga0501033_0041302 3300049570 Bacteria 3442
495 Ga0501034_0011301 3300049571 Bacteria 9261
496 Ga0501034_0115335 3300049571 Bacteria 2675
497 Ga0501036_0043669 3300049572 Bacteria 3796
498 Ga0501036_0050220 3300049572 Bacteria 3532
499 Ga0501036_0122747 3300049572 Bacteria 2194
500 Ga0501036_0123256 3300049572 Bacteria 2189
501 Ga0501036_0138551 3300049572 Bacteria 2053
502 Ga0501036_0150947 3300049572 Bacteria 1960
503 Ga0501036_0172106 3300049572 Bacteria 1824
504 Ga0501036_0208718 3300049572 Bacteria 1641
505 Ga0501036_0462402 3300049572 Bacteria 1057
506 Ga0501037_0002769 3300049573 Bacteria 12682
507 Ga0501037_0055771 3300049573 Bacteria 2889
508 Ga0501038_0003753 3300049574 Bacteria 14133
509 Ga0501038_0030562 3300049574 Bacteria 4765
510 Ga0501038_0033506 3300049574 Bacteria 4525
511 Ga0501038_0171606 3300049574 Bacteria 1755
512 Ga0501039_0004459 3300049575 Bacteria 10566
513 Ga0501039_0022741 3300049575 Bacteria 4810
514 Ga0501039_0043644 3300049575 Bacteria 3463
515 Ga0501039_0069189 3300049575 Bacteria 2741
516 Ga0501039_0095731 3300049575 Bacteria 2315
517 Ga0501039_0109862 3300049575 Bacteria 2155
518 Ga0501040_0017272 3300049576 Bacteria 4787
519 Ga0501040_0025804 3300049576 Bacteria 3953
520 Ga0501040_0027930 3300049576 Bacteria 3801
521 Ga0501040_0028992 3300049576 Bacteria 3734
522 Ga0501040_0036832 3300049576 Bacteria 3322
523 Ga0501040_0040049 3300049576 Bacteria 3188
524 Ga0501040_0070304 3300049576 Bacteria 2415
525 Ga0501041_0010224 3300049577 Bacteria 5531
526 Ga0501041_0013196 3300049577 Bacteria 4895
527 Ga0501041_0062463 3300049577 Bacteria 2280
528 Ga0501041_0110258 3300049577 Bacteria 1707
529 Ga0501041_0259629 3300049577 Bacteria 1092
530 Ga0501041_0265968 3300049577 Bacteria 1078
531 Ga0501042_0012344 3300049578 Bacteria 5784
532 Ga0501042_0020235 3300049578 Bacteria 4630
533 Ga0501042_0092212 3300049578 Bacteria 2175
534 Ga0501042_0149274 3300049578 Bacteria 1685
535 Ga0501042_0245249 3300049578 Bacteria 1292
536 Ga0501042_0431819 3300049578 Bacteria 955
537 Ga0501043_0034752 3300049579 Bacteria 3964
538 Ga0501043_0113005 3300049579 Bacteria 2133
539 Ga0501043_0330842 3300049579 Bacteria 1160
540 Ga0501043_0345666 3300049579 Bacteria 1131
541 Ga0501046_0005549 3300049580 Bacteria 11270
542 Ga0501046_0018249 3300049580 Bacteria 5841
543 Ga0501046_0087086 3300049580 Bacteria 2407
544 Ga0501046_0186332 3300049580 Bacteria 1549
545 Ga0501046_0294242 3300049580 Bacteria 1187
546 Ga0501046_0358771 3300049580 Bacteria 1057
547 Ga0501047_0027727 3300049581 Bacteria 5458
548 Ga0501047_0067281 3300049581 Bacteria 3452
549 Ga0501047_0110901 3300049581 Bacteria 2626
550 Ga0501048_0002489 3300049582 Bacteria 14066
551 Ga0501048_0012939 3300049582 Bacteria 6198
552 Ga0501048_0052121 3300049582 Bacteria 2911
553 Ga0501048_0118122 3300049582 Bacteria 1873
554 Ga0501048_0312734 3300049582 Bacteria 1118
555 Ga0501067_0017219 3300049583 Bacteria 3994
556 Ga0501068_0002271 3300049584 Bacteria 10235
557 Ga0501068_0064949 3300049584 Bacteria 2221
558 Ga0501068_0092864 3300049584 Bacteria 1864
559 Ga0501068_0187425 3300049584 Bacteria 1309
560 Ga0501068_0188055 3300049584 Bacteria 1307
561 Ga0501068_0222865 3300049584 Bacteria 1199
562 Ga0501069_0017386 3300049585 Bacteria 3869
563 Ga0501069_0018063 3300049585 Bacteria 3804
564 Ga0501069_0079933 3300049585 Bacteria 1841
565 Ga0501070_0044118 3300049586 Bacteria 3710
566 Ga0501070_0172135 3300049586 Bacteria 1783
567 Ga0501071_0003111 3300049587 Bacteria 10296
568 Ga0501071_0049221 3300049587 Bacteria 3033
569 Ga0501071_0057386 3300049587 Bacteria 2813
570 Ga0501071_0060381 3300049587 Bacteria 2744
571 Ga0501071_0065264 3300049587 Bacteria 2643
572 Ga0501071_0079713 3300049587 Bacteria 2394
573 Ga0501071_0080399 3300049587 Bacteria 2383
574 Ga0501071_0100238 3300049587 Bacteria 2134
575 Ga0501071_0166891 3300049587 Bacteria 1647
576 Ga0501071_0300519 3300049587 Bacteria 1217
577 Ga0501071_0327357 3300049587 Bacteria 1164
578 Ga0501072_0009002 3300049588 Bacteria 7590
579 Ga0501072_0031226 3300049588 Bacteria 4168
580 Ga0501072_0042390 3300049588 Bacteria 3575
581 Ga0501072_0056458 3300049588 Bacteria 3094
582 Ga0501072_0089294 3300049588 Bacteria 2446
583 Ga0501072_0112005 3300049588 Bacteria 2172
584 Ga0501072_0247670 3300049588 Bacteria 1419
585 Ga0501072_0328516 3300049588 Bacteria 1215
586 Ga0501073_0043928 3300049589 Bacteria 3150
587 Ga0501073_0067379 3300049589 Bacteria 2496
588 Ga0501074_0006500 3300049590 Bacteria 8443
589 Ga0501074_0006612 3300049590 Bacteria 8382
590 Ga0501074_0028802 3300049590 Bacteria 4024
591 Ga0501074_0054478 3300049590 Bacteria 2884
592 Ga0501074_0305078 3300049590 Bacteria 1131
593 Ga0501074_0341821 3300049590 Bacteria 1062
594 Ga0501075_0004445 3300049591 Bacteria 9489
595 Ga0501075_0021150 3300049591 Bacteria 4740
596 Ga0501075_0023425 3300049591 Bacteria 4521
597 Ga0501075_0096095 3300049591 Bacteria 2249
598 Ga0501075_0097206 3300049591 Bacteria 2234
599 Ga0501076_0007814 3300049592 Bacteria 7796
600 Ga0501076_0008142 3300049592 Bacteria 7669
601 Ga0501076_0011403 3300049592 Bacteria 6618
602 Ga0501076_0028506 3300049592 Bacteria 4336
603 Ga0501076_0032144 3300049592 Bacteria 4095
604 Ga0501076_0052237 3300049592 Bacteria 3237
605 Ga0501076_0061404 3300049592 Bacteria 2991
606 Ga0501076_0073663 3300049592 Bacteria 2734
607 Ga0501076_0079072 3300049592 Bacteria 2639
608 Ga0501076_0205773 3300049592 Bacteria 1607
609 Ga0501076_0392817 3300049592 Bacteria 1140
610 Ga0501077_0032152 3300049593 Bacteria 3340
611 Ga0501077_0074690 3300049593 Bacteria 2147
612 Ga0501077_0106864 3300049593 Bacteria 1773
613 Ga0501077_0237261 3300049593 Bacteria 1159
614 Ga0501079_0017033 3300049741 Bacteria 5550
615 Ga0501079_0024985 3300049741 Bacteria 4583
616 Ga0501079_0025897 3300049741 Bacteria 4499
617 Ga0501079_0082257 3300049741 Bacteria 2490
618 Ga0501079_0140931 3300049741 Bacteria 1878
619 Ga0501079_0269728 3300049741 Bacteria 1330
620 Ga0501080_0061837 3300049742 Bacteria 3485
621 Ga0501080_0125490 3300049742 Bacteria 2377
622 Ga0501081_0005599 3300049743 Bacteria 8111
623 Ga0501081_0030794 3300049743 Bacteria 3634
624 Ga0501081_0072664 3300049743 Bacteria 2398
625 Ga0501081_0096432 3300049743 Bacteria 2086
626 Ga0501083_0040996 3300049744 Bacteria 3141
627 Ga0501083_0273342 3300049744 Bacteria 1099
628 Ga0501035_0018223 3300049822 Bacteria 6466
629 Ga0501035_0076211 3300049822 Bacteria 2966
630 Ga0501035_0266160 3300049822 Bacteria 1452
631 Ga0501035_0349545 3300049822 Bacteria 1237
632 Ga0501044_0014862 3300049823 Bacteria 8392
633 Ga0501044_0034027 3300049823 Bacteria 5348
634 Ga0501044_0376182 3300049823 Bacteria 1336
635 Ga0501045_0019194 3300049824 Bacteria 4870
636 Ga0501045_0082239 3300049824 Bacteria 2375
637 Ga0501045_0188051 3300049824 Bacteria 1539
638 Ga0501045_0328167 3300049824 Bacteria 1139
639 nmdc:mga03n38_19754_c1 3300050490 Bacteria 2682
640 nmdc:mga00v17_191274_c1 3300050491 Bacteria 1322
641 nmdc:mga00v17_41311_c1 3300050491 Bacteria 2769
642 nmdc:mga0yw44_205589_c1 3300050492 Bacteria 1301
643 nmdc:mga05p37_378395_c1 3300050507 Bacteria 1660
644 nmdc:mga05p37_4971_c1 3300050507 Bacteria 15580
645 nmdc:mga09592_227321_c1 3300050508 Bacteria 1616
646 nmdc:mga0qj67_413644_c1 3300050509 Bacteria 1088
647 nmdc:mga0qj67_56217_c1 3300050509 Bacteria 3119
648 nmdc:mga06r32_202821_c1 3300050510 Bacteria 1971
649 nmdc:mga06r32_76346_c1 3300050510 Bacteria 3254
650 nmdc:mga08y16_22873_c1 3300050511 Bacteria 6597
651 Ga0500641_0013882 3300053096 Bacteria 2964
652 Ga0500556_0001060 3300053104 Bacteria 14115
653 Ga0500616_0058152 3300053153 Bacteria 2012
654 Ga0500616_0058716 3300053153 Bacteria 2000
655 Ga0500599_002571 3300053736 Bacteria 2181
656 Ga0501084_0004200 3300054114 Bacteria 11749
657 Ga0501084_0032428 3300054114 Bacteria 4370
658 Ga0501084_0062326 3300054114 Bacteria 3121
659 Ga0501084_0094809 3300054114 Bacteria 2506
660 Ga0501084_0203662 3300054114 Bacteria 1670
661 Ga0501084_0310507 3300054114 Bacteria 1332
662 Ga0501084_0346176 3300054114 Bacteria 1255
663 Ga0501082_0013763 3300060353 Bacteria 6955
664 Ga0501082_0014079 3300060353 Bacteria 6880
665 Ga0501082_0038736 3300060353 Bacteria 4111
666 Ga0501082_0094475 3300060353 Bacteria 2584
667 Ga0501082_0134996 3300060353 Bacteria 2141
668 Ga0501082_0203718 3300060353 Bacteria 1721
669 Ga0501082_0220272 3300060353 Bacteria 1651
670 Ga0501082_0358614 3300060353 Bacteria 1272
671 Ga0466962_0164062 3300061719 Bacteria 1081
672 Ga0530510_0004106 3300061734 Bacteria 10050
673 Ga0530510_0016773 3300061734 Bacteria 5186
674 Ga0530510_0035845 3300061734 Bacteria 3576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10134055 Ga0105245_101340552 236
2 3300050509 nmdc:mga0qj67_413644_c1 nmdc:mga0qj67_413644_c1_260_1051 236
3 3300005456 Ga0070678_100005959 Ga0070678_1000059596 252
4 3300005544 Ga0070686_100114649 Ga0070686_1001146492 252
5 3300005718 Ga0068866_10017369 Ga0068866_100173692 252
6 3300009176 Ga0105242_10003435 Ga0105242_100034356 252
7 3300013308 Ga0157375_10237967 Ga0157375_102379672 252
8 3300014968 Ga0157379_10002851 Ga0157379_100028512 252
9 3300025915 Ga0207693_10180948 Ga0207693_101809482 252
10 3300025986 Ga0207658_10114215 Ga0207658_101142152 252
11 3300026121 Ga0207683_10000904 Ga0207683_100009042 252
12 3300014497 Ga0182008_10177910 Ga0182008_101779102 254
13 3300005440 Ga0070705_100035123 Ga0070705_1000351232 255
14 3300005615 Ga0070702_100017182 Ga0070702_1000171822 255
15 3300005843 Ga0068860_100091425 Ga0068860_1000914252 255
16 3300006163 Ga0070715_10027388 Ga0070715_100273882 255
17 3300009148 Ga0105243_10027628 Ga0105243_100276282 255
18 3300025935 Ga0207709_10021582 Ga0207709_100215822 255
19 3300025938 Ga0207704_10025467 Ga0207704_100254672 255
20 3300028381 Ga0268264_10079767 Ga0268264_100797672 255
21 3300048903 Ga0496100_0093713 Ga0496100_0093713_453_1472 255
22 3300048904 Ga0496101_0164381 Ga0496101_0164381_270_1289 255
23 3300048909 Ga0496106_0048459 Ga0496106_0048459_71_1090 255
24 3300048910 Ga0496107_0011637 Ga0496107_0011637_1306_2325 255
25 3300048917 Ga0496114_0036214 Ga0496114_0036214_2025_3044 255
26 3300048913 Ga0496110_0203770 Ga0496110_0203770_271_1134 257
27 3300049575 Ga0501039_0069189 Ga0501039_0069189_857_1750 257
28 3300037312 Ga0395899_0093690 Ga0395899_0093690_251_1036 261
29 3300037418 Ga0395900_0111597 Ga0395900_0111597_141_926 261
30 3300037466 Ga0395898_0051651 Ga0395898_0051651_379_1164 261
31 3300037471 Ga0395905_0044404 Ga0395905_0044404_3105_3890 261
32 3300038443 Ga0395901_0011145 Ga0395901_0011145_5279_6064 261
33 3300048904 Ga0496101_0125818 Ga0496101_0125818_11_901 262
34 3300049572 Ga0501036_0462402 Ga0501036_0462402_124_1038 262
35 3300049578 Ga0501042_0431819 Ga0501042_0431819_25_939 262
36 3300049743 Ga0501081_0096432 Ga0501081_0096432_1171_2067 262
37 3300005338 Ga0068868_100262550 Ga0068868_1002625502 267
38 3300005366 Ga0070659_100052652 Ga0070659_1000526523 267
39 3300025909 Ga0207705_10249680 Ga0207705_102496802 267
40 3300025940 Ga0207691_10085028 Ga0207691_100850282 267
41 3300025945 Ga0207679_10027539 Ga0207679_100275392 267
42 3300025961 Ga0207712_10079965 Ga0207712_100799652 267
43 3300026142 Ga0207698_10124074 Ga0207698_101240742 267
44 3300038443 Ga0395901_0791978 Ga0395901_0791978_23_826 267
45 3300044694 Ga0466963_0517836 Ga0466963_0517836_14_817 267
46 3300047320 Ga0495672_0033312 Ga0495672_0033312_2365_3168 267
47 3300061719 Ga0466962_0164062 Ga0466962_0164062_174_1052 267
48 3300045049 Ga0466959_0086058 Ga0466959_0086058_469_1362 269
49 3300045836 Ga0466958_0003457 Ga0466958_0003457_61_954 269
50 3300048916 Ga0496113_0097557 Ga0496113_0097557_777_1688 269
51 3300049569 Ga0501032_0047954 Ga0501032_0047954_14_919 269
52 3300049587 Ga0501071_0327357 Ga0501071_0327357_257_1111 269
53 3300049592 Ga0501076_0079072 Ga0501076_0079072_1743_2600 269
54 3300049742 Ga0501080_0125490 Ga0501080_0125490_14_919 269
55 3300006846 Ga0075430_100061698 Ga0075430_1000616983 270
56 3300009147 Ga0114129_10009215 Ga0114129_100092153 270
57 3300050507 nmdc:mga05p37_4971_c1 nmdc:mga05p37_4971_c1_2336_3328 270
58 3300050509 nmdc:mga0qj67_56217_c1 nmdc:mga0qj67_56217_c1_1021_2013 270
59 3300048929 Ga0496126_0019683 Ga0496126_0019683_4437_5336 271
60 3300005335 Ga0070666_10001731 Ga0070666_100017316 272
61 3300005367 Ga0070667_100006217 Ga0070667_1000062173 272
62 3300005548 Ga0070665_100113512 Ga0070665_1001135122 272
63 3300006844 Ga0075428_100016123 Ga0075428_1000161234 272
64 3300009094 Ga0111539_10024265 Ga0111539_100242654 272
65 3300009551 Ga0105238_10554428 Ga0105238_105544281 272
66 3300025903 Ga0207680_10002563 Ga0207680_100025634 272
67 3300025986 Ga0207658_10010603 Ga0207658_100106033 272
68 3300027907 Ga0207428_10033790 Ga0207428_100337904 272
69 3300028379 Ga0268266_10001725 Ga0268266_100017255 272
70 3300044694 Ga0466963_0170351 Ga0466963_0170351_481_1485 272
71 3300048924 Ga0496121_0255906 Ga0496121_0255906_181_1194 272
72 3300049590 Ga0501074_0028802 Ga0501074_0028802_669_1667 272
73 3300050511 nmdc:mga08y16_22873_c1 nmdc:mga08y16_22873_c1_2368_3264 272
74 3300025960 Ga0207651_10439930 Ga0207651_104399302 273
75 3300049572 Ga0501036_0123256 Ga0501036_0123256_1236_2165 273
76 3300039450 Ga0436363_0151266 Ga0436363_0151266_13908_14879 276
77 3300009147 Ga0114129_10045594 Ga0114129_100455947 277
78 3300027907 Ga0207428_10285006 Ga0207428_102850062 277
79 3300045836 Ga0466958_0010849 Ga0466958_0010849_18_887 278
80 3300049584 Ga0501068_0222865 Ga0501068_0222865_27_980 278
81 3300009176 Ga0105242_10537500 Ga0105242_105375001 279
82 3300041458 Ga0451798_0590354 Ga0451798_0590354_223_1179 279
83 3300006846 Ga0075430_100070457 Ga0075430_1000704573 280
84 3300025901 Ga0207688_10119438 Ga0207688_101194382 280
85 3300005548 Ga0070665_100036254 Ga0070665_1000362546 281
86 3300005985 Ga0081539_10005362 Ga0081539_1000536214 281
87 3300028379 Ga0268266_10025080 Ga0268266_100250806 281
88 3300046660 Ga0495625_0000032 Ga0495625_0000032_17618_18556 281
89 3300048924 Ga0496121_0002166 Ga0496121_0002166_21131_22129 281
90 3300048929 Ga0496126_0061882 Ga0496126_0061882_1873_2838 282
91 3300005337 Ga0070682_100243519 Ga0070682_1002435191 283
92 3300045976 Ga0466967_0043510 Ga0466967_0043510_1125_2096 283
93 3300048924 Ga0496121_0079255 Ga0496121_0079255_1405_2388 283
94 3300005985 Ga0081539_10008446 Ga0081539_100084469 284
95 3300009176 Ga0105242_10525359 Ga0105242_105253591 284
96 3300021384 Ga0213876_10037113 Ga0213876_100371132 284
97 3300031995 Ga0307409_100521768 Ga0307409_1005217681 284
98 3300039437 Ga0436365_1294762 Ga0436365_1294762_1889_2866 284
99 3300039453 Ga0436362_0435205 Ga0436362_0435205_361_1338 284
100 3300042436 Ga0439435_0018557 Ga0439435_0018557_529_1422 284
101 3300044694 Ga0466963_0280086 Ga0466963_0280086_144_1070 284
102 3300048913 Ga0496110_0350046 Ga0496110_0350046_341_1318 284
103 3300021388 Ga0213875_10041825 Ga0213875_100418252 285
104 3300037853 Ga0436364_0911658 Ga0436364_0911658_666_1637 285
105 3300037853 Ga0436364_1492429 Ga0436364_1492429_472_1443 285
106 3300039437 Ga0436365_0392863 Ga0436365_0392863_5035_6006 285
107 3300039453 Ga0436362_0668447 Ga0436362_0668447_116_1093 285
108 3300050492 nmdc:mga0yw44_205589_c1 nmdc:mga0yw44_205589_c1_256_1236 285
109 iso_pu_bacteria 2524614857 2526063489 285
110 iso_pu_bacteria 2739367875 2740064778 285
111 3300026089 Ga0207648_10465501 Ga0207648_104655011 286
112 3300032002 Ga0307416_100321996 Ga0307416_1003219961 286
113 3300039437 Ga0436365_0987560 Ga0436365_0987560_185_1156 286
114 3300039450 Ga0436363_0820817 Ga0436363_0820817_283_1254 286
115 3300044694 Ga0466963_0013615 Ga0466963_0013615_1594_2565 286
116 3300045836 Ga0466958_0012328 Ga0466958_0012328_1135_2106 286
117 3300045976 Ga0466967_0055287 Ga0466967_0055287_1455_2426 286
118 3300049588 Ga0501072_0328516 Ga0501072_0328516_146_1114 286
119 3300049592 Ga0501076_0392817 Ga0501076_0392817_159_1127 286
120 3300049824 Ga0501045_0328167 Ga0501045_0328167_151_1119 286
121 3300005337 Ga0070682_100028195 Ga0070682_1000281952 287
122 3300005455 Ga0070663_100115196 Ga0070663_1001151962 287
123 3300005981 Ga0081538_10001198 Ga0081538_1000119820 287
124 3300006038 Ga0075365_10096809 Ga0075365_100968092 287
125 3300006358 Ga0068871_100068423 Ga0068871_1000684232 287
126 3300009101 Ga0105247_10096510 Ga0105247_100965102 287
127 3300009148 Ga0105243_10090349 Ga0105243_100903491 287
128 3300009177 Ga0105248_10039635 Ga0105248_100396352 287
129 3300021377 Ga0213874_10070137 Ga0213874_100701371 287
130 3300025927 Ga0207687_10118863 Ga0207687_101188632 287
131 3300026035 Ga0207703_10424681 Ga0207703_104246811 287
132 3300026067 Ga0207678_10038844 Ga0207678_100388442 287
133 3300032126 Ga0307415_100051609 Ga0307415_1000516093 287
134 3300044694 Ga0466963_0006299 Ga0466963_0006299_2345_3280 287
135 3300045836 Ga0466958_0259870 Ga0466958_0259870_90_1025 287
136 3300048906 Ga0496103_0007811 Ga0496103_0007811_446_1429 287
137 3300048920 Ga0496117_0000619 Ga0496117_0000619_38311_39294 287
138 3300048921 Ga0496118_0000766 Ga0496118_0000766_12240_13223 287
139 3300049576 Ga0501040_0028992 Ga0501040_0028992_2068_3063 287
140 3300049577 Ga0501041_0010224 Ga0501041_0010224_839_1834 287
141 3300049592 Ga0501076_0061404 Ga0501076_0061404_487_1482 287
142 3300049741 Ga0501079_0082257 Ga0501079_0082257_1394_2389 287
143 3300054114 Ga0501084_0094809 Ga0501084_0094809_825_1820 287
144 3300060353 Ga0501082_0094475 Ga0501082_0094475_43_1038 287
145 3300009098 Ga0105245_10011669 Ga0105245_100116698 288
146 3300021358 Ga0213873_10005797 Ga0213873_100057973 288
147 3300021377 Ga0213874_10004563 Ga0213874_100045633 288
148 3300021388 Ga0213875_10108527 Ga0213875_101085271 288
149 3300025909 Ga0207705_10052426 Ga0207705_100524262 288
150 3300025927 Ga0207687_10040262 Ga0207687_100402622 288
151 3300025972 Ga0207668_10229496 Ga0207668_102294962 288
152 3300025981 Ga0207640_10190851 Ga0207640_101908512 288
153 3300026142 Ga0207698_10313381 Ga0207698_103133812 288
154 3300037418 Ga0395900_0289067 Ga0395900_0289067_41_907 288
155 3300037853 Ga0436364_0801814 Ga0436364_0801814_6565_7536 288
156 3300039437 Ga0436365_1901512 Ga0436365_1901512_10008_10979 288
157 3300039450 Ga0436363_0605788 Ga0436363_0605788_9107_10078 288
158 3300039453 Ga0436362_0943907 Ga0436362_0943907_87_1058 288
159 3300047320 Ga0495672_0020993 Ga0495672_0020993_130_1056 288
160 3300049580 Ga0501046_0294242 Ga0501046_0294242_13_939 288
161 3300005344 Ga0070661_100245909 Ga0070661_1002459092 289
162 3300005347 Ga0070668_100093329 Ga0070668_1000933292 289
163 3300005441 Ga0070700_100038737 Ga0070700_1000387372 289
164 3300005444 Ga0070694_100173209 Ga0070694_1001732092 289
165 3300005564 Ga0070664_100153089 Ga0070664_1001530892 289
166 3300005719 Ga0068861_100215218 Ga0068861_1002152182 289
167 3300009148 Ga0105243_10229337 Ga0105243_102293372 289
168 3300009148 Ga0105243_10270036 Ga0105243_102700362 289
169 3300009553 Ga0105249_10109058 Ga0105249_101090584 289
170 3300021377 Ga0213874_10000194 Ga0213874_100001941 289
171 3300021384 Ga0213876_10035417 Ga0213876_100354172 289
172 3300025920 Ga0207649_10321122 Ga0207649_103211222 289
173 3300025927 Ga0207687_10128792 Ga0207687_101287922 289
174 3300025944 Ga0207661_10093794 Ga0207661_100937942 289
175 3300025945 Ga0207679_10205774 Ga0207679_102057742 289
176 3300025972 Ga0207668_10012905 Ga0207668_100129052 289
177 3300026067 Ga0207678_10149064 Ga0207678_101490642 289
178 3300026075 Ga0207708_10100514 Ga0207708_101005142 289
179 3300026095 Ga0207676_10447750 Ga0207676_104477502 289
180 3300026121 Ga0207683_10289236 Ga0207683_102892362 289
181 3300039437 Ga0436365_0440302 Ga0436365_0440302_1411_2382 289
182 3300039453 Ga0436362_0062100 Ga0436362_0062100_1454_2425 289
183 3300044683 Ga0466965_0035871 Ga0466965_0035871_770_1711 289
184 3300048914 Ga0496111_0249828 Ga0496111_0249828_204_1151 289
185 3300031824 Ga0307413_10010236 Ga0307413_100102364 290
186 3300031995 Ga0307409_100234667 Ga0307409_1002346672 290
187 3300045049 Ga0466959_0084022 Ga0466959_0084022_1054_2025 290
188 3300049587 Ga0501071_0300519 Ga0501071_0300519_160_1170 290
189 3300005336 Ga0070680_100000377 Ga0070680_10000037721 291
190 3300005337 Ga0070682_100009338 Ga0070682_1000093386 291
191 3300005344 Ga0070661_100062397 Ga0070661_1000623972 291
192 3300005366 Ga0070659_100049821 Ga0070659_1000498214 291
193 3300005530 Ga0070679_100001463 Ga0070679_10000146321 291
194 3300005535 Ga0070684_100052205 Ga0070684_1000522052 291
195 3300005539 Ga0068853_100098586 Ga0068853_1000985862 291
196 3300005578 Ga0068854_100049607 Ga0068854_1000496074 291
197 3300005614 Ga0068856_100052107 Ga0068856_1000521074 291
198 3300005616 Ga0068852_100002053 Ga0068852_10000205312 291
199 3300005937 Ga0081455_10126056 Ga0081455_101260561 291
200 3300005981 Ga0081538_10001226 Ga0081538_1000122622 291
201 3300006048 Ga0075363_100144458 Ga0075363_1001444582 291
202 3300006048 Ga0075363_100166102 Ga0075363_1001661022 291
203 3300009093 Ga0105240_10094004 Ga0105240_100940044 291
204 3300009545 Ga0105237_10176225 Ga0105237_101762252 291
205 3300009551 Ga0105238_10008186 Ga0105238_100081867 291
206 3300010375 Ga0105239_10287316 Ga0105239_102873162 291
207 3300013104 Ga0157370_10210897 Ga0157370_102108972 291
208 3300013105 Ga0157369_10003461 Ga0157369_1000346115 291
209 3300013307 Ga0157372_10003908 Ga0157372_1000390812 291
210 3300020082 Ga0206353_11726145 Ga0206353_117261455 291
211 3300022467 Ga0224712_10079041 Ga0224712_100790411 291
212 3300025912 Ga0207707_10001967 Ga0207707_1000196716 291
213 3300025913 Ga0207695_10131582 Ga0207695_101315822 291
214 3300025917 Ga0207660_10012386 Ga0207660_100123865 291
215 3300025920 Ga0207649_10021303 Ga0207649_100213032 291
216 3300025921 Ga0207652_10002299 Ga0207652_100022999 291
217 3300025932 Ga0207690_10053114 Ga0207690_100531142 291
218 3300025944 Ga0207661_10001506 Ga0207661_1000150611 291
219 3300025981 Ga0207640_10040498 Ga0207640_100404982 291
220 3300026041 Ga0207639_10048571 Ga0207639_100485713 291
221 3300026078 Ga0207702_10039380 Ga0207702_100393804 291
222 3300044694 Ga0466963_0101156 Ga0466963_0101156_578_1549 291
223 3300044694 Ga0466963_0217703 Ga0466963_0217703_189_1064 291
224 3300048912 Ga0496109_0000753 Ga0496109_0000753_18459_19388 291
225 3300050490 nmdc:mga03n38_19754_c1 nmdc:mga03n38_19754_c1_164_1129 291
226 3300005985 Ga0081539_10002286 Ga0081539_100022864 292
227 3300031901 Ga0307406_10138584 Ga0307406_101385841 292
228 3300061734 Ga0530510_0035845 Ga0530510_0035845_1039_1971 293
229 3300005535 Ga0070684_100227388 Ga0070684_1002273882 294
230 3300026075 Ga0207708_10034160 Ga0207708_100341602 294
231 3300026089 Ga0207648_10366143 Ga0207648_103661431 294
232 3300031852 Ga0307410_10053395 Ga0307410_100533951 294
233 3300032002 Ga0307416_100236167 Ga0307416_1002361672 294
234 3300037466 Ga0395898_0270790 Ga0395898_0270790_256_1227 294
235 3300038443 Ga0395901_0123458 Ga0395901_0123458_303_1274 294
236 3300045976 Ga0466967_0015486 Ga0466967_0015486_4693_5670 294
237 3300048905 Ga0496102_0250353 Ga0496102_0250353_161_1096 294
238 3300048907 Ga0496104_0066553 Ga0496104_0066553_1823_2758 294
239 3300048910 Ga0496107_0116788 Ga0496107_0116788_517_1452 294
240 3300005337 Ga0070682_100045514 Ga0070682_1000455142 295
241 3300005340 Ga0070689_100101211 Ga0070689_1001012112 295
242 3300005356 Ga0070674_100115428 Ga0070674_1001154282 295
243 3300005366 Ga0070659_100375635 Ga0070659_1003756351 295
244 3300005439 Ga0070711_100208184 Ga0070711_1002081841 295
245 3300005441 Ga0070700_100066220 Ga0070700_1000662202 295
246 3300005455 Ga0070663_100203071 Ga0070663_1002030712 295
247 3300005456 Ga0070678_100158411 Ga0070678_1001584112 295
248 3300005564 Ga0070664_100079587 Ga0070664_1000795872 295
249 3300005577 Ga0068857_100164099 Ga0068857_1001640992 295
250 3300005614 Ga0068856_100170885 Ga0068856_1001708852 295
251 3300005615 Ga0070702_100085052 Ga0070702_1000850522 295
252 3300005718 Ga0068866_10187048 Ga0068866_101870481 295
253 3300005719 Ga0068861_100177847 Ga0068861_1001778472 295
254 3300005844 Ga0068862_100145332 Ga0068862_1001453322 295
255 3300005981 Ga0081538_10003665 Ga0081538_1000366514 295
256 3300006881 Ga0068865_100031397 Ga0068865_1000313975 295
257 3300009094 Ga0111539_10159476 Ga0111539_101594762 295
258 3300009148 Ga0105243_10188412 Ga0105243_101884122 295
259 3300009177 Ga0105248_10367092 Ga0105248_103670922 295
260 3300010375 Ga0105239_10294474 Ga0105239_102944742 295
261 3300010375 Ga0105239_10310404 Ga0105239_103104042 295
262 3300013105 Ga0157369_10374906 Ga0157369_103749061 295
263 3300013306 Ga0163162_10147760 Ga0163162_101477602 295
264 3300014969 Ga0157376_10329940 Ga0157376_103299402 295
265 3300025321 Ga0207656_10045167 Ga0207656_100451672 295
266 3300025904 Ga0207647_10034082 Ga0207647_100340822 295
267 3300025918 Ga0207662_10017897 Ga0207662_100178972 295
268 3300025919 Ga0207657_10208957 Ga0207657_102089571 295
269 3300025932 Ga0207690_10154274 Ga0207690_101542742 295
270 3300025938 Ga0207704_10150092 Ga0207704_101500922 295
271 3300025941 Ga0207711_10199015 Ga0207711_101990153 295
272 3300025945 Ga0207679_10126146 Ga0207679_101261461 295
273 3300025972 Ga0207668_10095258 Ga0207668_100952582 295
274 3300026041 Ga0207639_10085495 Ga0207639_100854952 295
275 3300026078 Ga0207702_10140610 Ga0207702_101406102 295
276 3300026088 Ga0207641_10513284 Ga0207641_105132841 295
277 3300026095 Ga0207676_10511898 Ga0207676_105118981 295
278 3300026116 Ga0207674_10017500 Ga0207674_100175006 295
279 3300026118 Ga0207675_100030323 Ga0207675_1000303232 295
280 3300026142 Ga0207698_10134589 Ga0207698_101345892 295
281 3300028380 Ga0268265_10364449 Ga0268265_103644491 295
282 3300032002 Ga0307416_100456345 Ga0307416_1004563452 295
283 3300045976 Ga0466967_0251497 Ga0466967_0251497_692_1639 295
284 3300048906 Ga0496103_0029643 Ga0496103_0029643_314_1252 295
285 3300048911 Ga0496108_0086717 Ga0496108_0086717_176_1114 295
286 3300048913 Ga0496110_0196101 Ga0496110_0196101_617_1630 295
287 3300003373 JGI25407J50210_10020872 JGI25407J50210_100208723 296
288 3300005548 Ga0070665_100012257 Ga0070665_1000122576 296
289 3300005981 Ga0081538_10003093 Ga0081538_1000309311 296
290 3300009098 Ga0105245_10604309 Ga0105245_106043091 296
291 3300020082 Ga0206353_11303487 Ga0206353_113034872 296
292 3300025972 Ga0207668_10185421 Ga0207668_101854211 296
293 3300028379 Ga0268266_10403040 Ga0268266_104030402 296
294 3300046471 Ga0495650_0000121 Ga0495650_0000121_11527_12459 296
295 3300048927 Ga0496124_0104612 Ga0496124_0104612_328_1320 296
296 3300053153 Ga0500616_0058152 Ga0500616_0058152_371_1309 296
297 3300003203 JGI25406J46586_10005508 JGI25406J46586_100055082 297
298 3300003373 JGI25407J50210_10005900 JGI25407J50210_100059004 297
299 3300003373 JGI25407J50210_10006293 JGI25407J50210_100062932 297
300 3300003373 JGI25407J50210_10007416 JGI25407J50210_100074161 297
301 3300005328 Ga0070676_10094962 Ga0070676_100949621 297
302 3300005336 Ga0070680_100270873 Ga0070680_1002708733 297
303 3300005338 Ga0068868_100089099 Ga0068868_1000890992 297
304 3300005347 Ga0070668_100048526 Ga0070668_1000485263 297
305 3300005347 Ga0070668_100160210 Ga0070668_1001602103 297
306 3300005356 Ga0070674_100300886 Ga0070674_1003008862 297
307 3300005364 Ga0070673_100219937 Ga0070673_1002199372 297
308 3300005438 Ga0070701_10073492 Ga0070701_100734922 297
309 3300005439 Ga0070711_100142960 Ga0070711_1001429602 297
310 3300005441 Ga0070700_100386092 Ga0070700_1003860921 297
311 3300005457 Ga0070662_100003436 Ga0070662_1000034366 297
312 3300005458 Ga0070681_10108608 Ga0070681_101086084 297
313 3300005530 Ga0070679_100006632 Ga0070679_1000066325 297
314 3300005535 Ga0070684_100182268 Ga0070684_1001822682 297
315 3300005548 Ga0070665_100037474 Ga0070665_1000374743 297
316 3300005563 Ga0068855_100600422 Ga0068855_1006004221 297
317 3300005578 Ga0068854_100207087 Ga0068854_1002070872 297
318 3300005614 Ga0068856_100018280 Ga0068856_1000182806 297
319 3300005614 Ga0068856_100023860 Ga0068856_1000238605 297
320 3300005615 Ga0070702_100011574 Ga0070702_1000115745 297
321 3300005616 Ga0068852_100273727 Ga0068852_1002737271 297
322 3300005618 Ga0068864_100126088 Ga0068864_1001260882 297
323 3300005842 Ga0068858_100294091 Ga0068858_1002940912 297
324 3300005937 Ga0081455_10005766 Ga0081455_1000576616 297
325 3300005937 Ga0081455_10052151 Ga0081455_100521513 297
326 3300005981 Ga0081538_10000118 Ga0081538_1000011827 297
327 3300005981 Ga0081538_10000412 Ga0081538_1000041246 297
328 3300005981 Ga0081538_10000761 Ga0081538_1000076118 297
329 3300005981 Ga0081538_10001966 Ga0081538_100019667 297
330 3300005981 Ga0081538_10004687 Ga0081538_100046877 297
331 3300005981 Ga0081538_10004940 Ga0081538_100049407 297
332 3300005981 Ga0081538_10006114 Ga0081538_100061142 297
333 3300005981 Ga0081538_10006708 Ga0081538_100067086 297
334 3300005981 Ga0081538_10011012 Ga0081538_100110126 297
335 3300005981 Ga0081538_10012383 Ga0081538_100123837 297
336 3300005981 Ga0081538_10016899 Ga0081538_100168996 297
337 3300005981 Ga0081538_10022203 Ga0081538_100222033 297
338 3300005981 Ga0081538_10059746 Ga0081538_100597463 297
339 3300005981 Ga0081538_10074669 Ga0081538_100746692 297
340 3300005983 Ga0081540_1025569 Ga0081540_10255694 297
341 3300005985 Ga0081539_10000181 Ga0081539_10000181102 297
342 3300006038 Ga0075365_10017909 Ga0075365_100179095 297
343 3300006038 Ga0075365_10066553 Ga0075365_100665533 297
344 3300006038 Ga0075365_10092730 Ga0075365_100927302 297
345 3300006051 Ga0075364_10009847 Ga0075364_100098475 297
346 3300006051 Ga0075364_10034197 Ga0075364_100341973 297
347 3300006163 Ga0070715_10152025 Ga0070715_101520251 297
348 3300006175 Ga0070712_100050185 Ga0070712_1000501851 297
349 3300006237 Ga0097621_100042024 Ga0097621_1000420243 297
350 3300006844 Ga0075428_100113374 Ga0075428_1001133742 297
351 3300006844 Ga0075428_100690508 Ga0075428_1006905081 297
352 3300006846 Ga0075430_100041116 Ga0075430_1000411162 297
353 3300006847 Ga0075431_100054563 Ga0075431_1000545636 297
354 3300006880 Ga0075429_100083935 Ga0075429_1000839354 297
355 3300009094 Ga0111539_10052620 Ga0111539_100526205 297
356 3300009094 Ga0111539_10520709 Ga0111539_105207092 297
357 3300009094 Ga0111539_10717123 Ga0111539_107171231 297
358 3300009098 Ga0105245_10011707 Ga0105245_100117074 297
359 3300009098 Ga0105245_10013599 Ga0105245_100135996 297
360 3300009101 Ga0105247_10179318 Ga0105247_101793182 297
361 3300009147 Ga0114129_10154324 Ga0114129_101543245 297
362 3300009147 Ga0114129_10469821 Ga0114129_104698212 297
363 3300009147 Ga0114129_10517162 Ga0114129_105171622 297
364 3300009148 Ga0105243_10031322 Ga0105243_100313226 297
365 3300009176 Ga0105242_10384214 Ga0105242_103842141 297
366 3300009176 Ga0105242_10425091 Ga0105242_104250911 297
367 3300009551 Ga0105238_10126326 Ga0105238_101263263 297
368 3300009553 Ga0105249_10088299 Ga0105249_100882996 297
369 3300009553 Ga0105249_10587921 Ga0105249_105879212 297
370 3300010375 Ga0105239_10103464 Ga0105239_101034642 297
371 3300010375 Ga0105239_10137793 Ga0105239_101377935 297
372 3300010375 Ga0105239_10556173 Ga0105239_105561731 297
373 3300013105 Ga0157369_10662815 Ga0157369_106628151 297
374 3300013296 Ga0157374_10005535 Ga0157374_100055357 297
375 3300013307 Ga0157372_10017098 Ga0157372_100170988 297
376 3300013307 Ga0157372_10083623 Ga0157372_100836233 297
377 3300013308 Ga0157375_10002684 Ga0157375_100026848 297
378 3300014745 Ga0157377_10022644 Ga0157377_100226442 297
379 3300014745 Ga0157377_10144646 Ga0157377_101446462 297
380 3300014969 Ga0157376_10496926 Ga0157376_104969262 297
381 3300020082 Ga0206353_11573877 Ga0206353_115738772 297
382 3300022467 Ga0224712_10005082 Ga0224712_100050822 297
383 3300022467 Ga0224712_10169566 Ga0224712_101695661 297
384 3300025901 Ga0207688_10092123 Ga0207688_100921232 297
385 3300025921 Ga0207652_10059594 Ga0207652_100595944 297
386 3300025927 Ga0207687_10099715 Ga0207687_100997152 297
387 3300025927 Ga0207687_10106685 Ga0207687_101066851 297
388 3300025927 Ga0207687_10133616 Ga0207687_101336162 297
389 3300025934 Ga0207686_10050907 Ga0207686_100509072 297
390 3300025961 Ga0207712_10411721 Ga0207712_104117211 297
391 3300025972 Ga0207668_10165151 Ga0207668_101651511 297
392 3300025972 Ga0207668_10171640 Ga0207668_101716402 297
393 3300026078 Ga0207702_10004813 Ga0207702_1000481313 297
394 3300026078 Ga0207702_10243415 Ga0207702_102434151 297
395 3300026118 Ga0207675_100043207 Ga0207675_1000432074 297
396 3300026121 Ga0207683_10498003 Ga0207683_104980031 297
397 3300026142 Ga0207698_10047788 Ga0207698_100477881 297
398 3300027907 Ga0207428_10249286 Ga0207428_102492861 297
399 3300028379 Ga0268266_10036137 Ga0268266_100361372 297
400 3300031548 Ga0307408_100082903 Ga0307408_1000829034 297
401 3300031731 Ga0307405_10057739 Ga0307405_100577393 297
402 3300031731 Ga0307405_10114052 Ga0307405_101140523 297
403 3300031824 Ga0307413_10056028 Ga0307413_100560284 297
404 3300031824 Ga0307413_10123563 Ga0307413_101235632 297
405 3300031852 Ga0307410_10012040 Ga0307410_100120405 297
406 3300031852 Ga0307410_10264304 Ga0307410_102643042 297
407 3300031901 Ga0307406_10028555 Ga0307406_100285553 297
408 3300031901 Ga0307406_10094008 Ga0307406_100940082 297
409 3300031901 Ga0307406_10370782 Ga0307406_103707822 297
410 3300031901 Ga0307406_10407587 Ga0307406_104075871 297
411 3300031903 Ga0307407_10018604 Ga0307407_100186044 297
412 3300031903 Ga0307407_10071469 Ga0307407_100714692 297
413 3300031903 Ga0307407_10090742 Ga0307407_100907422 297
414 3300031911 Ga0307412_10113760 Ga0307412_101137602 297
415 3300031995 Ga0307409_100000655 Ga0307409_10000065511 297
416 3300031995 Ga0307409_100011147 Ga0307409_1000111473 297
417 3300031995 Ga0307409_100121568 Ga0307409_1001215682 297
418 3300032002 Ga0307416_100021508 Ga0307416_1000215082 297
419 3300032002 Ga0307416_100035957 Ga0307416_1000359572 297
420 3300032002 Ga0307416_100041122 Ga0307416_1000411224 297
421 3300032002 Ga0307416_100083179 Ga0307416_1000831793 297
422 3300032002 Ga0307416_100097413 Ga0307416_1000974132 297
423 3300032002 Ga0307416_100104311 Ga0307416_1001043113 297
424 3300032002 Ga0307416_100336211 Ga0307416_1003362112 297
425 3300032002 Ga0307416_100356466 Ga0307416_1003564661 297
426 3300032004 Ga0307414_10007256 Ga0307414_100072567 297
427 3300032004 Ga0307414_10317682 Ga0307414_103176822 297
428 3300032004 Ga0307414_10499131 Ga0307414_104991311 297
429 3300032005 Ga0307411_10070932 Ga0307411_100709324 297
430 3300032005 Ga0307411_10232787 Ga0307411_102327872 297
431 3300032126 Ga0307415_100000531 Ga0307415_1000005312 297
432 3300032126 Ga0307415_100018102 Ga0307415_1000181023 297
433 3300032126 Ga0307415_100100912 Ga0307415_1001009122 297
434 3300032126 Ga0307415_100130455 Ga0307415_1001304553 297
435 3300032126 Ga0307415_100231515 Ga0307415_1002315152 297
436 3300037418 Ga0395900_0324321 Ga0395900_0324321_15_995 297
437 3300037466 Ga0395898_0178783 Ga0395898_0178783_678_1658 297
438 3300037853 Ga0436364_0888707 Ga0436364_0888707_954_1925 297
439 3300038443 Ga0395901_0078852 Ga0395901_0078852_245_1216 297
440 3300038443 Ga0395901_0208182 Ga0395901_0208182_737_1720 297
441 3300039437 Ga0436365_0494652 Ga0436365_0494652_9601_10572 297
442 3300039437 Ga0436365_0855903 Ga0436365_0855903_640_1611 297
443 3300039450 Ga0436363_0101887 Ga0436363_0101887_2332_3303 297
444 3300039450 Ga0436363_0108530 Ga0436363_0108530_146_1117 297
445 3300039453 Ga0436362_0264531 Ga0436362_0264531_91_1062 297
446 3300041410 Ga0439461_0001977 Ga0439461_0001977_1556_2557 297
447 3300041512 Ga0451853_0007471 Ga0451853_0007471_716_1723 297
448 3300041512 Ga0451853_2379236 Ga0451853_2379236_1078_2109 297
449 3300042005 Ga0439448_0012121 Ga0439448_0012121_352_1377 297
450 3300042531 Ga0450918_003461 Ga0450918_003461_792_1799 297
451 3300044683 Ga0466965_0019495 Ga0466965_0019495_530_1510 297
452 3300044694 Ga0466963_0005462 Ga0466963_0005462_2522_3496 297
453 3300044694 Ga0466963_0040989 Ga0466963_0040989_1943_2872 297
454 3300044706 Ga0466964_0011611 Ga0466964_0011611_1698_2672 297
455 3300044719 Ga0466971_0070334 Ga0466971_0070334_192_1172 297
456 3300044735 Ga0466968_0004627 Ga0466968_0004627_2375_3355 297
457 3300044765 Ga0466970_0132463 Ga0466970_0132463_177_1106 297
458 3300044842 Ga0466957_0009461 Ga0466957_0009461_4017_4997 297
459 3300044842 Ga0466957_0041067 Ga0466957_0041067_38_1012 297
460 3300044842 Ga0466957_0230048 Ga0466957_0230048_110_1096 297
461 3300044842 Ga0466957_0256090 Ga0466957_0256090_68_997 297
462 3300044901 Ga0466960_0000005 Ga0466960_0000005_58119_59090 297
463 3300045049 Ga0466959_0050868 Ga0466959_0050868_1869_2798 297
464 3300045049 Ga0466959_0119662 Ga0466959_0119662_832_1803 297
465 3300045049 Ga0466959_0131804 Ga0466959_0131804_273_1229 297
466 3300045976 Ga0466967_0000503 Ga0466967_0000503_15583_16560 297
467 3300045976 Ga0466967_0006242 Ga0466967_0006242_2044_2976 297
468 3300045976 Ga0466967_0059767 Ga0466967_0059767_344_1321 297
469 3300045976 Ga0466967_0070822 Ga0466967_0070822_1978_2961 297
470 3300045976 Ga0466967_0094369 Ga0466967_0094369_1473_2447 297
471 3300045976 Ga0466967_0107032 Ga0466967_0107032_761_1738 297
472 3300045976 Ga0466967_0221474 Ga0466967_0221474_535_1515 297
473 3300045976 Ga0466967_0247806 Ga0466967_0247806_499_1476 297
474 3300045976 Ga0466967_0392825 Ga0466967_0392825_185_1156 297
475 3300048903 Ga0496100_0002667 Ga0496100_0002667_1610_2608 297
476 3300048903 Ga0496100_0225510 Ga0496100_0225510_384_1358 297
477 3300048904 Ga0496101_0146273 Ga0496101_0146273_435_1418 297
478 3300048905 Ga0496102_0051057 Ga0496102_0051057_1307_2305 297
479 3300048905 Ga0496102_0118769 Ga0496102_0118769_625_1599 297
480 3300048906 Ga0496103_0089230 Ga0496103_0089230_232_1230 297
481 3300048907 Ga0496104_0008134 Ga0496104_0008134_2872_3870 297
482 3300048907 Ga0496104_0073837 Ga0496104_0073837_267_1247 297
483 3300048907 Ga0496104_0412103 Ga0496104_0412103_14_988 297
484 3300048908 Ga0496105_0002183 Ga0496105_0002183_8702_9700 297
485 3300048908 Ga0496105_0007438 Ga0496105_0007438_6744_7724 297
486 3300048908 Ga0496105_0213906 Ga0496105_0213906_40_1014 297
487 3300048909 Ga0496106_0022070 Ga0496106_0022070_261_1235 297
488 3300048909 Ga0496106_0152753 Ga0496106_0152753_408_1406 297
489 3300048910 Ga0496107_0052903 Ga0496107_0052903_408_1406 297
490 3300048911 Ga0496108_0000894 Ga0496108_0000894_4886_5860 297
491 3300048911 Ga0496108_0007071 Ga0496108_0007071_1624_2604 297
492 3300048911 Ga0496108_0010239 Ga0496108_0010239_5464_6462 297
493 3300048911 Ga0496108_0024845 Ga0496108_0024845_3020_4003 297
494 3300048912 Ga0496109_0000326 Ga0496109_0000326_28003_28983 297
495 3300048912 Ga0496109_0006929 Ga0496109_0006929_7722_8696 297
496 3300048912 Ga0496109_0007731 Ga0496109_0007731_8127_9059 297
497 3300048912 Ga0496109_0011798 Ga0496109_0011798_1286_2284 297
498 3300048912 Ga0496109_0173795 Ga0496109_0173795_182_1120 297
499 3300048913 Ga0496110_0002845 Ga0496110_0002845_5300_6298 297
500 3300048913 Ga0496110_0012777 Ga0496110_0012777_5337_6311 297
501 3300048913 Ga0496110_0047764 Ga0496110_0047764_835_1809 297
502 3300048913 Ga0496110_0056058 Ga0496110_0056058_1069_2049 297
503 3300048913 Ga0496110_0189512 Ga0496110_0189512_234_1229 297
504 3300048913 Ga0496110_0203200 Ga0496110_0203200_715_1698 297
505 3300048914 Ga0496111_0006374 Ga0496111_0006374_5351_6349 297
506 3300048914 Ga0496111_0007380 Ga0496111_0007380_1470_2450 297
507 3300048914 Ga0496111_0009574 Ga0496111_0009574_2581_3555 297
508 3300048914 Ga0496111_0079952 Ga0496111_0079952_1317_2300 297
509 3300048914 Ga0496111_0190100 Ga0496111_0190100_352_1350 297
510 3300048914 Ga0496111_0234533 Ga0496111_0234533_86_1018 297
511 3300048915 Ga0496112_0011422 Ga0496112_0011422_3345_4325 297
512 3300048915 Ga0496112_0041071 Ga0496112_0041071_1026_2000 297
513 3300048916 Ga0496113_0013478 Ga0496113_0013478_3340_4314 297
514 3300048916 Ga0496113_0031402 Ga0496113_0031402_2718_3698 297
515 3300048917 Ga0496114_0000990 Ga0496114_0000990_15235_16233 297
516 3300048918 Ga0496115_0192488 Ga0496115_0192488_295_1275 297
517 3300048927 Ga0496124_0121828 Ga0496124_0121828_884_1840 297
518 3300049568 Ga0501031_0004357 Ga0501031_0004357_6339_7280 297
519 3300049568 Ga0501031_0017795 Ga0501031_0017795_554_1546 297
520 3300049568 Ga0501031_0025420 Ga0501031_0025420_1412_2404 297
521 3300049568 Ga0501031_0032017 Ga0501031_0032017_1864_2892 297
522 3300049568 Ga0501031_0039685 Ga0501031_0039685_2055_3059 297
523 3300049569 Ga0501032_0004803 Ga0501032_0004803_3464_4405 297
524 3300049569 Ga0501032_0166439 Ga0501032_0166439_308_1312 297
525 3300049570 Ga0501033_0018958 Ga0501033_0018958_1388_2329 297
526 3300049570 Ga0501033_0041302 Ga0501033_0041302_195_1187 297
527 3300049571 Ga0501034_0011301 Ga0501034_0011301_3310_4284 297
528 3300049571 Ga0501034_0115335 Ga0501034_0115335_752_1846 297
529 3300049572 Ga0501036_0043669 Ga0501036_0043669_411_1403 297
530 3300049572 Ga0501036_0050220 Ga0501036_0050220_1166_2107 297
531 3300049572 Ga0501036_0122747 Ga0501036_0122747_575_1597 297
532 3300049572 Ga0501036_0138551 Ga0501036_0138551_554_1546 297
533 3300049572 Ga0501036_0150947 Ga0501036_0150947_19_1017 297
534 3300049572 Ga0501036_0172106 Ga0501036_0172106_473_1426 297
535 3300049572 Ga0501036_0208718 Ga0501036_0208718_373_1401 297
536 3300049573 Ga0501037_0002769 Ga0501037_0002769_5586_6527 297
537 3300049573 Ga0501037_0055771 Ga0501037_0055771_1158_2186 297
538 3300049574 Ga0501038_0003753 Ga0501038_0003753_11767_12708 297
539 3300049574 Ga0501038_0030562 Ga0501038_0030562_1739_2731 297
540 3300049574 Ga0501038_0033506 Ga0501038_0033506_3245_4237 297
541 3300049574 Ga0501038_0171606 Ga0501038_0171606_289_1317 297
542 3300049575 Ga0501039_0004459 Ga0501039_0004459_9492_10484 297
543 3300049575 Ga0501039_0022741 Ga0501039_0022741_756_1697 297
544 3300049575 Ga0501039_0043644 Ga0501039_0043644_2364_3299 297
545 3300049575 Ga0501039_0095731 Ga0501039_0095731_445_1473 297
546 3300049575 Ga0501039_0109862 Ga0501039_0109862_311_1303 297
547 3300049576 Ga0501040_0017272 Ga0501040_0017272_583_1575 297
548 3300049576 Ga0501040_0025804 Ga0501040_0025804_409_1344 297
549 3300049576 Ga0501040_0027930 Ga0501040_0027930_264_1295 297
550 3300049576 Ga0501040_0036832 Ga0501040_0036832_1425_2378 297
551 3300049576 Ga0501040_0040049 Ga0501040_0040049_229_1173 297
552 3300049576 Ga0501040_0070304 Ga0501040_0070304_58_1011 297
553 3300049577 Ga0501041_0013196 Ga0501041_0013196_1222_2214 297
554 3300049577 Ga0501041_0062463 Ga0501041_0062463_1093_2085 297
555 3300049577 Ga0501041_0110258 Ga0501041_0110258_739_1692 297
556 3300049577 Ga0501041_0259629 Ga0501041_0259629_29_1060 297
557 3300049577 Ga0501041_0265968 Ga0501041_0265968_28_1056 297
558 3300049578 Ga0501042_0012344 Ga0501042_0012344_1854_2807 297
559 3300049578 Ga0501042_0020235 Ga0501042_0020235_852_1844 297
560 3300049578 Ga0501042_0092212 Ga0501042_0092212_240_1169 297
561 3300049578 Ga0501042_0149274 Ga0501042_0149274_369_1367 297
562 3300049578 Ga0501042_0245249 Ga0501042_0245249_253_1281 297
563 3300049579 Ga0501043_0034752 Ga0501043_0034752_1531_2472 297
564 3300049579 Ga0501043_0113005 Ga0501043_0113005_721_1656 297
565 3300049579 Ga0501043_0330842 Ga0501043_0330842_42_1073 297
566 3300049579 Ga0501043_0345666 Ga0501043_0345666_153_1106 297
567 3300049580 Ga0501046_0005549 Ga0501046_0005549_6695_7687 297
568 3300049580 Ga0501046_0018249 Ga0501046_0018249_3485_4426 297
569 3300049580 Ga0501046_0087086 Ga0501046_0087086_582_1610 297
570 3300049580 Ga0501046_0186332 Ga0501046_0186332_46_1050 297
571 3300049580 Ga0501046_0358771 Ga0501046_0358771_46_1026 297
572 3300049581 Ga0501047_0027727 Ga0501047_0027727_3813_4745 297
573 3300049581 Ga0501047_0067281 Ga0501047_0067281_913_1854 297
574 3300049581 Ga0501047_0110901 Ga0501047_0110901_1420_2514 297
575 3300049582 Ga0501048_0002489 Ga0501048_0002489_9771_10712 297
576 3300049582 Ga0501048_0012939 Ga0501048_0012939_2987_3979 297
577 3300049582 Ga0501048_0052121 Ga0501048_0052121_1821_2774 297
578 3300049582 Ga0501048_0118122 Ga0501048_0118122_741_1733 297
579 3300049582 Ga0501048_0312734 Ga0501048_0312734_78_1082 297
580 3300049583 Ga0501067_0017219 Ga0501067_0017219_278_1219 297
581 3300049584 Ga0501068_0002271 Ga0501068_0002271_2438_3430 297
582 3300049584 Ga0501068_0064949 Ga0501068_0064949_17_952 297
583 3300049584 Ga0501068_0092864 Ga0501068_0092864_223_1176 297
584 3300049584 Ga0501068_0187425 Ga0501068_0187425_77_1105 297
585 3300049584 Ga0501068_0188055 Ga0501068_0188055_275_1279 297
586 3300049585 Ga0501069_0017386 Ga0501069_0017386_201_1229 297
587 3300049585 Ga0501069_0018063 Ga0501069_0018063_1697_2638 297
588 3300049585 Ga0501069_0079933 Ga0501069_0079933_717_1688 297
589 3300049586 Ga0501070_0044118 Ga0501070_0044118_1493_2434 297
590 3300049586 Ga0501070_0172135 Ga0501070_0172135_776_1768 297
591 3300049587 Ga0501071_0003111 Ga0501071_0003111_4930_5922 297
592 3300049587 Ga0501071_0049221 Ga0501071_0049221_1221_2252 297
593 3300049587 Ga0501071_0057386 Ga0501071_0057386_1028_2056 297
594 3300049587 Ga0501071_0060381 Ga0501071_0060381_1459_2451 297
595 3300049587 Ga0501071_0065264 Ga0501071_0065264_339_1361 297
596 3300049587 Ga0501071_0079713 Ga0501071_0079713_932_1885 297
597 3300049587 Ga0501071_0080399 Ga0501071_0080399_1291_2295 297
598 3300049587 Ga0501071_0100238 Ga0501071_0100238_673_1617 297
599 3300049587 Ga0501071_0166891 Ga0501071_0166891_224_1159 297
600 3300049588 Ga0501072_0009002 Ga0501072_0009002_5287_6279 297
601 3300049588 Ga0501072_0031226 Ga0501072_0031226_359_1387 297
602 3300049588 Ga0501072_0042390 Ga0501072_0042390_1000_2010 297
603 3300049588 Ga0501072_0056458 Ga0501072_0056458_2064_3068 297
604 3300049588 Ga0501072_0089294 Ga0501072_0089294_142_1164 297
605 3300049588 Ga0501072_0112005 Ga0501072_0112005_780_1772 297
606 3300049588 Ga0501072_0247670 Ga0501072_0247670_160_1158 297
607 3300049589 Ga0501073_0043928 Ga0501073_0043928_308_1249 297
608 3300049589 Ga0501073_0067379 Ga0501073_0067379_434_1426 297
609 3300049590 Ga0501074_0006500 Ga0501074_0006500_7212_8204 297
610 3300049590 Ga0501074_0006612 Ga0501074_0006612_1287_2228 297
611 3300049590 Ga0501074_0054478 Ga0501074_0054478_31_1023 297
612 3300049590 Ga0501074_0305078 Ga0501074_0305078_63_1094 297
613 3300049590 Ga0501074_0341821 Ga0501074_0341821_108_1043 297
614 3300049591 Ga0501075_0004445 Ga0501075_0004445_8062_9054 297
615 3300049591 Ga0501075_0021150 Ga0501075_0021150_537_1568 297
616 3300049591 Ga0501075_0023425 Ga0501075_0023425_2077_3081 297
617 3300049591 Ga0501075_0096095 Ga0501075_0096095_216_1214 297
618 3300049591 Ga0501075_0097206 Ga0501075_0097206_332_1360 297
619 3300049592 Ga0501076_0007814 Ga0501076_0007814_5268_6272 297
620 3300049592 Ga0501076_0008142 Ga0501076_0008142_2766_3758 297
621 3300049592 Ga0501076_0011403 Ga0501076_0011403_2281_3234 297
622 3300049592 Ga0501076_0028506 Ga0501076_0028506_3121_4074 297
623 3300049592 Ga0501076_0032144 Ga0501076_0032144_231_1253 297
624 3300049592 Ga0501076_0052237 Ga0501076_0052237_506_1498 297
625 3300049592 Ga0501076_0073663 Ga0501076_0073663_924_1955 297
626 3300049592 Ga0501076_0205773 Ga0501076_0205773_399_1427 297
627 3300049593 Ga0501077_0032152 Ga0501077_0032152_2223_3215 297
628 3300049593 Ga0501077_0074690 Ga0501077_0074690_195_1187 297
629 3300049593 Ga0501077_0106864 Ga0501077_0106864_106_1137 297
630 3300049593 Ga0501077_0237261 Ga0501077_0237261_157_1110 297
631 3300049741 Ga0501079_0017033 Ga0501079_0017033_3668_4621 297
632 3300049741 Ga0501079_0024985 Ga0501079_0024985_3526_4557 297
633 3300049741 Ga0501079_0025897 Ga0501079_0025897_506_1498 297
634 3300049741 Ga0501079_0140931 Ga0501079_0140931_70_1014 297
635 3300049741 Ga0501079_0269728 Ga0501079_0269728_298_1233 297
636 3300049742 Ga0501080_0061837 Ga0501080_0061837_1099_2040 297
637 3300049743 Ga0501081_0005599 Ga0501081_0005599_4085_5077 297
638 3300049743 Ga0501081_0030794 Ga0501081_0030794_1463_2407 297
639 3300049743 Ga0501081_0072664 Ga0501081_0072664_1183_2175 297
640 3300049744 Ga0501083_0040996 Ga0501083_0040996_1043_1984 297
641 3300049744 Ga0501083_0273342 Ga0501083_0273342_42_1070 297
642 3300049822 Ga0501035_0018223 Ga0501035_0018223_734_1675 297
643 3300049822 Ga0501035_0076211 Ga0501035_0076211_73_1026 297
644 3300049822 Ga0501035_0266160 Ga0501035_0266160_454_1407 297
645 3300049822 Ga0501035_0349545 Ga0501035_0349545_89_1087 297
646 3300049823 Ga0501044_0014862 Ga0501044_0014862_4491_5483 297
647 3300049823 Ga0501044_0034027 Ga0501044_0034027_1426_2367 297
648 3300049823 Ga0501044_0376182 Ga0501044_0376182_39_1067 297
649 3300049824 Ga0501045_0019194 Ga0501045_0019194_1499_2491 297
650 3300049824 Ga0501045_0082239 Ga0501045_0082239_501_1523 297
651 3300049824 Ga0501045_0188051 Ga0501045_0188051_42_1055 297
652 3300050491 nmdc:mga00v17_191274_c1 nmdc:mga00v17_191274_c1_294_1271 297
653 3300050491 nmdc:mga00v17_41311_c1 nmdc:mga00v17_41311_c1_1651_2634 297
654 3300050507 nmdc:mga05p37_378395_c1 nmdc:mga05p37_378395_c1_53_1030 297
655 3300050508 nmdc:mga09592_227321_c1 nmdc:mga09592_227321_c1_446_1384 297
656 3300050510 nmdc:mga06r32_202821_c1 nmdc:mga06r32_202821_c1_103_1110 297
657 3300050510 nmdc:mga06r32_76346_c1 nmdc:mga06r32_76346_c1_1840_2817 297
658 3300053096 Ga0500641_0013882 Ga0500641_0013882_1949_2878 297
659 3300053104 Ga0500556_0001060 Ga0500556_0001060_12484_13395 297
660 3300053153 Ga0500616_0058716 Ga0500616_0058716_532_1443 297
661 3300053736 Ga0500599_002571 Ga0500599_002571_440_1351 297
662 3300054114 Ga0501084_0004200 Ga0501084_0004200_10184_11137 297
663 3300054114 Ga0501084_0032428 Ga0501084_0032428_345_1337 297
664 3300054114 Ga0501084_0062326 Ga0501084_0062326_34_1026 297
665 3300054114 Ga0501084_0203662 Ga0501084_0203662_229_1227 297
666 3300054114 Ga0501084_0310507 Ga0501084_0310507_37_1047 297
667 3300054114 Ga0501084_0346176 Ga0501084_0346176_205_1233 297
668 3300060353 Ga0501082_0013763 Ga0501082_0013763_1354_2295 297
669 3300060353 Ga0501082_0014079 Ga0501082_0014079_5143_6135 297
670 3300060353 Ga0501082_0038736 Ga0501082_0038736_2380_3372 297
671 3300060353 Ga0501082_0134996 Ga0501082_0134996_220_1242 297
672 3300060353 Ga0501082_0203718 Ga0501082_0203718_66_1094 297
673 3300060353 Ga0501082_0220272 Ga0501082_0220272_218_1171 297
674 3300060353 Ga0501082_0358614 Ga0501082_0358614_46_1050 297
675 3300061734 Ga0530510_0004106 Ga0530510_0004106_7761_8753 297
676 3300061734 Ga0530510_0016773 Ga0530510_0016773_3338_4291 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05067

Mn_catalase

Manganese containing catalase

1

300

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v8t-assembly1.cif.gz_A crystal structure of mn catalase from thermus thermophilus complexed with chloride 0.9384 1 285
2cwl-assembly1.cif.gz_A crystal structure of manganese-free form of pseudocatalase from thermus thermophilus hb8 0.938 1 282
2v8t-assembly1.cif.gz_A crystal structure of mn catalase from thermus thermophilus complexed with chloride 0.8985 1 285
2cwl-assembly1.cif.gz_A crystal structure of manganese-free form of pseudocatalase from thermus thermophilus hb8 0.889 1 282
6j42-assembly1.cif.gz_B-2 crystal structure of wild type katb, a manganese catalase from anabaena 0.8232 1 224
ID Description Score Start End Superfamily
2cwlA01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.938 3 282 1.20.1260.10
af_Q4CYB4_1172_1308_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.9221 130 182 1.20.58.1120
af_Q9C0G6_1303_1448_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.9215 128 185 1.20.58.1120
4r42B01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.895 1 193 1.20.1260.10
1jkuA01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8948 1 189 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7V9H882-F1-model_v4 Manganese catalase family protein 0.9829 1 88
AF-A0A7K0PBL1-F1-model_v4 Manganese catalase family protein 0.9754 1 87
AF-A0A6J4SF62-F1-model_v4 Manganese catalase (EC 1.11.1.6) 0.9564 1 289 GO:0004096
AF-A0A4Q3AWB6-F1-model_v4 deleted 0.9564 1 88
AF-A0A4R1T4U3-F1-model_v4 deleted 0.9537 1 188

Feature Viewer

pLDDT pTM Quality
92.32 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map