F474564
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 676 | 356 | 654 | 349 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8055172936|8055174599 |
| Length | 397 |
| Sequence | GKTQVSSTVSEPGIHMTRIAAVRGALPPNRYPQTEITDTFARICLPPGADRRLLDRLHTSARVGHRNLVLPLEQYAKLDGFGMANEIFIEAAVELGAEAVGAALEAAGLTPRDVDMIMFTSVTGIAAPSVDARLAGRLGLRPDVKRVPVFGLGCVAGAAGIGRLHDYLRGWPDHVAVLLSVELCSLTLQRGDSSPVNLVASGLFGDGAAAVVACGSGRAVPGSEGASVPGSEGAVGSGGMPGTGPTPGGPDAAGPTVIATRSHLYPDSEAVMGWEVSDTGFRVVLDTTVPEVVRTYLADDVHGFLADHGLTARDVTAWVCHPGGPKVLQAVAETLDLPDGALDLTWRSLADIGNLSSSSVLHVLRDTLALRPPPPGTPGVLIAMGPGFCSELVLLRW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 4 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 5 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 6 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 7 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 8 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 9 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 10 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 11 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 12 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 13 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 14 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 15 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 16 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 17 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 18 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 19 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 20 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 21 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 22 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 23 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 24 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 25 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 26 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 27 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 28 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 134 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 137 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 194 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 200 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 201 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 202 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 209 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 216 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 217 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 218 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 219 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 220 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 223 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 224 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 225 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 226 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 227 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 228 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 229 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 230 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 233 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 234 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 237 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 238 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 239 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 240 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 309 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 310 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 311 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 312 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 313 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 346 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 348 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 349 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 350 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 351 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 352 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 353 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 355 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 356 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.45 |
| Metatranscriptomes | 0.3 |
| Isolates | 3.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.36 |
| Nodule | 0.15 |
| Rhizoplane | 7.4 |
| Rhizosphere | 78.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1002411 | 3300001977 | Bacteria | 2982 |
| 2 | JGI24739J22299_10013268 | 3300001989 | Bacteria | 3011 |
| 3 | JGI24737J22298_10007391 | 3300001990 | Bacteria | 3711 |
| 4 | JGI24743J22301_10001106 | 3300001991 | Bacteria | 3603 |
| 5 | JGI24750J21931_1001541 | 3300002070 | Bacteria | 2839 |
| 6 | JGI24744J21845_10001375 | 3300002077 | Bacteria | 4818 |
| 7 | JGI24034J26672_10001541 | 3300002239 | Bacteria | 3064 |
| 8 | JGI24742J22300_10002497 | 3300002244 | Bacteria | 2940 |
| 9 | rootH2_10195207 | 3300003320 | Bacteria | 5915 |
| 10 | Ga0070658_10006864 | 3300005327 | Bacteria | 9203 |
| 11 | Ga0070683_100126221 | 3300005329 | Bacteria | 2419 |
| 12 | Ga0070690_100009368 | 3300005330 | Bacteria | 5671 |
| 13 | Ga0068869_100017484 | 3300005334 | Bacteria | 4862 |
| 14 | Ga0070666_10012330 | 3300005335 | Bacteria | 5389 |
| 15 | Ga0070680_100189573 | 3300005336 | Bacteria | 1732 |
| 16 | Ga0070680_100346219 | 3300005336 | Bacteria | 1263 |
| 17 | Ga0070682_100018767 | 3300005337 | Bacteria | 4049 |
| 18 | Ga0068868_100001534 | 3300005338 | Bacteria | 15815 |
| 19 | Ga0070660_100030184 | 3300005339 | Bacteria | 4066 |
| 20 | Ga0070660_100193926 | 3300005339 | Bacteria | 1646 |
| 21 | Ga0070691_10139672 | 3300005341 | Bacteria | 1233 |
| 22 | Ga0070692_10148630 | 3300005345 | Bacteria | 1332 |
| 23 | Ga0070668_100003591 | 3300005347 | Bacteria | 11440 |
| 24 | Ga0070668_100156530 | 3300005347 | Bacteria | 1846 |
| 25 | Ga0070669_100052715 | 3300005353 | Bacteria | 2977 |
| 26 | Ga0070675_100050835 | 3300005354 | Bacteria | 3404 |
| 27 | Ga0070671_100001055 | 3300005355 | Bacteria | 20319 |
| 28 | Ga0070671_100082278 | 3300005355 | Bacteria | 2692 |
| 29 | Ga0070674_100005222 | 3300005356 | Bacteria | 7472 |
| 30 | Ga0070674_100008711 | 3300005356 | Bacteria | 6051 |
| 31 | Ga0070674_100196880 | 3300005356 | Bacteria | 1553 |
| 32 | Ga0070673_100148537 | 3300005364 | Bacteria | 1983 |
| 33 | Ga0070673_100192256 | 3300005364 | Bacteria | 1753 |
| 34 | Ga0070688_100006042 | 3300005365 | Bacteria | 6428 |
| 35 | Ga0070688_100006500 | 3300005365 | Bacteria | 6250 |
| 36 | Ga0070659_100066313 | 3300005366 | Bacteria | 2860 |
| 37 | Ga0070659_100163309 | 3300005366 | Bacteria | 1822 |
| 38 | Ga0070667_100003168 | 3300005367 | Bacteria | 14101 |
| 39 | Ga0070667_100006233 | 3300005367 | Bacteria | 9924 |
| 40 | Ga0070667_100033162 | 3300005367 | Bacteria | 4313 |
| 41 | Ga0070667_100438597 | 3300005367 | Bacteria | 1192 |
| 42 | Ga0070709_10074023 | 3300005434 | Bacteria | 2207 |
| 43 | Ga0070709_10225796 | 3300005434 | Bacteria | 1337 |
| 44 | Ga0070714_100049241 | 3300005435 | Bacteria | 3586 |
| 45 | Ga0070714_100188451 | 3300005435 | Bacteria | 1881 |
| 46 | Ga0070710_10001392 | 3300005437 | Bacteria | 11417 |
| 47 | Ga0070710_10083407 | 3300005437 | Bacteria | 1870 |
| 48 | Ga0070701_10006493 | 3300005438 | Bacteria | 4927 |
| 49 | Ga0070711_100008288 | 3300005439 | Bacteria | 6359 |
| 50 | Ga0070711_100028177 | 3300005439 | Bacteria | 3694 |
| 51 | Ga0070705_100108009 | 3300005440 | Bacteria | 1772 |
| 52 | Ga0070700_100005245 | 3300005441 | Bacteria | 6853 |
| 53 | Ga0070700_100033608 | 3300005441 | Bacteria | 3090 |
| 54 | Ga0070694_100004880 | 3300005444 | Bacteria | 8078 |
| 55 | Ga0070663_100054446 | 3300005455 | Bacteria | 2860 |
| 56 | Ga0070678_100002759 | 3300005456 | Bacteria | 9710 |
| 57 | Ga0070678_100143932 | 3300005456 | Bacteria | 1911 |
| 58 | Ga0070678_100222228 | 3300005456 | Bacteria | 1570 |
| 59 | Ga0070662_100026108 | 3300005457 | Bacteria | 4042 |
| 60 | Ga0070681_10042415 | 3300005458 | Bacteria | 4559 |
| 61 | Ga0070681_10082039 | 3300005458 | Bacteria | 3180 |
| 62 | Ga0070681_10182905 | 3300005458 | Bacteria | 2017 |
| 63 | Ga0068867_100005802 | 3300005459 | Bacteria | 8761 |
| 64 | Ga0068867_100112610 | 3300005459 | Bacteria | 2092 |
| 65 | Ga0070684_100167019 | 3300005535 | Bacteria | 1998 |
| 66 | Ga0068853_100010078 | 3300005539 | Bacteria | 7635 |
| 67 | Ga0068853_100102204 | 3300005539 | Bacteria | 2536 |
| 68 | Ga0068853_100120082 | 3300005539 | Bacteria | 2344 |
| 69 | Ga0068853_100272314 | 3300005539 | Bacteria | 1559 |
| 70 | Ga0070672_100079954 | 3300005543 | Bacteria | 2618 |
| 71 | Ga0070686_100022138 | 3300005544 | Bacteria | 3783 |
| 72 | Ga0070686_100044128 | 3300005544 | Bacteria | 2800 |
| 73 | Ga0070695_100021292 | 3300005545 | Bacteria | 3966 |
| 74 | Ga0070696_100057020 | 3300005546 | Bacteria | 2726 |
| 75 | Ga0070693_100010110 | 3300005547 | Bacteria | 4712 |
| 76 | Ga0070693_100025397 | 3300005547 | Bacteria | 3188 |
| 77 | Ga0070665_100010566 | 3300005548 | Bacteria | 9343 |
| 78 | Ga0070665_100037661 | 3300005548 | Bacteria | 4863 |
| 79 | Ga0070665_100198972 | 3300005548 | Bacteria | 2004 |
| 80 | Ga0070704_100000313 | 3300005549 | Bacteria | 21721 |
| 81 | Ga0070704_100028516 | 3300005549 | Bacteria | 3715 |
| 82 | Ga0070704_100140074 | 3300005549 | Bacteria | 1887 |
| 83 | Ga0068855_100005049 | 3300005563 | Bacteria | 16107 |
| 84 | Ga0068855_100308153 | 3300005563 | Bacteria | 1752 |
| 85 | Ga0068855_100610503 | 3300005563 | Bacteria | 1175 |
| 86 | Ga0068854_100001484 | 3300005578 | Bacteria | 14214 |
| 87 | Ga0068854_100002893 | 3300005578 | Bacteria | 10668 |
| 88 | Ga0068856_100035735 | 3300005614 | Bacteria | 4870 |
| 89 | Ga0068856_100039164 | 3300005614 | Bacteria | 4653 |
| 90 | Ga0068856_100363551 | 3300005614 | Bacteria | 1466 |
| 91 | Ga0070702_100187142 | 3300005615 | Bacteria | 1359 |
| 92 | Ga0068852_100015840 | 3300005616 | Bacteria | 5863 |
| 93 | Ga0068852_100085631 | 3300005616 | Bacteria | 2808 |
| 94 | Ga0068859_100004026 | 3300005617 | Bacteria | 14985 |
| 95 | Ga0068859_100130908 | 3300005617 | Bacteria | 2580 |
| 96 | Ga0068864_100329234 | 3300005618 | Bacteria | 1437 |
| 97 | Ga0068866_10056984 | 3300005718 | Bacteria | 2011 |
| 98 | Ga0068861_100001049 | 3300005719 | Bacteria | 16983 |
| 99 | Ga0068861_100052638 | 3300005719 | Bacteria | 3095 |
| 100 | Ga0068861_100242406 | 3300005719 | Bacteria | 1534 |
| 101 | Ga0068861_100441335 | 3300005719 | Bacteria | 1164 |
| 102 | Ga0068863_100006420 | 3300005841 | Bacteria | 11530 |
| 103 | Ga0068863_100021810 | 3300005841 | Bacteria | 6112 |
| 104 | Ga0068858_100014801 | 3300005842 | Bacteria | 7339 |
| 105 | Ga0068858_100162416 | 3300005842 | Bacteria | 2103 |
| 106 | Ga0068858_100437377 | 3300005842 | Bacteria | 1259 |
| 107 | Ga0068860_100002092 | 3300005843 | Bacteria | 21025 |
| 108 | Ga0068860_100368896 | 3300005843 | Bacteria | 1415 |
| 109 | Ga0068862_100003302 | 3300005844 | Bacteria | 13953 |
| 110 | Ga0068862_100075250 | 3300005844 | Bacteria | 2920 |
| 111 | Ga0081455_10011250 | 3300005937 | Bacteria | 9003 |
| 112 | Ga0081455_10055362 | 3300005937 | Bacteria | 3374 |
| 113 | Ga0070717_10021403 | 3300006028 | Bacteria | 5095 |
| 114 | Ga0075365_10082714 | 3300006038 | Bacteria | 2177 |
| 115 | Ga0075365_10170482 | 3300006038 | Bacteria | 1519 |
| 116 | Ga0075363_100007673 | 3300006048 | Bacteria | 4976 |
| 117 | Ga0075363_100040039 | 3300006048 | Bacteria | 2469 |
| 118 | Ga0075364_10001908 | 3300006051 | Bacteria | 11600 |
| 119 | Ga0075364_10004603 | 3300006051 | Bacteria | 7947 |
| 120 | Ga0075364_10074333 | 3300006051 | Bacteria | 2241 |
| 121 | Ga0075364_10085463 | 3300006051 | Bacteria | 2089 |
| 122 | Ga0070715_10000197 | 3300006163 | Bacteria | 14144 |
| 123 | Ga0070716_100040545 | 3300006173 | Bacteria | 2591 |
| 124 | Ga0070712_100006916 | 3300006175 | Bacteria | 7068 |
| 125 | Ga0070712_100013001 | 3300006175 | Bacteria | 5309 |
| 126 | Ga0070712_100124993 | 3300006175 | Bacteria | 1941 |
| 127 | Ga0070712_100162377 | 3300006175 | Bacteria | 1726 |
| 128 | Ga0075362_10063002 | 3300006177 | Bacteria | 1681 |
| 129 | Ga0075367_10018625 | 3300006178 | Bacteria | 3835 |
| 130 | Ga0075367_10023412 | 3300006178 | Bacteria | 3475 |
| 131 | Ga0075369_10000432 | 3300006186 | Bacteria | 12737 |
| 132 | Ga0075369_10012593 | 3300006186 | Bacteria | 3341 |
| 133 | Ga0075369_10019582 | 3300006186 | Bacteria | 2764 |
| 134 | Ga0075369_10056568 | 3300006186 | Bacteria | 1705 |
| 135 | Ga0075369_10071518 | 3300006186 | Bacteria | 1527 |
| 136 | Ga0097621_100029904 | 3300006237 | Bacteria | 4306 |
| 137 | Ga0075370_10048108 | 3300006353 | Bacteria | 2416 |
| 138 | Ga0068871_100090829 | 3300006358 | Bacteria | 2544 |
| 139 | Ga0068871_100204345 | 3300006358 | Bacteria | 1707 |
| 140 | Ga0075430_100224330 | 3300006846 | Bacteria | 1559 |
| 141 | Ga0075431_100056504 | 3300006847 | Bacteria | 4048 |
| 142 | Ga0075431_100313091 | 3300006847 | Bacteria | 1584 |
| 143 | Ga0075429_100024137 | 3300006880 | Bacteria | 5274 |
| 144 | Ga0068865_100104823 | 3300006881 | Bacteria | 2076 |
| 145 | Ga0068865_100190268 | 3300006881 | Bacteria | 1586 |
| 146 | Ga0097620_100004026 | 3300006931 | Bacteria | 14985 |
| 147 | Ga0097620_100130913 | 3300006931 | Bacteria | 2580 |
| 148 | Ga0099794_10001021 | 3300007265 | Bacteria | 9488 |
| 149 | Ga0105251_10054305 | 3300009011 | Bacteria | 1903 |
| 150 | Ga0105250_10007891 | 3300009092 | Bacteria | 4549 |
| 151 | Ga0105240_10004501 | 3300009093 | Bacteria | 21181 |
| 152 | Ga0105245_10005751 | 3300009098 | Bacteria | 10883 |
| 153 | Ga0105245_10079624 | 3300009098 | Bacteria | 2992 |
| 154 | Ga0105247_10003309 | 3300009101 | Bacteria | 10558 |
| 155 | Ga0114129_10022999 | 3300009147 | Bacteria | 8843 |
| 156 | Ga0114129_10054328 | 3300009147 | Bacteria | 5615 |
| 157 | Ga0114129_10130049 | 3300009147 | Bacteria | 3459 |
| 158 | Ga0105243_10000779 | 3300009148 | Bacteria | 30542 |
| 159 | Ga0105243_10203574 | 3300009148 | Bacteria | 1738 |
| 160 | Ga0105241_10008273 | 3300009174 | Bacteria | 7658 |
| 161 | Ga0105241_10424446 | 3300009174 | Bacteria | 1171 |
| 162 | Ga0105242_10000066 | 3300009176 | Bacteria | 73865 |
| 163 | Ga0105248_10037978 | 3300009177 | Bacteria | 5387 |
| 164 | Ga0105237_10059499 | 3300009545 | Bacteria | 3822 |
| 165 | Ga0105237_10131334 | 3300009545 | Bacteria | 2499 |
| 166 | Ga0105237_10223042 | 3300009545 | Bacteria | 1885 |
| 167 | Ga0105237_10253280 | 3300009545 | Bacteria | 1763 |
| 168 | Ga0105238_10188912 | 3300009551 | Bacteria | 2036 |
| 169 | Ga0105249_10004766 | 3300009553 | Bacteria | 11701 |
| 170 | Ga0105249_10050690 | 3300009553 | Bacteria | 3784 |
| 171 | Ga0105249_10486663 | 3300009553 | Bacteria | 1277 |
| 172 | Ga0105239_10015683 | 3300010375 | Bacteria | 8386 |
| 173 | Ga0105239_10020214 | 3300010375 | Bacteria | 7345 |
| 174 | Ga0105239_10290580 | 3300010375 | Bacteria | 1841 |
| 175 | Ga0105239_10583957 | 3300010375 | Bacteria | 1274 |
| 176 | Ga0105246_10135595 | 3300011119 | Bacteria | 1844 |
| 177 | Ga0157373_10045936 | 3300013100 | Bacteria | 3117 |
| 178 | Ga0157369_10022248 | 3300013105 | Bacteria | 7079 |
| 179 | Ga0157369_10065414 | 3300013105 | Bacteria | 3913 |
| 180 | Ga0157369_10077529 | 3300013105 | Bacteria | 3562 |
| 181 | Ga0157374_10010125 | 3300013296 | Bacteria | 8100 |
| 182 | Ga0157374_10028848 | 3300013296 | Bacteria | 5017 |
| 183 | Ga0157374_10087228 | 3300013296 | Bacteria | 2970 |
| 184 | Ga0157378_10002159 | 3300013297 | Bacteria | 17478 |
| 185 | Ga0163162_10014890 | 3300013306 | Bacteria | 7594 |
| 186 | Ga0163162_10075854 | 3300013306 | Bacteria | 3423 |
| 187 | Ga0163162_10142805 | 3300013306 | Bacteria | 2508 |
| 188 | Ga0163162_10169078 | 3300013306 | Bacteria | 2310 |
| 189 | Ga0163162_10204831 | 3300013306 | Bacteria | 2102 |
| 190 | Ga0163162_10366505 | 3300013306 | Bacteria | 1574 |
| 191 | Ga0157372_10123852 | 3300013307 | Bacteria | 2972 |
| 192 | Ga0157375_10000268 | 3300013308 | Bacteria | 47381 |
| 193 | Ga0157375_10153402 | 3300013308 | Bacteria | 2440 |
| 194 | Ga0163163_10010671 | 3300014325 | Bacteria | 8279 |
| 195 | Ga0157380_10000036 | 3300014326 | Bacteria | 81892 |
| 196 | Ga0157377_10031203 | 3300014745 | Bacteria | 2894 |
| 197 | Ga0157377_10034140 | 3300014745 | Bacteria | 2782 |
| 198 | Ga0157377_10115503 | 3300014745 | Bacteria | 1619 |
| 199 | Ga0157379_10001562 | 3300014968 | Bacteria | 18866 |
| 200 | Ga0157376_10065953 | 3300014969 | Bacteria | 3059 |
| 201 | Ga0157376_10088990 | 3300014969 | Bacteria | 2669 |
| 202 | Ga0157376_10325101 | 3300014969 | Bacteria | 1463 |
| 203 | Ga0163161_10009914 | 3300017792 | Bacteria | 6598 |
| 204 | Ga0197907_11018771 | 3300020069 | Bacteria | 1952 |
| 205 | Ga0213872_10013785 | 3300021361 | Bacteria | 3781 |
| 206 | Ga0213874_10015250 | 3300021377 | Bacteria | 2024 |
| 207 | Ga0213874_10018415 | 3300021377 | Unclassified | 1887 |
| 208 | Ga0213876_10013131 | 3300021384 | Bacteria | 4401 |
| 209 | Ga0213876_10066336 | 3300021384 | Bacteria | 1905 |
| 210 | Ga0213876_10092656 | 3300021384 | Unclassified | 1600 |
| 211 | Ga0213875_10000575 | 3300021388 | Bacteria | 29979 |
| 212 | Ga0213875_10009380 | 3300021388 | Bacteria | 4962 |
| 213 | Ga0213875_10014462 | 3300021388 | Unclassified | 3850 |
| 214 | Ga0213875_10042447 | 3300021388 | Bacteria | 2136 |
| 215 | Ga0224712_10040707 | 3300022467 | Bacteria | 1750 |
| 216 | Ga0207696_1024521 | 3300025711 | Bacteria | 1891 |
| 217 | Ga0207692_10025507 | 3300025898 | Bacteria | 2762 |
| 218 | Ga0207642_10004003 | 3300025899 | Bacteria | 4706 |
| 219 | Ga0207642_10117544 | 3300025899 | Bacteria | 1366 |
| 220 | Ga0207710_10001082 | 3300025900 | Bacteria | 14018 |
| 221 | Ga0207688_10001014 | 3300025901 | Bacteria | 14331 |
| 222 | Ga0207688_10007147 | 3300025901 | Bacteria | 6072 |
| 223 | Ga0207647_10011346 | 3300025904 | Bacteria | 6253 |
| 224 | Ga0207647_10041867 | 3300025904 | Bacteria | 2877 |
| 225 | Ga0207647_10131326 | 3300025904 | Bacteria | 1472 |
| 226 | Ga0207699_10054060 | 3300025906 | Bacteria | 2384 |
| 227 | Ga0207645_10009109 | 3300025907 | Bacteria | 6885 |
| 228 | Ga0207705_10003150 | 3300025909 | Bacteria | 12558 |
| 229 | Ga0207705_10184033 | 3300025909 | Unclassified | 1578 |
| 230 | Ga0207654_10011826 | 3300025911 | Bacteria | 4459 |
| 231 | Ga0207654_10058692 | 3300025911 | Bacteria | 2241 |
| 232 | Ga0207654_10069188 | 3300025911 | Bacteria | 2091 |
| 233 | Ga0207707_10057685 | 3300025912 | Bacteria | 3379 |
| 234 | Ga0207695_10002443 | 3300025913 | Bacteria | 27463 |
| 235 | Ga0207671_10002910 | 3300025914 | Bacteria | 17666 |
| 236 | Ga0207693_10000224 | 3300025915 | Bacteria | 51559 |
| 237 | Ga0207693_10007684 | 3300025915 | Bacteria | 8853 |
| 238 | Ga0207693_10010959 | 3300025915 | Bacteria | 7346 |
| 239 | Ga0207693_10170608 | 3300025915 | Bacteria | 1713 |
| 240 | Ga0207693_10236766 | 3300025915 | Bacteria | 1433 |
| 241 | Ga0207663_10006226 | 3300025916 | Bacteria | 6087 |
| 242 | Ga0207657_10018386 | 3300025919 | Bacteria | 6673 |
| 243 | Ga0207681_10179757 | 3300025923 | Bacteria | 1610 |
| 244 | Ga0207694_10001312 | 3300025924 | Bacteria | 21375 |
| 245 | Ga0207659_10200287 | 3300025926 | Bacteria | 1594 |
| 246 | Ga0207659_10206546 | 3300025926 | Bacteria | 1572 |
| 247 | Ga0207687_10000594 | 3300025927 | Bacteria | 24499 |
| 248 | Ga0207687_10008487 | 3300025927 | Bacteria | 6716 |
| 249 | Ga0207687_10047832 | 3300025927 | Bacteria | 2967 |
| 250 | Ga0207664_10079939 | 3300025929 | Bacteria | 2656 |
| 251 | Ga0207644_10052351 | 3300025931 | Bacteria | 2933 |
| 252 | Ga0207644_10084306 | 3300025931 | Bacteria | 2355 |
| 253 | Ga0207690_10226193 | 3300025932 | Bacteria | 1434 |
| 254 | Ga0207706_10000288 | 3300025933 | Bacteria | 54869 |
| 255 | Ga0207686_10003068 | 3300025934 | Bacteria | 8987 |
| 256 | Ga0207709_10007903 | 3300025935 | Bacteria | 5897 |
| 257 | Ga0207670_10059445 | 3300025936 | Bacteria | 2600 |
| 258 | Ga0207669_10000196 | 3300025937 | Bacteria | 27615 |
| 259 | Ga0207669_10026418 | 3300025937 | Bacteria | 3157 |
| 260 | Ga0207704_10001017 | 3300025938 | Bacteria | 12443 |
| 261 | Ga0207704_10010220 | 3300025938 | Bacteria | 4567 |
| 262 | Ga0207704_10013681 | 3300025938 | Bacteria | 4072 |
| 263 | Ga0207704_10018203 | 3300025938 | Bacteria | 3663 |
| 264 | Ga0207665_10008988 | 3300025939 | Bacteria | 6557 |
| 265 | Ga0207665_10010453 | 3300025939 | Bacteria | 6099 |
| 266 | Ga0207665_10065209 | 3300025939 | Bacteria | 2476 |
| 267 | Ga0207691_10054663 | 3300025940 | Bacteria | 3642 |
| 268 | Ga0207691_10205210 | 3300025940 | Bacteria | 1714 |
| 269 | Ga0207711_10031606 | 3300025941 | Bacteria | 4470 |
| 270 | Ga0207689_10027054 | 3300025942 | Bacteria | 4801 |
| 271 | Ga0207667_10073808 | 3300025949 | Bacteria | 3544 |
| 272 | Ga0207667_10285162 | 3300025949 | Bacteria | 1687 |
| 273 | Ga0207712_10070324 | 3300025961 | Bacteria | 2514 |
| 274 | Ga0207712_10141600 | 3300025961 | Bacteria | 1846 |
| 275 | Ga0207712_10170739 | 3300025961 | Bacteria | 1700 |
| 276 | Ga0207668_10000708 | 3300025972 | Bacteria | 20382 |
| 277 | Ga0207668_10006971 | 3300025972 | Bacteria | 6702 |
| 278 | Ga0207668_10237081 | 3300025972 | Bacteria | 1474 |
| 279 | Ga0207640_10004862 | 3300025981 | Bacteria | 7298 |
| 280 | Ga0207640_10049193 | 3300025981 | Bacteria | 2728 |
| 281 | Ga0207658_10016511 | 3300025986 | Bacteria | 5078 |
| 282 | Ga0207658_10016993 | 3300025986 | Bacteria | 5008 |
| 283 | Ga0207677_10038457 | 3300026023 | Bacteria | 3137 |
| 284 | Ga0207703_10007155 | 3300026035 | Bacteria | 8876 |
| 285 | Ga0207703_10016663 | 3300026035 | Bacteria | 5732 |
| 286 | Ga0207703_10037293 | 3300026035 | Bacteria | 3872 |
| 287 | Ga0207703_10506197 | 3300026035 | Bacteria | 1134 |
| 288 | Ga0207639_10083156 | 3300026041 | Bacteria | 2540 |
| 289 | Ga0207678_10014277 | 3300026067 | Bacteria | 6984 |
| 290 | Ga0207678_10018104 | 3300026067 | Bacteria | 6187 |
| 291 | Ga0207678_10146433 | 3300026067 | Bacteria | 2016 |
| 292 | Ga0207708_10000667 | 3300026075 | Bacteria | 26347 |
| 293 | Ga0207708_10003048 | 3300026075 | Bacteria | 12338 |
| 294 | Ga0207702_10026632 | 3300026078 | Bacteria | 4800 |
| 295 | Ga0207702_10050180 | 3300026078 | Bacteria | 3523 |
| 296 | Ga0207641_10042878 | 3300026088 | Bacteria | 3797 |
| 297 | Ga0207641_10133458 | 3300026088 | Bacteria | 2232 |
| 298 | Ga0207648_10001622 | 3300026089 | Bacteria | 24662 |
| 299 | Ga0207648_10068522 | 3300026089 | Bacteria | 3092 |
| 300 | Ga0207648_10475692 | 3300026089 | Bacteria | 1140 |
| 301 | Ga0207676_10249819 | 3300026095 | Bacteria | 1596 |
| 302 | Ga0207675_100000324 | 3300026118 | Bacteria | 45435 |
| 303 | Ga0207675_100001148 | 3300026118 | Bacteria | 26257 |
| 304 | Ga0207675_100071618 | 3300026118 | Bacteria | 3241 |
| 305 | Ga0207675_100140160 | 3300026118 | Bacteria | 2297 |
| 306 | Ga0207683_10000077 | 3300026121 | Bacteria | 77710 |
| 307 | Ga0207683_10002485 | 3300026121 | Bacteria | 16082 |
| 308 | Ga0207683_10040740 | 3300026121 | Bacteria | 4055 |
| 309 | Ga0207683_10262030 | 3300026121 | Bacteria | 1578 |
| 310 | Ga0207428_10199168 | 3300027907 | Bacteria | 1507 |
| 311 | Ga0268266_10008138 | 3300028379 | Bacteria | 9363 |
| 312 | Ga0268266_10011847 | 3300028379 | Bacteria | 7556 |
| 313 | Ga0268266_10048719 | 3300028379 | Bacteria | 3632 |
| 314 | Ga0268265_10008953 | 3300028380 | Bacteria | 6769 |
| 315 | Ga0268264_10001281 | 3300028381 | Bacteria | 23793 |
| 316 | Ga0268264_10011619 | 3300028381 | Bacteria | 7262 |
| 317 | Ga0307515_10023269 | 3300028794 | Bacteria | 10866 |
| 318 | Ga0265338_10001088 | 3300028800 | Bacteria | 45144 |
| 319 | Ga0307512_10016297 | 3300030522 | Bacteria | 6864 |
| 320 | Ga0265339_10003630 | 3300031249 | Bacteria | 10767 |
| 321 | Ga0307513_10032914 | 3300031456 | Bacteria | 5837 |
| 322 | Ga0307513_10074084 | 3300031456 | Bacteria | 3542 |
| 323 | Ga0307508_10063119 | 3300031616 | Bacteria | 3269 |
| 324 | Ga0307514_10107836 | 3300031649 | Bacteria | 1982 |
| 325 | Ga0265314_10132941 | 3300031711 | Bacteria | 1549 |
| 326 | Ga0316576_10004486 | 3300031727 | Bacteria | 8384 |
| 327 | Ga0316577_10119780 | 3300031733 | Bacteria | 1479 |
| 328 | Ga0307518_10002821 | 3300031838 | Bacteria | 12609 |
| 329 | Ga0373948_0009169 | 3300034817 | Bacteria | 1702 |
| 330 | Ga0373949_0006400 | 3300035090 | Bacteria | 2591 |
| 331 | Ga0373951_0007158 | 3300035091 | Bacteria | 2538 |
| 332 | Ga0373932_0057322 | 3300035112 | Bacteria | 1174 |
| 333 | Ga0373942_0012269 | 3300035207 | Bacteria | 2044 |
| 334 | Ga0373935_0114160 | 3300035692 | Bacteria | 1796 |
| 335 | Ga0316582_0016179 | 3300036647 | Bacteria | 4285 |
| 336 | Ga0316584_0166417 | 3300036712 | Bacteria | 1637 |
| 337 | Ga0395900_0098024 | 3300037418 | Bacteria | 3012 |
| 338 | Ga0395898_0136673 | 3300037466 | Bacteria | 2347 |
| 339 | Ga0395905_0360754 | 3300037471 | Bacteria | 1346 |
| 340 | Ga0436364_0108822 | 3300037853 | Bacteria | 3669 |
| 341 | Ga0436364_0271209 | 3300037853 | Bacteria | 17136 |
| 342 | Ga0436364_0934343 | 3300037853 | Bacteria | 2136 |
| 343 | Ga0436364_1008502 | 3300037853 | Bacteria | 66010 |
| 344 | Ga0436364_1345478 | 3300037853 | Unclassified | 4922 |
| 345 | Ga0436365_0187823 | 3300039437 | Bacteria | 22544 |
| 346 | Ga0436365_0464118 | 3300039437 | Bacteria | 5357 |
| 347 | Ga0436365_0588267 | 3300039437 | Bacteria | 3146 |
| 348 | Ga0436365_0810711 | 3300039437 | Bacteria | 50192 |
| 349 | Ga0436365_1409440 | 3300039437 | Bacteria | 11548 |
| 350 | Ga0436361_0474393 | 3300039447 | Bacteria | 166415 |
| 351 | Ga0436363_0010176 | 3300039450 | Unclassified | 2173 |
| 352 | Ga0436363_0360664 | 3300039450 | Bacteria | 5780 |
| 353 | Ga0439461_0000574 | 3300041410 | Bacteria | 5329 |
| 354 | Ga0439466_0002159 | 3300041411 | Bacteria | 7706 |
| 355 | Ga0439465_0047262 | 3300041413 | Bacteria | 1402 |
| 356 | Ga0451793_0215871 | 3300041452 | Bacteria | 2155 |
| 357 | Ga0451797_1104098 | 3300041453 | Bacteria | 1926 |
| 358 | Ga0439431_0000447 | 3300041997 | Bacteria | 8689 |
| 359 | Ga0439442_017270 | 3300042002 | Bacteria | 1489 |
| 360 | Ga0439434_0003234 | 3300042435 | Bacteria | 4784 |
| 361 | Ga0439434_0029280 | 3300042435 | Bacteria | 1669 |
| 362 | Ga0466969_0003976 | 3300044656 | Bacteria | 7849 |
| 363 | Ga0466972_0033971 | 3300044658 | Bacteria | 2501 |
| 364 | Ga0466972_0035646 | 3300044658 | Bacteria | 2435 |
| 365 | Ga0466965_0000686 | 3300044683 | Bacteria | 12514 |
| 366 | Ga0466965_0006756 | 3300044683 | Bacteria | 5234 |
| 367 | Ga0466965_0011035 | 3300044683 | Bacteria | 4225 |
| 368 | Ga0466966_0001411 | 3300044684 | Bacteria | 15471 |
| 369 | Ga0466966_0075782 | 3300044684 | Bacteria | 2101 |
| 370 | Ga0466961_0001880 | 3300044693 | Bacteria | 13054 |
| 371 | Ga0466963_0001442 | 3300044694 | Bacteria | 12805 |
| 372 | Ga0466963_0045955 | 3300044694 | Bacteria | 2877 |
| 373 | Ga0466963_0254026 | 3300044694 | Bacteria | 1234 |
| 374 | Ga0453684_0360009 | 3300044712 | Bacteria | 1638 |
| 375 | Ga0466971_0047062 | 3300044719 | Bacteria | 1938 |
| 376 | Ga0466968_0007037 | 3300044735 | Bacteria | 4263 |
| 377 | Ga0466970_0000235 | 3300044765 | Bacteria | 27066 |
| 378 | Ga0466970_0018544 | 3300044765 | Bacteria | 3603 |
| 379 | Ga0466970_0021565 | 3300044765 | Bacteria | 3355 |
| 380 | Ga0466957_0011701 | 3300044842 | Bacteria | 5071 |
| 381 | Ga0466957_0013117 | 3300044842 | Bacteria | 4803 |
| 382 | Ga0466957_0018278 | 3300044842 | Bacteria | 4116 |
| 383 | Ga0466957_0044037 | 3300044842 | Bacteria | 2704 |
| 384 | Ga0466960_0000043 | 3300044901 | Bacteria | 40805 |
| 385 | Ga0466960_0000893 | 3300044901 | Bacteria | 10550 |
| 386 | Ga0466960_0009641 | 3300044901 | Bacteria | 3987 |
| 387 | Ga0466960_0017115 | 3300044901 | Bacteria | 3155 |
| 388 | Ga0466959_0000228 | 3300045049 | Bacteria | 35389 |
| 389 | Ga0466959_0041991 | 3300045049 | Bacteria | 3374 |
| 390 | Ga0466958_0003793 | 3300045836 | Bacteria | 7889 |
| 391 | Ga0466958_0027616 | 3300045836 | Bacteria | 3360 |
| 392 | Ga0466958_0031525 | 3300045836 | Bacteria | 3151 |
| 393 | Ga0466958_0036071 | 3300045836 | Bacteria | 2958 |
| 394 | Ga0466958_0200396 | 3300045836 | Bacteria | 1270 |
| 395 | Ga0466967_0001278 | 3300045976 | Bacteria | 14303 |
| 396 | Ga0466967_0035672 | 3300045976 | Bacteria | 4236 |
| 397 | Ga0466967_0078198 | 3300045976 | Bacteria | 2980 |
| 398 | Ga0466967_0078503 | 3300045976 | Bacteria | 2974 |
| 399 | Ga0466967_0081226 | 3300045976 | Bacteria | 2928 |
| 400 | Ga0466967_0102573 | 3300045976 | Bacteria | 2617 |
| 401 | Ga0466967_0194891 | 3300045976 | Bacteria | 1916 |
| 402 | Ga0495617_008207 | 3300046452 | Bacteria | 3606 |
| 403 | Ga0495592_0001429 | 3300046454 | Bacteria | 16573 |
| 404 | Ga0495592_0066581 | 3300046454 | Bacteria | 2635 |
| 405 | Ga0495592_0077813 | 3300046454 | Bacteria | 2403 |
| 406 | Ga0495592_0164446 | 3300046454 | Bacteria | 1524 |
| 407 | Ga0495603_0000765 | 3300046455 | Bacteria | 18365 |
| 408 | Ga0495603_0003497 | 3300046455 | Bacteria | 9346 |
| 409 | Ga0495603_0012031 | 3300046455 | Bacteria | 5238 |
| 410 | Ga0495629_0004675 | 3300046459 | Bacteria | 10257 |
| 411 | Ga0495629_0005953 | 3300046459 | Bacteria | 9079 |
| 412 | Ga0495629_0022019 | 3300046459 | Bacteria | 4545 |
| 413 | Ga0495629_0056176 | 3300046459 | Bacteria | 2753 |
| 414 | Ga0495629_0078102 | 3300046459 | Bacteria | 2311 |
| 415 | Ga0495638_0172521 | 3300046460 | Bacteria | 1240 |
| 416 | Ga0495641_0037619 | 3300046461 | Bacteria | 2266 |
| 417 | Ga0495641_0050006 | 3300046461 | Bacteria | 1912 |
| 418 | Ga0495651_0002255 | 3300046462 | Bacteria | 14897 |
| 419 | Ga0495651_0007772 | 3300046462 | Bacteria | 8205 |
| 420 | Ga0495651_0009658 | 3300046462 | Bacteria | 7418 |
| 421 | Ga0495651_0045916 | 3300046462 | Bacteria | 3382 |
| 422 | Ga0495653_0015204 | 3300046463 | Bacteria | 6273 |
| 423 | Ga0495653_0152298 | 3300046463 | Bacteria | 1614 |
| 424 | Ga0495582_0059540 | 3300046473 | Bacteria | 2107 |
| 425 | Ga0495582_0138703 | 3300046473 | Bacteria | 1377 |
| 426 | Ga0495662_0004034 | 3300046476 | Bacteria | 7394 |
| 427 | Ga0495662_0009605 | 3300046476 | Bacteria | 4743 |
| 428 | Ga0495662_0010308 | 3300046476 | Bacteria | 4579 |
| 429 | Ga0495662_0018701 | 3300046476 | Bacteria | 3354 |
| 430 | Ga0495664_0003276 | 3300046477 | Bacteria | 8801 |
| 431 | Ga0495664_0009224 | 3300046477 | Bacteria | 5515 |
| 432 | Ga0495664_0235376 | 3300046477 | Bacteria | 1108 |
| 433 | Ga0495585_0001761 | 3300046492 | Bacteria | 16474 |
| 434 | Ga0495585_0038486 | 3300046492 | Bacteria | 2692 |
| 435 | Ga0495594_0044024 | 3300046499 | Bacteria | 2448 |
| 436 | Ga0495594_0079672 | 3300046499 | Bacteria | 1829 |
| 437 | Ga0495594_0084619 | 3300046499 | Bacteria | 1774 |
| 438 | Ga0495607_0064977 | 3300046501 | Bacteria | 2059 |
| 439 | Ga0495583_0020098 | 3300046506 | Bacteria | 3468 |
| 440 | Ga0495628_0010353 | 3300046516 | Bacteria | 7929 |
| 441 | Ga0495628_0059510 | 3300046516 | Bacteria | 2999 |
| 442 | Ga0495630_0020357 | 3300046517 | Bacteria | 4891 |
| 443 | Ga0495630_0043526 | 3300046517 | Bacteria | 3354 |
| 444 | Ga0495652_0012110 | 3300046529 | Bacteria | 7792 |
| 445 | Ga0495652_0038924 | 3300046529 | Bacteria | 4114 |
| 446 | Ga0495652_0147174 | 3300046529 | Bacteria | 1845 |
| 447 | Ga0495665_0082224 | 3300046531 | Bacteria | 1693 |
| 448 | Ga0495640_0001256 | 3300046533 | Bacteria | 19903 |
| 449 | Ga0495640_0004019 | 3300046533 | Bacteria | 11767 |
| 450 | Ga0495640_0010089 | 3300046533 | Bacteria | 7321 |
| 451 | Ga0495640_0065115 | 3300046533 | Bacteria | 2462 |
| 452 | Ga0495587_0001809 | 3300046536 | Bacteria | 14267 |
| 453 | Ga0495587_0006340 | 3300046536 | Bacteria | 7713 |
| 454 | Ga0495587_0010691 | 3300046536 | Bacteria | 5827 |
| 455 | Ga0495645_0010749 | 3300046543 | Bacteria | 6432 |
| 456 | Ga0495645_0054714 | 3300046543 | Bacteria | 2899 |
| 457 | Ga0495667_0016349 | 3300046559 | Bacteria | 5014 |
| 458 | Ga0495667_0034528 | 3300046559 | Bacteria | 3382 |
| 459 | Ga0495634_0000535 | 3300046642 | Bacteria | 37286 |
| 460 | Ga0495634_0035550 | 3300046642 | Bacteria | 3410 |
| 461 | Ga0495634_0086632 | 3300046642 | Bacteria | 2040 |
| 462 | Ga0495611_0003683 | 3300046648 | Bacteria | 6712 |
| 463 | Ga0495635_0001798 | 3300046663 | Bacteria | 14499 |
| 464 | Ga0495635_0007371 | 3300046663 | Bacteria | 7675 |
| 465 | Ga0495635_0142665 | 3300046663 | Bacteria | 1631 |
| 466 | Ga0495635_0217688 | 3300046663 | Bacteria | 1292 |
| 467 | Ga0495588_0023666 | 3300046674 | Bacteria | 3043 |
| 468 | Ga0495588_0038616 | 3300046674 | Bacteria | 2429 |
| 469 | Ga0495657_0002019 | 3300046675 | Bacteria | 17285 |
| 470 | Ga0495657_0002058 | 3300046675 | Bacteria | 17117 |
| 471 | Ga0495657_0008280 | 3300046675 | Bacteria | 7966 |
| 472 | Ga0495657_0011542 | 3300046675 | Bacteria | 6602 |
| 473 | Ga0495657_0032941 | 3300046675 | Bacteria | 3612 |
| 474 | Ga0495599_0005251 | 3300046678 | Bacteria | 7728 |
| 475 | Ga0495623_0005019 | 3300046679 | Bacteria | 8678 |
| 476 | Ga0495646_0001682 | 3300046680 | Bacteria | 13232 |
| 477 | Ga0495646_0004122 | 3300046680 | Bacteria | 9123 |
| 478 | Ga0495658_0040562 | 3300046683 | Bacteria | 2589 |
| 479 | Ga0495613_0003158 | 3300046689 | Bacteria | 12343 |
| 480 | Ga0495613_0003801 | 3300046689 | Bacteria | 11318 |
| 481 | Ga0495613_0004186 | 3300046689 | Bacteria | 10795 |
| 482 | Ga0495613_0004495 | 3300046689 | Bacteria | 10453 |
| 483 | Ga0495613_0008195 | 3300046689 | Bacteria | 7762 |
| 484 | Ga0495613_0009210 | 3300046689 | Bacteria | 7320 |
| 485 | Ga0495624_0068387 | 3300046690 | Bacteria | 2214 |
| 486 | Ga0495670_0138863 | 3300046691 | Bacteria | 1270 |
| 487 | Ga0495589_0020033 | 3300046794 | Bacteria | 3421 |
| 488 | Ga0495600_0004749 | 3300046809 | Bacteria | 8152 |
| 489 | Ga0495600_0053138 | 3300046809 | Bacteria | 2645 |
| 490 | Ga0495600_0092713 | 3300046809 | Bacteria | 1970 |
| 491 | Ga0495660_0003633 | 3300046810 | Bacteria | 9494 |
| 492 | Ga0495581_0006822 | 3300047315 | Bacteria | 6624 |
| 493 | Ga0495581_0025921 | 3300047315 | Bacteria | 3400 |
| 494 | Ga0495581_0035263 | 3300047315 | Bacteria | 2895 |
| 495 | Ga0495581_0070913 | 3300047315 | Bacteria | 2016 |
| 496 | Ga0495604_0000284 | 3300047317 | Bacteria | 45236 |
| 497 | Ga0495604_0001320 | 3300047317 | Bacteria | 20245 |
| 498 | Ga0495604_0010657 | 3300047317 | Bacteria | 7291 |
| 499 | Ga0495604_0023894 | 3300047317 | Bacteria | 4878 |
| 500 | Ga0495604_0055515 | 3300047317 | Bacteria | 3052 |
| 501 | Ga0495604_0068210 | 3300047317 | Bacteria | 2700 |
| 502 | Ga0495636_0011349 | 3300047318 | Bacteria | 3526 |
| 503 | Ga0495674_0021560 | 3300047319 | Bacteria | 5957 |
| 504 | Ga0495674_0049107 | 3300047319 | Bacteria | 3730 |
| 505 | Ga0495672_0088365 | 3300047320 | Bacteria | 1708 |
| 506 | Ga0495676_0028092 | 3300047321 | Bacteria | 4812 |
| 507 | Ga0495676_0040198 | 3300047321 | Bacteria | 3863 |
| 508 | Ga0495676_0049517 | 3300047321 | Bacteria | 3377 |
| 509 | Ga0495676_0057414 | 3300047321 | Bacteria | 3070 |
| 510 | Ga0495683_0001156 | 3300047323 | Bacteria | 18115 |
| 511 | Ga0495687_002795 | 3300047443 | Bacteria | 13470 |
| 512 | Ga0495675_0003362 | 3300047444 | Bacteria | 9635 |
| 513 | Ga0495675_0015699 | 3300047444 | Bacteria | 4788 |
| 514 | Ga0495675_0024034 | 3300047444 | Bacteria | 3882 |
| 515 | Ga0495675_0066185 | 3300047444 | Bacteria | 2284 |
| 516 | Ga0495685_035358 | 3300047447 | Bacteria | 1717 |
| 517 | Ga0495684_0005393 | 3300047471 | Bacteria | 9956 |
| 518 | Ga0495684_0045437 | 3300047471 | Bacteria | 3361 |
| 519 | Ga0495593_0005510 | 3300047673 | Bacteria | 7471 |
| 520 | Ga0495593_0013924 | 3300047673 | Bacteria | 4582 |
| 521 | Ga0495593_0031540 | 3300047673 | Bacteria | 2894 |
| 522 | Ga0495602_0010713 | 3300048088 | Bacteria | 9507 |
| 523 | Ga0495614_0000601 | 3300048089 | Bacteria | 15073 |
| 524 | Ga0495614_0091970 | 3300048089 | Bacteria | 1320 |
| 525 | Ga0496100_0038245 | 3300048903 | Bacteria | 3040 |
| 526 | Ga0496100_0056016 | 3300048903 | Bacteria | 2578 |
| 527 | Ga0496100_0069841 | 3300048903 | Bacteria | 2340 |
| 528 | Ga0496100_0100125 | 3300048903 | Bacteria | 1996 |
| 529 | Ga0496101_0006148 | 3300048904 | Bacteria | 7707 |
| 530 | Ga0496101_0038130 | 3300048904 | Bacteria | 3412 |
| 531 | Ga0496101_0235950 | 3300048904 | Bacteria | 1423 |
| 532 | Ga0496102_0000915 | 3300048905 | Bacteria | 27833 |
| 533 | Ga0496102_0002940 | 3300048905 | Bacteria | 14452 |
| 534 | Ga0496102_0014909 | 3300048905 | Bacteria | 6762 |
| 535 | Ga0496102_0067515 | 3300048905 | Bacteria | 3280 |
| 536 | Ga0496102_0150096 | 3300048905 | Bacteria | 2189 |
| 537 | Ga0496103_0008168 | 3300048906 | Bacteria | 6212 |
| 538 | Ga0496103_0012660 | 3300048906 | Bacteria | 5004 |
| 539 | Ga0496103_0020319 | 3300048906 | Bacteria | 3989 |
| 540 | Ga0496104_0051861 | 3300048907 | Bacteria | 3873 |
| 541 | Ga0496105_0021530 | 3300048908 | Bacteria | 5216 |
| 542 | Ga0496106_0001251 | 3300048909 | Bacteria | 19027 |
| 543 | Ga0496106_0095081 | 3300048909 | Bacteria | 2304 |
| 544 | Ga0496106_0133394 | 3300048909 | Bacteria | 1949 |
| 545 | Ga0496107_0000854 | 3300048910 | Bacteria | 17883 |
| 546 | Ga0496107_0064070 | 3300048910 | Bacteria | 2664 |
| 547 | Ga0496107_0134032 | 3300048910 | Bacteria | 1830 |
| 548 | Ga0496108_0000375 | 3300048911 | Bacteria | 37222 |
| 549 | Ga0496108_0045273 | 3300048911 | Bacteria | 3675 |
| 550 | Ga0496108_0048600 | 3300048911 | Bacteria | 3547 |
| 551 | Ga0496108_0093243 | 3300048911 | Bacteria | 2561 |
| 552 | Ga0496109_0011398 | 3300048912 | Bacteria | 7640 |
| 553 | Ga0496109_0013758 | 3300048912 | Bacteria | 7030 |
| 554 | Ga0496109_0170304 | 3300048912 | Bacteria | 2043 |
| 555 | Ga0496109_0174396 | 3300048912 | Bacteria | 2018 |
| 556 | Ga0496109_0388348 | 3300048912 | Bacteria | 1319 |
| 557 | Ga0496110_0003151 | 3300048913 | Bacteria | 12541 |
| 558 | Ga0496111_0064454 | 3300048914 | Bacteria | 2658 |
| 559 | Ga0496111_0124659 | 3300048914 | Bacteria | 1904 |
| 560 | Ga0496112_0007519 | 3300048915 | Bacteria | 9671 |
| 561 | Ga0496112_0012218 | 3300048915 | Bacteria | 7882 |
| 562 | Ga0496112_0021144 | 3300048915 | Bacteria | 6183 |
| 563 | Ga0496112_0391299 | 3300048915 | Bacteria | 1330 |
| 564 | Ga0496112_0409967 | 3300048915 | Bacteria | 1294 |
| 565 | Ga0496113_0057270 | 3300048916 | Bacteria | 2929 |
| 566 | Ga0496113_0195037 | 3300048916 | Bacteria | 1608 |
| 567 | Ga0496114_0000045 | 3300048917 | Bacteria | 126886 |
| 568 | Ga0496114_0000766 | 3300048917 | Bacteria | 24011 |
| 569 | Ga0496114_0001108 | 3300048917 | Bacteria | 20364 |
| 570 | Ga0496115_0005192 | 3300048918 | Bacteria | 9467 |
| 571 | Ga0496115_0008253 | 3300048918 | Bacteria | 7698 |
| 572 | Ga0496115_0011304 | 3300048918 | Bacteria | 6689 |
| 573 | Ga0496118_0003869 | 3300048921 | Bacteria | 18393 |
| 574 | Ga0496118_0204330 | 3300048921 | Bacteria | 1166 |
| 575 | Ga0496119_0054548 | 3300048922 | Unclassified | 2433 |
| 576 | Ga0496121_0140458 | 3300048924 | Bacteria | 1793 |
| 577 | Ga0496123_0056766 | 3300048926 | Bacteria | 2555 |
| 578 | Ga0496126_0002219 | 3300048929 | Bacteria | 26885 |
| 579 | Ga0496126_0079850 | 3300048929 | Bacteria | 2895 |
| 580 | Ga0501031_0003559 | 3300049568 | Bacteria | 10007 |
| 581 | Ga0501032_0004950 | 3300049569 | Bacteria | 9963 |
| 582 | Ga0501034_0009889 | 3300049571 | Bacteria | 9969 |
| 583 | Ga0501034_0011034 | 3300049571 | Bacteria | 9379 |
| 584 | Ga0501034_0030998 | 3300049571 | Bacteria | 5434 |
| 585 | Ga0501034_0067347 | 3300049571 | Bacteria | 3594 |
| 586 | Ga0501036_0029781 | 3300049572 | Bacteria | 4613 |
| 587 | Ga0501036_0199188 | 3300049572 | Bacteria | 1684 |
| 588 | Ga0501037_0013608 | 3300049573 | Bacteria | 5993 |
| 589 | Ga0501037_0064465 | 3300049573 | Bacteria | 2670 |
| 590 | Ga0501038_0040632 | 3300049574 | Bacteria | 4059 |
| 591 | Ga0501038_0136685 | 3300049574 | Bacteria | 2007 |
| 592 | Ga0501039_0000835 | 3300049575 | Bacteria | 22275 |
| 593 | Ga0501039_0020591 | 3300049575 | Bacteria | 5054 |
| 594 | Ga0501041_0015104 | 3300049577 | Bacteria | 4586 |
| 595 | Ga0501043_0016855 | 3300049579 | Bacteria | 5726 |
| 596 | Ga0501046_0009457 | 3300049580 | Bacteria | 8422 |
| 597 | Ga0501046_0024825 | 3300049580 | Bacteria | 4911 |
| 598 | Ga0501047_0021818 | 3300049581 | Bacteria | 6148 |
| 599 | Ga0501047_0071460 | 3300049581 | Bacteria | 3341 |
| 600 | Ga0501047_0217158 | 3300049581 | Bacteria | 1769 |
| 601 | Ga0501047_0266952 | 3300049581 | Unclassified | 1558 |
| 602 | Ga0501048_0131548 | 3300049582 | Bacteria | 1768 |
| 603 | Ga0501067_0015476 | 3300049583 | Bacteria | 4222 |
| 604 | Ga0501068_0012777 | 3300049584 | Bacteria | 4767 |
| 605 | Ga0501069_0004427 | 3300049585 | Bacteria | 7255 |
| 606 | Ga0501070_0002995 | 3300049586 | Bacteria | 14699 |
| 607 | Ga0501070_0008673 | 3300049586 | Bacteria | 8595 |
| 608 | Ga0501070_0203212 | 3300049586 | Bacteria | 1627 |
| 609 | Ga0501071_0010148 | 3300049587 | Bacteria | 6301 |
| 610 | Ga0501072_0004542 | 3300049588 | Bacteria | 10550 |
| 611 | Ga0501073_0016582 | 3300049589 | Bacteria | 5338 |
| 612 | Ga0501073_0018809 | 3300049589 | Bacteria | 4992 |
| 613 | Ga0501073_0157998 | 3300049589 | Bacteria | 1571 |
| 614 | Ga0501077_0026031 | 3300049593 | Bacteria | 3712 |
| 615 | Ga0501079_0025517 | 3300049741 | Bacteria | 4531 |
| 616 | Ga0501080_0131573 | 3300049742 | Bacteria | 2316 |
| 617 | Ga0501083_0008871 | 3300049744 | Bacteria | 7100 |
| 618 | Ga0501035_0150679 | 3300049822 | Bacteria | 2018 |
| 619 | Ga0501044_0005313 | 3300049823 | Bacteria | 14326 |
| 620 | Ga0501044_0012714 | 3300049823 | Bacteria | 9117 |
| 621 | nmdc:mga03n38_50100_c1 | 3300050490 | Bacteria | 1860 |
| 622 | nmdc:mga03n38_66081_c1 | 3300050490 | Bacteria | 1660 |
| 623 | nmdc:mga00v17_24328_c1 | 3300050491 | Bacteria | 3512 |
| 624 | nmdc:mga00v17_48709_c1 | 3300050491 | Bacteria | 2569 |
| 625 | nmdc:mga00v17_9568_c1 | 3300050491 | Bacteria | 5251 |
| 626 | nmdc:mga0yw44_164926_c1 | 3300050492 | Bacteria | 1452 |
| 627 | nmdc:mga0yw44_45819_c1 | 3300050492 | Bacteria | 2623 |
| 628 | nmdc:mga06z11_43196_c1 | 3300050494 | Bacteria | 2266 |
| 629 | nmdc:mga07m45_32573_c1 | 3300050496 | Bacteria | 2890 |
| 630 | nmdc:mga05p37_168234_c1 | 3300050507 | Bacteria | 2674 |
| 631 | nmdc:mga05p37_91320_c1 | 3300050507 | Bacteria | 3752 |
| 632 | nmdc:mga06r32_205740_c1 | 3300050510 | Bacteria | 1956 |
| 633 | nmdc:mga06r32_281962_c1 | 3300050510 | Bacteria | 1648 |
| 634 | nmdc:mga06r32_9568_c1 | 3300050510 | Bacteria | 8753 |
| 635 | nmdc:mga0sz30_1591_c2 | 3300050516 | Bacteria | 6325 |
| 636 | nmdc:mga0sz30_17951_c1 | 3300050516 | Bacteria | 2827 |
| 637 | nmdc:mga0sz30_19557_c1 | 3300050516 | Bacteria | 1378 |
| 638 | nmdc:mga0sz30_59301_c1 | 3300050516 | Bacteria | 1633 |
| 639 | nmdc:mga0sz30_95504_c1 | 3300050516 | Bacteria | 1296 |
| 640 | nmdc:mga0sz30_95696_c1 | 3300050516 | Bacteria | 1295 |
| 641 | Ga0495601_0121709 | 3300053077 | Bacteria | 1695 |
| 642 | Ga0500643_000213 | 3300053087 | Bacteria | 54707 |
| 643 | Ga0500643_008952 | 3300053087 | Bacteria | 3874 |
| 644 | Ga0500640_003785 | 3300053095 | Bacteria | 5373 |
| 645 | Ga0500553_078154 | 3300053101 | Bacteria | 1499 |
| 646 | Ga0500652_026557 | 3300053131 | Bacteria | 2231 |
| 647 | Ga0500559_0035783 | 3300053136 | Bacteria | 2146 |
| 648 | Ga0500559_0074466 | 3300053136 | Bacteria | 1534 |
| 649 | Ga0500573_0012180 | 3300053140 | Bacteria | 4827 |
| 650 | Ga0500627_0004080 | 3300053158 | Bacteria | 4628 |
| 651 | Ga0500645_000188 | 3300053730 | Bacteria | 48061 |
| 652 | Ga0500645_027614 | 3300053730 | Bacteria | 1720 |
| 653 | Ga0466962_0014026 | 3300061719 | Bacteria | 3859 |
| 654 | Ga0466962_0066127 | 3300061719 | Bacteria | 1726 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037853 | Ga0436364_0108822 | Ga0436364_0108822_40_924 | 293 |
| 2 | 3300046499 | Ga0495594_0044024 | Ga0495594_0044024_127_1026 | 297 |
| 3 | 3300005459 | Ga0068867_100112610 | Ga0068867_1001126103 | 298 |
| 4 | 3300005546 | Ga0070696_100057020 | Ga0070696_1000570203 | 298 |
| 5 | 3300046454 | Ga0495592_0077813 | Ga0495592_0077813_1459_2382 | 299 |
| 6 | 3300046809 | Ga0495600_0053138 | Ga0495600_0053138_18_929 | 300 |
| 7 | 3300050494 | nmdc:mga06z11_43196_c1 | nmdc:mga06z11_43196_c1_1339_2250 | 300 |
| 8 | 3300025961 | Ga0207712_10170739 | Ga0207712_101707391 | 301 |
| 9 | 3300025913 | Ga0207695_10002443 | Ga0207695_1000244311 | 313 |
| 10 | 3300005355 | Ga0070671_100001055 | Ga0070671_10000105515 | 316 |
| 11 | 3300005367 | Ga0070667_100006233 | Ga0070667_1000062332 | 316 |
| 12 | 3300005544 | Ga0070686_100044128 | Ga0070686_1000441283 | 316 |
| 13 | 3300005548 | Ga0070665_100010566 | Ga0070665_1000105662 | 316 |
| 14 | 3300005841 | Ga0068863_100006420 | Ga0068863_1000064203 | 316 |
| 15 | 3300025931 | Ga0207644_10052351 | Ga0207644_100523512 | 316 |
| 16 | 3300025986 | Ga0207658_10016511 | Ga0207658_100165112 | 316 |
| 17 | 3300026035 | Ga0207703_10506197 | Ga0207703_105061971 | 316 |
| 18 | 3300026088 | Ga0207641_10042878 | Ga0207641_100428782 | 316 |
| 19 | 3300028379 | Ga0268266_10008138 | Ga0268266_100081383 | 316 |
| 20 | 3300048912 | Ga0496109_0170304 | Ga0496109_0170304_71_1021 | 316 |
| 21 | 3300050516 | nmdc:mga0sz30_19557_c1 | nmdc:mga0sz30_19557_c1_311_1261 | 316 |
| 22 | 3300049742 | Ga0501080_0131573 | Ga0501080_0131573_27_1010 | 323 |
| 23 | 3300041452 | Ga0451793_0215871 | Ga0451793_0215871_904_1902 | 325 |
| 24 | 3300041453 | Ga0451797_1104098 | Ga0451797_1104098_523_1521 | 325 |
| 25 | 3300022467 | Ga0224712_10040707 | Ga0224712_100407072 | 326 |
| 26 | 3300006178 | Ga0075367_10018625 | Ga0075367_100186254 | 327 |
| 27 | 3300031838 | Ga0307518_10002821 | Ga0307518_1000282111 | 327 |
| 28 | 3300046529 | Ga0495652_0147174 | Ga0495652_0147174_807_1805 | 327 |
| 29 | 3300046663 | Ga0495635_0217688 | Ga0495635_0217688_282_1280 | 327 |
| 30 | 3300047317 | Ga0495604_0068210 | Ga0495604_0068210_52_1050 | 327 |
| 31 | 3300002244 | JGI24742J22300_10002497 | JGI24742J22300_100024972 | 330 |
| 32 | 3300005330 | Ga0070690_100009368 | Ga0070690_1000093682 | 330 |
| 33 | 3300005334 | Ga0068869_100017484 | Ga0068869_1000174842 | 330 |
| 34 | 3300005337 | Ga0070682_100018767 | Ga0070682_1000187674 | 330 |
| 35 | 3300005338 | Ga0068868_100001534 | Ga0068868_10000153410 | 330 |
| 36 | 3300005339 | Ga0070660_100193926 | Ga0070660_1001939262 | 330 |
| 37 | 3300005345 | Ga0070692_10148630 | Ga0070692_101486301 | 330 |
| 38 | 3300005347 | Ga0070668_100003591 | Ga0070668_1000035916 | 330 |
| 39 | 3300005353 | Ga0070669_100052715 | Ga0070669_1000527152 | 330 |
| 40 | 3300005355 | Ga0070671_100082278 | Ga0070671_1000822782 | 330 |
| 41 | 3300005356 | Ga0070674_100005222 | Ga0070674_1000052224 | 330 |
| 42 | 3300005364 | Ga0070673_100148537 | Ga0070673_1001485372 | 330 |
| 43 | 3300005365 | Ga0070688_100006042 | Ga0070688_1000060425 | 330 |
| 44 | 3300005366 | Ga0070659_100163309 | Ga0070659_1001633091 | 330 |
| 45 | 3300005367 | Ga0070667_100003168 | Ga0070667_1000031684 | 330 |
| 46 | 3300005434 | Ga0070709_10074023 | Ga0070709_100740233 | 330 |
| 47 | 3300005437 | Ga0070710_10001392 | Ga0070710_100013923 | 330 |
| 48 | 3300005438 | Ga0070701_10006493 | Ga0070701_100064934 | 330 |
| 49 | 3300005439 | Ga0070711_100008288 | Ga0070711_1000082883 | 330 |
| 50 | 3300005441 | Ga0070700_100005245 | Ga0070700_1000052452 | 330 |
| 51 | 3300005444 | Ga0070694_100004880 | Ga0070694_1000048803 | 330 |
| 52 | 3300005456 | Ga0070678_100002759 | Ga0070678_1000027596 | 330 |
| 53 | 3300005457 | Ga0070662_100026108 | Ga0070662_1000261082 | 330 |
| 54 | 3300005459 | Ga0068867_100005802 | Ga0068867_1000058025 | 330 |
| 55 | 3300005539 | Ga0068853_100010078 | Ga0068853_1000100783 | 330 |
| 56 | 3300005544 | Ga0070686_100022138 | Ga0070686_1000221382 | 330 |
| 57 | 3300005545 | Ga0070695_100021292 | Ga0070695_1000212923 | 330 |
| 58 | 3300005547 | Ga0070693_100010110 | Ga0070693_1000101102 | 330 |
| 59 | 3300005549 | Ga0070704_100000313 | Ga0070704_1000003134 | 330 |
| 60 | 3300005578 | Ga0068854_100001484 | Ga0068854_10000148410 | 330 |
| 61 | 3300005617 | Ga0068859_100004026 | Ga0068859_10000402612 | 330 |
| 62 | 3300005719 | Ga0068861_100001049 | Ga0068861_10000104911 | 330 |
| 63 | 3300005842 | Ga0068858_100014801 | Ga0068858_1000148013 | 330 |
| 64 | 3300005843 | Ga0068860_100002092 | Ga0068860_10000209222 | 330 |
| 65 | 3300005844 | Ga0068862_100003302 | Ga0068862_1000033025 | 330 |
| 66 | 3300006163 | Ga0070715_10000197 | Ga0070715_100001974 | 330 |
| 67 | 3300006175 | Ga0070712_100006916 | Ga0070712_1000069163 | 330 |
| 68 | 3300006358 | Ga0068871_100090829 | Ga0068871_1000908293 | 330 |
| 69 | 3300006931 | Ga0097620_100004026 | Ga0097620_10000402612 | 330 |
| 70 | 3300009098 | Ga0105245_10005751 | Ga0105245_100057515 | 330 |
| 71 | 3300009101 | Ga0105247_10003309 | Ga0105247_100033096 | 330 |
| 72 | 3300009148 | Ga0105243_10000779 | Ga0105243_1000077912 | 330 |
| 73 | 3300009174 | Ga0105241_10008273 | Ga0105241_100082732 | 330 |
| 74 | 3300009176 | Ga0105242_10000066 | Ga0105242_100000665 | 330 |
| 75 | 3300009177 | Ga0105248_10037978 | Ga0105248_100379783 | 330 |
| 76 | 3300009545 | Ga0105237_10131334 | Ga0105237_101313343 | 330 |
| 77 | 3300009553 | Ga0105249_10004766 | Ga0105249_100047663 | 330 |
| 78 | 3300010375 | Ga0105239_10015683 | Ga0105239_100156835 | 330 |
| 79 | 3300013297 | Ga0157378_10002159 | Ga0157378_100021597 | 330 |
| 80 | 3300013306 | Ga0163162_10014890 | Ga0163162_100148903 | 330 |
| 81 | 3300013308 | Ga0157375_10000268 | Ga0157375_100002688 | 330 |
| 82 | 3300014326 | Ga0157380_10000036 | Ga0157380_1000003662 | 330 |
| 83 | 3300014745 | Ga0157377_10031203 | Ga0157377_100312031 | 330 |
| 84 | 3300014968 | Ga0157379_10001562 | Ga0157379_100015628 | 330 |
| 85 | 3300014969 | Ga0157376_10065953 | Ga0157376_100659534 | 330 |
| 86 | 3300017792 | Ga0163161_10009914 | Ga0163161_100099143 | 330 |
| 87 | 3300025899 | Ga0207642_10004003 | Ga0207642_100040032 | 330 |
| 88 | 3300025901 | Ga0207688_10001014 | Ga0207688_100010146 | 330 |
| 89 | 3300025904 | Ga0207647_10041867 | Ga0207647_100418672 | 330 |
| 90 | 3300025911 | Ga0207654_10058692 | Ga0207654_100586922 | 330 |
| 91 | 3300025915 | Ga0207693_10000224 | Ga0207693_1000022441 | 330 |
| 92 | 3300025916 | Ga0207663_10006226 | Ga0207663_100062263 | 330 |
| 93 | 3300025926 | Ga0207659_10206546 | Ga0207659_102065462 | 330 |
| 94 | 3300025927 | Ga0207687_10008487 | Ga0207687_100084872 | 330 |
| 95 | 3300025933 | Ga0207706_10000288 | Ga0207706_1000028834 | 330 |
| 96 | 3300025935 | Ga0207709_10007903 | Ga0207709_100079032 | 330 |
| 97 | 3300025936 | Ga0207670_10059445 | Ga0207670_100594452 | 330 |
| 98 | 3300025937 | Ga0207669_10026418 | Ga0207669_100264182 | 330 |
| 99 | 3300025938 | Ga0207704_10010220 | Ga0207704_100102203 | 330 |
| 100 | 3300025939 | Ga0207665_10008988 | Ga0207665_100089882 | 330 |
| 101 | 3300025941 | Ga0207711_10031606 | Ga0207711_100316062 | 330 |
| 102 | 3300025942 | Ga0207689_10027054 | Ga0207689_100270543 | 330 |
| 103 | 3300025972 | Ga0207668_10006971 | Ga0207668_100069717 | 330 |
| 104 | 3300026035 | Ga0207703_10007155 | Ga0207703_100071558 | 330 |
| 105 | 3300026075 | Ga0207708_10003048 | Ga0207708_1000304811 | 330 |
| 106 | 3300026089 | Ga0207648_10001622 | Ga0207648_100016226 | 330 |
| 107 | 3300026118 | Ga0207675_100000324 | Ga0207675_10000032415 | 330 |
| 108 | 3300026121 | Ga0207683_10000077 | Ga0207683_1000007770 | 330 |
| 109 | 3300028379 | Ga0268266_10011847 | Ga0268266_100118475 | 330 |
| 110 | 3300028380 | Ga0268265_10008953 | Ga0268265_100089533 | 330 |
| 111 | 3300028381 | Ga0268264_10011619 | Ga0268264_100116193 | 330 |
| 112 | 3300035112 | Ga0373932_0057322 | Ga0373932_0057322_111_1103 | 330 |
| 113 | 3300044712 | Ga0453684_0360009 | Ga0453684_0360009_290_1384 | 330 |
| 114 | 3300048903 | Ga0496100_0069841 | Ga0496100_0069841_74_1066 | 330 |
| 115 | 3300048905 | Ga0496102_0000915 | Ga0496102_0000915_4918_5910 | 330 |
| 116 | 3300048910 | Ga0496107_0000854 | Ga0496107_0000854_1114_2106 | 330 |
| 117 | 3300048917 | Ga0496114_0001108 | Ga0496114_0001108_18601_19593 | 330 |
| 118 | 3300048918 | Ga0496115_0005192 | Ga0496115_0005192_2295_3287 | 330 |
| 119 | 3300005327 | Ga0070658_10006864 | Ga0070658_100068643 | 331 |
| 120 | 3300005336 | Ga0070680_100189573 | Ga0070680_1001895731 | 331 |
| 121 | 3300005458 | Ga0070681_10042415 | Ga0070681_100424151 | 331 |
| 122 | 3300005563 | Ga0068855_100005049 | Ga0068855_1000050499 | 331 |
| 123 | 3300025909 | Ga0207705_10003150 | Ga0207705_100031509 | 331 |
| 124 | 3300025912 | Ga0207707_10057685 | Ga0207707_100576853 | 331 |
| 125 | 3300025949 | Ga0207667_10073808 | Ga0207667_100738083 | 331 |
| 126 | 3300003320 | rootH2_10195207 | rootH2_101952075 | 336 |
| 127 | 3300026067 | Ga0207678_10146433 | Ga0207678_101464331 | 336 |
| 128 | 3300025906 | Ga0207699_10054060 | Ga0207699_100540602 | 338 |
| 129 | 3300009545 | Ga0105237_10253280 | Ga0105237_102532802 | 340 |
| 130 | 3300025939 | Ga0207665_10065209 | Ga0207665_100652093 | 341 |
| 131 | 3300044765 | Ga0466970_0021565 | Ga0466970_0021565_1063_2124 | 341 |
| 132 | 3300044842 | Ga0466957_0013117 | Ga0466957_0013117_1537_2598 | 341 |
| 133 | 3300053136 | Ga0500559_0035783 | Ga0500559_0035783_234_1277 | 343 |
| 134 | iso_pu_bacteria | 2873314349 | 2873319488 | 343 |
| 135 | 3300005335 | Ga0070666_10012330 | Ga0070666_100123302 | 344 |
| 136 | 3300005356 | Ga0070674_100196880 | Ga0070674_1001968802 | 344 |
| 137 | 3300005367 | Ga0070667_100033162 | Ga0070667_1000331624 | 344 |
| 138 | 3300005434 | Ga0070709_10225796 | Ga0070709_102257961 | 344 |
| 139 | 3300005437 | Ga0070710_10083407 | Ga0070710_100834071 | 344 |
| 140 | 3300005439 | Ga0070711_100028177 | Ga0070711_1000281771 | 344 |
| 141 | 3300005440 | Ga0070705_100108009 | Ga0070705_1001080091 | 344 |
| 142 | 3300005455 | Ga0070663_100054446 | Ga0070663_1000544462 | 344 |
| 143 | 3300005456 | Ga0070678_100222228 | Ga0070678_1002222282 | 344 |
| 144 | 3300005539 | Ga0068853_100120082 | Ga0068853_1001200822 | 344 |
| 145 | 3300005548 | Ga0070665_100037661 | Ga0070665_1000376615 | 344 |
| 146 | 3300005549 | Ga0070704_100028516 | Ga0070704_1000285164 | 344 |
| 147 | 3300005578 | Ga0068854_100002893 | Ga0068854_1000028935 | 344 |
| 148 | 3300005615 | Ga0070702_100187142 | Ga0070702_1001871421 | 344 |
| 149 | 3300005616 | Ga0068852_100015840 | Ga0068852_1000158404 | 344 |
| 150 | 3300005718 | Ga0068866_10056984 | Ga0068866_100569843 | 344 |
| 151 | 3300005719 | Ga0068861_100242406 | Ga0068861_1002424062 | 344 |
| 152 | 3300005843 | Ga0068860_100368896 | Ga0068860_1003688962 | 344 |
| 153 | 3300005844 | Ga0068862_100075250 | Ga0068862_1000752502 | 344 |
| 154 | 3300006051 | Ga0075364_10085463 | Ga0075364_100854632 | 344 |
| 155 | 3300006173 | Ga0070716_100040545 | Ga0070716_1000405453 | 344 |
| 156 | 3300006175 | Ga0070712_100013001 | Ga0070712_1000130013 | 344 |
| 157 | 3300006186 | Ga0075369_10019582 | Ga0075369_100195823 | 344 |
| 158 | 3300006358 | Ga0068871_100204345 | Ga0068871_1002043452 | 344 |
| 159 | 3300006847 | Ga0075431_100313091 | Ga0075431_1003130912 | 344 |
| 160 | 3300006881 | Ga0068865_100190268 | Ga0068865_1001902682 | 344 |
| 161 | 3300007265 | Ga0099794_10001021 | Ga0099794_100010217 | 344 |
| 162 | 3300009093 | Ga0105240_10004501 | Ga0105240_100045014 | 344 |
| 163 | 3300009545 | Ga0105237_10223042 | Ga0105237_102230422 | 344 |
| 164 | 3300010375 | Ga0105239_10020214 | Ga0105239_100202143 | 344 |
| 165 | 3300010375 | Ga0105239_10583957 | Ga0105239_105839571 | 344 |
| 166 | 3300013306 | Ga0163162_10075854 | Ga0163162_100758543 | 344 |
| 167 | 3300013306 | Ga0163162_10142805 | Ga0163162_101428052 | 344 |
| 168 | 3300020069 | Ga0197907_11018771 | Ga0197907_110187711 | 344 |
| 169 | 3300025711 | Ga0207696_1024521 | Ga0207696_10245213 | 344 |
| 170 | 3300025898 | Ga0207692_10025507 | Ga0207692_100255071 | 344 |
| 171 | 3300025909 | Ga0207705_10184033 | Ga0207705_101840332 | 344 |
| 172 | 3300025911 | Ga0207654_10011826 | Ga0207654_100118262 | 344 |
| 173 | 3300025914 | Ga0207671_10002910 | Ga0207671_100029107 | 344 |
| 174 | 3300025915 | Ga0207693_10007684 | Ga0207693_100076842 | 344 |
| 175 | 3300025915 | Ga0207693_10236766 | Ga0207693_102367661 | 344 |
| 176 | 3300025924 | Ga0207694_10001312 | Ga0207694_1000131211 | 344 |
| 177 | 3300025938 | Ga0207704_10013681 | Ga0207704_100136812 | 344 |
| 178 | 3300025939 | Ga0207665_10010453 | Ga0207665_100104533 | 344 |
| 179 | 3300025981 | Ga0207640_10004862 | Ga0207640_100048625 | 344 |
| 180 | 3300025986 | Ga0207658_10016993 | Ga0207658_100169933 | 344 |
| 181 | 3300026067 | Ga0207678_10014277 | Ga0207678_100142777 | 344 |
| 182 | 3300026089 | Ga0207648_10068522 | Ga0207648_100685222 | 344 |
| 183 | 3300026118 | Ga0207675_100140160 | Ga0207675_1001401602 | 344 |
| 184 | 3300026121 | Ga0207683_10040740 | Ga0207683_100407403 | 344 |
| 185 | 3300031616 | Ga0307508_10063119 | Ga0307508_100631194 | 344 |
| 186 | 3300031727 | Ga0316576_10004486 | Ga0316576_100044865 | 344 |
| 187 | 3300031733 | Ga0316577_10119780 | Ga0316577_101197802 | 344 |
| 188 | 3300035692 | Ga0373935_0114160 | Ga0373935_0114160_640_1689 | 344 |
| 189 | 3300036647 | Ga0316582_0016179 | Ga0316582_0016179_1954_3003 | 344 |
| 190 | 3300041413 | Ga0439465_0047262 | Ga0439465_0047262_179_1213 | 344 |
| 191 | 3300042002 | Ga0439442_017270 | Ga0439442_017270_340_1374 | 344 |
| 192 | 3300046459 | Ga0495629_0022019 | Ga0495629_0022019_1639_2673 | 344 |
| 193 | 3300046461 | Ga0495641_0050006 | Ga0495641_0050006_809_1843 | 344 |
| 194 | 3300046462 | Ga0495651_0007772 | Ga0495651_0007772_2097_3161 | 344 |
| 195 | 3300046463 | Ga0495653_0015204 | Ga0495653_0015204_1615_2679 | 344 |
| 196 | 3300046473 | Ga0495582_0138703 | Ga0495582_0138703_285_1319 | 344 |
| 197 | 3300046477 | Ga0495664_0235376 | Ga0495664_0235376_19_1083 | 344 |
| 198 | 3300046517 | Ga0495630_0020357 | Ga0495630_0020357_2206_3270 | 344 |
| 199 | 3300046529 | Ga0495652_0012110 | Ga0495652_0012110_5045_6109 | 344 |
| 200 | 3300046533 | Ga0495640_0004019 | Ga0495640_0004019_7946_9010 | 344 |
| 201 | 3300046536 | Ga0495587_0006340 | Ga0495587_0006340_5039_6103 | 344 |
| 202 | 3300046559 | Ga0495667_0016349 | Ga0495667_0016349_2229_3293 | 344 |
| 203 | 3300046663 | Ga0495635_0007371 | Ga0495635_0007371_1620_2684 | 344 |
| 204 | 3300046663 | Ga0495635_0142665 | Ga0495635_0142665_488_1522 | 344 |
| 205 | 3300046675 | Ga0495657_0011542 | Ga0495657_0011542_1622_2686 | 344 |
| 206 | 3300046678 | Ga0495599_0005251 | Ga0495599_0005251_5045_6109 | 344 |
| 207 | 3300046679 | Ga0495623_0005019 | Ga0495623_0005019_2097_3161 | 344 |
| 208 | 3300046689 | Ga0495613_0003801 | Ga0495613_0003801_8571_9635 | 344 |
| 209 | 3300046809 | Ga0495600_0004749 | Ga0495600_0004749_2097_3161 | 344 |
| 210 | 3300047315 | Ga0495581_0035263 | Ga0495581_0035263_1422_2456 | 344 |
| 211 | 3300047317 | Ga0495604_0023894 | Ga0495604_0023894_2097_3161 | 344 |
| 212 | 3300047320 | Ga0495672_0088365 | Ga0495672_0088365_621_1655 | 344 |
| 213 | 3300047444 | Ga0495675_0003362 | Ga0495675_0003362_3527_4591 | 344 |
| 214 | 3300047471 | Ga0495684_0005393 | Ga0495684_0005393_6796_7860 | 344 |
| 215 | 3300047673 | Ga0495593_0013924 | Ga0495593_0013924_1641_2675 | 344 |
| 216 | 3300048088 | Ga0495602_0010713 | Ga0495602_0010713_3399_4463 | 344 |
| 217 | 3300048903 | Ga0496100_0038245 | Ga0496100_0038245_564_1598 | 344 |
| 218 | 3300048906 | Ga0496103_0020319 | Ga0496103_0020319_912_1946 | 344 |
| 219 | 3300048909 | Ga0496106_0095081 | Ga0496106_0095081_216_1250 | 344 |
| 220 | 3300048910 | Ga0496107_0134032 | Ga0496107_0134032_186_1220 | 344 |
| 221 | 3300048917 | Ga0496114_0000045 | Ga0496114_0000045_56002_57051 | 344 |
| 222 | 3300050490 | nmdc:mga03n38_66081_c1 | nmdc:mga03n38_66081_c1_276_1310 | 344 |
| 223 | 3300050507 | nmdc:mga05p37_168234_c1 | nmdc:mga05p37_168234_c1_658_1716 | 344 |
| 224 | 3300050510 | nmdc:mga06r32_205740_c1 | nmdc:mga06r32_205740_c1_640_1698 | 344 |
| 225 | 3300050516 | nmdc:mga0sz30_17951_c1 | nmdc:mga0sz30_17951_c1_1708_2742 | 344 |
| 226 | 3300050516 | nmdc:mga0sz30_95696_c1 | nmdc:mga0sz30_95696_c1_86_1120 | 344 |
| 227 | 3300053136 | Ga0500559_0074466 | Ga0500559_0074466_406_1452 | 344 |
| 228 | iso_pu_bacteria | 2862574272 | 2862581869 | 344 |
| 229 | iso_pu_bacteria | 3006393351 | 3006397985 | 344 |
| 230 | 3300044656 | Ga0466969_0003976 | Ga0466969_0003976_3792_4928 | 345 |
| 231 | 3300044658 | Ga0466972_0033971 | Ga0466972_0033971_564_1700 | 345 |
| 232 | 3300044683 | Ga0466965_0000686 | Ga0466965_0000686_9134_10270 | 345 |
| 233 | 3300044684 | Ga0466966_0001411 | Ga0466966_0001411_2366_3502 | 345 |
| 234 | 3300044693 | Ga0466961_0001880 | Ga0466961_0001880_6679_7815 | 345 |
| 235 | 3300044694 | Ga0466963_0001442 | Ga0466963_0001442_182_1318 | 345 |
| 236 | 3300044719 | Ga0466971_0047062 | Ga0466971_0047062_55_1191 | 345 |
| 237 | 3300044765 | Ga0466970_0000235 | Ga0466970_0000235_12097_13233 | 345 |
| 238 | 3300044842 | Ga0466957_0044037 | Ga0466957_0044037_55_1191 | 345 |
| 239 | 3300044901 | Ga0466960_0017115 | Ga0466960_0017115_642_1763 | 345 |
| 240 | 3300045049 | Ga0466959_0000228 | Ga0466959_0000228_13188_14324 | 345 |
| 241 | 3300045836 | Ga0466958_0003793 | Ga0466958_0003793_5240_6376 | 345 |
| 242 | 3300045976 | Ga0466967_0035672 | Ga0466967_0035672_2384_3520 | 345 |
| 243 | 3300053087 | Ga0500643_000213 | Ga0500643_000213_1828_2874 | 345 |
| 244 | 3300061719 | Ga0466962_0014026 | Ga0466962_0014026_1210_2346 | 345 |
| 245 | iso_pu_bacteria | 2891395885 | 2891400604 | 345 |
| 246 | iso_pu_bacteria | 2891554331 | 2891562294 | 345 |
| 247 | 3300005339 | Ga0070660_100030184 | Ga0070660_1000301842 | 346 |
| 248 | 3300005366 | Ga0070659_100066313 | Ga0070659_1000663134 | 346 |
| 249 | 3300005458 | Ga0070681_10182905 | Ga0070681_101829052 | 346 |
| 250 | 3300005539 | Ga0068853_100102204 | Ga0068853_1001022043 | 346 |
| 251 | 3300005548 | Ga0070665_100198972 | Ga0070665_1001989722 | 346 |
| 252 | 3300005614 | Ga0068856_100035735 | Ga0068856_1000357353 | 346 |
| 253 | 3300005614 | Ga0068856_100039164 | Ga0068856_1000391642 | 346 |
| 254 | 3300005937 | Ga0081455_10011250 | Ga0081455_100112505 | 346 |
| 255 | 3300006028 | Ga0070717_10021403 | Ga0070717_100214035 | 346 |
| 256 | 3300006175 | Ga0070712_100162377 | Ga0070712_1001623772 | 346 |
| 257 | 3300009551 | Ga0105238_10188912 | Ga0105238_101889121 | 346 |
| 258 | 3300013100 | Ga0157373_10045936 | Ga0157373_100459362 | 346 |
| 259 | 3300013105 | Ga0157369_10022248 | Ga0157369_100222487 | 346 |
| 260 | 3300013105 | Ga0157369_10077529 | Ga0157369_100775294 | 346 |
| 261 | 3300013296 | Ga0157374_10010125 | Ga0157374_100101257 | 346 |
| 262 | 3300013296 | Ga0157374_10087228 | Ga0157374_100872282 | 346 |
| 263 | 3300013307 | Ga0157372_10123852 | Ga0157372_101238521 | 346 |
| 264 | 3300014969 | Ga0157376_10088990 | Ga0157376_100889902 | 346 |
| 265 | 3300021361 | Ga0213872_10013785 | Ga0213872_100137852 | 346 |
| 266 | 3300021377 | Ga0213874_10015250 | Ga0213874_100152502 | 346 |
| 267 | 3300021377 | Ga0213874_10018415 | Ga0213874_100184153 | 346 |
| 268 | 3300021384 | Ga0213876_10013131 | Ga0213876_100131312 | 346 |
| 269 | 3300021384 | Ga0213876_10092656 | Ga0213876_100926562 | 346 |
| 270 | 3300021388 | Ga0213875_10000575 | Ga0213875_1000057511 | 346 |
| 271 | 3300021388 | Ga0213875_10014462 | Ga0213875_100144622 | 346 |
| 272 | 3300021388 | Ga0213875_10042447 | Ga0213875_100424472 | 346 |
| 273 | 3300025915 | Ga0207693_10170608 | Ga0207693_101706082 | 346 |
| 274 | 3300026041 | Ga0207639_10083156 | Ga0207639_100831562 | 346 |
| 275 | 3300026078 | Ga0207702_10026632 | Ga0207702_100266324 | 346 |
| 276 | 3300026078 | Ga0207702_10050180 | Ga0207702_100501802 | 346 |
| 277 | 3300028800 | Ga0265338_10001088 | Ga0265338_1000108816 | 346 |
| 278 | 3300031249 | Ga0265339_10003630 | Ga0265339_100036303 | 346 |
| 279 | 3300031711 | Ga0265314_10132941 | Ga0265314_101329412 | 346 |
| 280 | 3300037853 | Ga0436364_0934343 | Ga0436364_0934343_59_1108 | 346 |
| 281 | 3300037853 | Ga0436364_1008502 | Ga0436364_1008502_53315_54364 | 346 |
| 282 | 3300037853 | Ga0436364_1345478 | Ga0436364_1345478_3258_4307 | 346 |
| 283 | 3300039437 | Ga0436365_0588267 | Ga0436365_0588267_470_1519 | 346 |
| 284 | 3300039447 | Ga0436361_0474393 | Ga0436361_0474393_4445_5494 | 346 |
| 285 | 3300039450 | Ga0436363_0010176 | Ga0436363_0010176_939_1988 | 346 |
| 286 | 3300044684 | Ga0466966_0075782 | Ga0466966_0075782_646_1695 | 346 |
| 287 | 3300048915 | Ga0496112_0012218 | Ga0496112_0012218_4567_5616 | 346 |
| 288 | 3300048918 | Ga0496115_0008253 | Ga0496115_0008253_3776_4825 | 346 |
| 289 | iso_pu_bacteria | 2808606359 | 2808842749 | 346 |
| 290 | iso_pu_bacteria | 2856741275 | 2856745442 | 346 |
| 291 | iso_pu_bacteria | 2856741275 | 2856747955 | 346 |
| 292 | iso_pu_bacteria | 2891562705 | 2891566429 | 346 |
| 293 | iso_pu_bacteria | 2891562705 | 2891569680 | 346 |
| 294 | iso_pu_bacteria | 2912757875 | 2912758362 | 346 |
| 295 | iso_pu_bacteria | 2997451912 | 2997452291 | 346 |
| 296 | 3300006880 | Ga0075429_100024137 | Ga0075429_1000241372 | 347 |
| 297 | 3300009147 | Ga0114129_10054328 | Ga0114129_100543287 | 347 |
| 298 | 3300039437 | Ga0436365_0464118 | Ga0436365_0464118_1922_2965 | 347 |
| 299 | 3300039450 | Ga0436363_0360664 | Ga0436363_0360664_1773_2876 | 347 |
| 300 | 3300045836 | Ga0466958_0036071 | Ga0466958_0036071_693_1781 | 347 |
| 301 | 3300046462 | Ga0495651_0002255 | Ga0495651_0002255_7718_8785 | 347 |
| 302 | 3300046492 | Ga0495585_0038486 | Ga0495585_0038486_251_1303 | 347 |
| 303 | 3300046499 | Ga0495594_0079672 | Ga0495594_0079672_175_1227 | 347 |
| 304 | 3300046516 | Ga0495628_0010353 | Ga0495628_0010353_4262_5329 | 347 |
| 305 | 3300046533 | Ga0495640_0065115 | Ga0495640_0065115_341_1393 | 347 |
| 306 | 3300046543 | Ga0495645_0054714 | Ga0495645_0054714_317_1384 | 347 |
| 307 | 3300046809 | Ga0495600_0092713 | Ga0495600_0092713_883_1950 | 347 |
| 308 | 3300047317 | Ga0495604_0010657 | Ga0495604_0010657_107_1174 | 347 |
| 309 | 3300049581 | Ga0501047_0217158 | Ga0501047_0217158_597_1649 | 347 |
| 310 | 3300050507 | nmdc:mga05p37_91320_c1 | nmdc:mga05p37_91320_c1_1760_2818 | 347 |
| 311 | 3300050510 | nmdc:mga06r32_281962_c1 | nmdc:mga06r32_281962_c1_301_1350 | 347 |
| 312 | iso_pu_bacteria | 2554235005 | 2554261079 | 347 |
| 313 | iso_pu_bacteria | 2818991472 | 2819743668 | 347 |
| 314 | iso_pu_bacteria | 2995463766 | 2995466437 | 347 |
| 315 | 3300009011 | Ga0105251_10054305 | Ga0105251_100543052 | 348 |
| 316 | 3300046455 | Ga0495603_0000765 | Ga0495603_0000765_12729_13787 | 348 |
| 317 | 3300046455 | Ga0495603_0003497 | Ga0495603_0003497_123_1181 | 348 |
| 318 | 3300046455 | Ga0495603_0012031 | Ga0495603_0012031_1866_2924 | 348 |
| 319 | 3300046459 | Ga0495629_0004675 | Ga0495629_0004675_5801_6859 | 348 |
| 320 | 3300046459 | Ga0495629_0056176 | Ga0495629_0056176_430_1488 | 348 |
| 321 | 3300046476 | Ga0495662_0009605 | Ga0495662_0009605_1646_2704 | 348 |
| 322 | 3300046476 | Ga0495662_0018701 | Ga0495662_0018701_1072_2130 | 348 |
| 323 | 3300046499 | Ga0495594_0084619 | Ga0495594_0084619_264_1322 | 348 |
| 324 | 3300046674 | Ga0495588_0038616 | Ga0495588_0038616_744_1802 | 348 |
| 325 | 3300046675 | Ga0495657_0002058 | Ga0495657_0002058_6700_7758 | 348 |
| 326 | 3300046689 | Ga0495613_0004186 | Ga0495613_0004186_3230_4288 | 348 |
| 327 | 3300046689 | Ga0495613_0009210 | Ga0495613_0009210_4925_5983 | 348 |
| 328 | 3300046691 | Ga0495670_0138863 | Ga0495670_0138863_166_1224 | 348 |
| 329 | 3300046794 | Ga0495589_0020033 | Ga0495589_0020033_1174_2232 | 348 |
| 330 | 3300047315 | Ga0495581_0025921 | Ga0495581_0025921_1232_2290 | 348 |
| 331 | 3300047318 | Ga0495636_0011349 | Ga0495636_0011349_2282_3340 | 348 |
| 332 | 3300047321 | Ga0495676_0028092 | Ga0495676_0028092_558_1616 | 348 |
| 333 | 3300047321 | Ga0495676_0057414 | Ga0495676_0057414_1702_2760 | 348 |
| 334 | 3300047444 | Ga0495675_0066185 | Ga0495675_0066185_1078_2136 | 348 |
| 335 | 3300048911 | Ga0496108_0045273 | Ga0496108_0045273_1726_2784 | 348 |
| 336 | 3300048912 | Ga0496109_0013758 | Ga0496109_0013758_4218_5276 | 348 |
| 337 | 3300049581 | Ga0501047_0266952 | Ga0501047_0266952_137_1195 | 348 |
| 338 | 3300053140 | Ga0500573_0012180 | Ga0500573_0012180_1229_2287 | 348 |
| 339 | 3300046454 | Ga0495592_0066581 | Ga0495592_0066581_238_1395 | 349 |
| 340 | 3300028794 | Ga0307515_10023269 | Ga0307515_1002326910 | 350 |
| 341 | 3300030522 | Ga0307512_10016297 | Ga0307512_100162976 | 350 |
| 342 | 3300031456 | Ga0307513_10032914 | Ga0307513_100329142 | 350 |
| 343 | 3300031456 | Ga0307513_10074084 | Ga0307513_100740844 | 350 |
| 344 | 3300031649 | Ga0307514_10107836 | Ga0307514_101078362 | 350 |
| 345 | 3300046452 | Ga0495617_008207 | Ga0495617_008207_196_1263 | 350 |
| 346 | 3300046454 | Ga0495592_0001429 | Ga0495592_0001429_4497_5561 | 350 |
| 347 | 3300046454 | Ga0495592_0164446 | Ga0495592_0164446_84_1151 | 350 |
| 348 | 3300046459 | Ga0495629_0005953 | Ga0495629_0005953_7180_8247 | 350 |
| 349 | 3300046459 | Ga0495629_0078102 | Ga0495629_0078102_195_1352 | 350 |
| 350 | 3300046462 | Ga0495651_0009658 | Ga0495651_0009658_5730_6797 | 350 |
| 351 | 3300046462 | Ga0495651_0045916 | Ga0495651_0045916_1786_2850 | 350 |
| 352 | 3300046463 | Ga0495653_0152298 | Ga0495653_0152298_31_1095 | 350 |
| 353 | 3300046476 | Ga0495662_0004034 | Ga0495662_0004034_981_2051 | 350 |
| 354 | 3300046476 | Ga0495662_0010308 | Ga0495662_0010308_1462_2526 | 350 |
| 355 | 3300046477 | Ga0495664_0003276 | Ga0495664_0003276_2054_3118 | 350 |
| 356 | 3300046477 | Ga0495664_0009224 | Ga0495664_0009224_3390_4457 | 350 |
| 357 | 3300046492 | Ga0495585_0001761 | Ga0495585_0001761_9955_11022 | 350 |
| 358 | 3300046501 | Ga0495607_0064977 | Ga0495607_0064977_104_1171 | 350 |
| 359 | 3300046506 | Ga0495583_0020098 | Ga0495583_0020098_1227_2294 | 350 |
| 360 | 3300046516 | Ga0495628_0059510 | Ga0495628_0059510_843_2000 | 350 |
| 361 | 3300046517 | Ga0495630_0043526 | Ga0495630_0043526_505_1569 | 350 |
| 362 | 3300046529 | Ga0495652_0038924 | Ga0495652_0038924_1786_2850 | 350 |
| 363 | 3300046533 | Ga0495640_0001256 | Ga0495640_0001256_2979_4136 | 350 |
| 364 | 3300046533 | Ga0495640_0010089 | Ga0495640_0010089_4930_5994 | 350 |
| 365 | 3300046536 | Ga0495587_0001809 | Ga0495587_0001809_9704_10771 | 350 |
| 366 | 3300046536 | Ga0495587_0010691 | Ga0495587_0010691_1786_2850 | 350 |
| 367 | 3300046543 | Ga0495645_0010749 | Ga0495645_0010749_1472_2602 | 350 |
| 368 | 3300046559 | Ga0495667_0034528 | Ga0495667_0034528_1786_2850 | 350 |
| 369 | 3300046642 | Ga0495634_0000535 | Ga0495634_0000535_24709_25776 | 350 |
| 370 | 3300046642 | Ga0495634_0035550 | Ga0495634_0035550_663_1727 | 350 |
| 371 | 3300046642 | Ga0495634_0086632 | Ga0495634_0086632_39_1106 | 350 |
| 372 | 3300046648 | Ga0495611_0003683 | Ga0495611_0003683_4956_6023 | 350 |
| 373 | 3300046663 | Ga0495635_0001798 | Ga0495635_0001798_7391_8458 | 350 |
| 374 | 3300046674 | Ga0495588_0023666 | Ga0495588_0023666_248_1309 | 350 |
| 375 | 3300046675 | Ga0495657_0002019 | Ga0495657_0002019_8851_9918 | 350 |
| 376 | 3300046675 | Ga0495657_0008280 | Ga0495657_0008280_4395_5462 | 350 |
| 377 | 3300046675 | Ga0495657_0032941 | Ga0495657_0032941_1469_2626 | 350 |
| 378 | 3300046680 | Ga0495646_0001682 | Ga0495646_0001682_7424_8491 | 350 |
| 379 | 3300046680 | Ga0495646_0004122 | Ga0495646_0004122_7025_8089 | 350 |
| 380 | 3300046683 | Ga0495658_0040562 | Ga0495658_0040562_605_1672 | 350 |
| 381 | 3300046689 | Ga0495613_0003158 | Ga0495613_0003158_4532_5599 | 350 |
| 382 | 3300046689 | Ga0495613_0004495 | Ga0495613_0004495_2831_3988 | 350 |
| 383 | 3300046689 | Ga0495613_0008195 | Ga0495613_0008195_1494_2561 | 350 |
| 384 | 3300046690 | Ga0495624_0068387 | Ga0495624_0068387_93_1250 | 350 |
| 385 | 3300046810 | Ga0495660_0003633 | Ga0495660_0003633_4458_5525 | 350 |
| 386 | 3300047315 | Ga0495581_0006822 | Ga0495581_0006822_1398_2465 | 350 |
| 387 | 3300047317 | Ga0495604_0000284 | Ga0495604_0000284_8832_9899 | 350 |
| 388 | 3300047317 | Ga0495604_0001320 | Ga0495604_0001320_11202_12266 | 350 |
| 389 | 3300047317 | Ga0495604_0055515 | Ga0495604_0055515_1378_2535 | 350 |
| 390 | 3300047319 | Ga0495674_0049107 | Ga0495674_0049107_905_1969 | 350 |
| 391 | 3300047321 | Ga0495676_0049517 | Ga0495676_0049517_980_2137 | 350 |
| 392 | 3300047323 | Ga0495683_0001156 | Ga0495683_0001156_6362_7429 | 350 |
| 393 | 3300047443 | Ga0495687_002795 | Ga0495687_002795_11174_12241 | 350 |
| 394 | 3300047444 | Ga0495675_0015699 | Ga0495675_0015699_712_1842 | 350 |
| 395 | 3300047444 | Ga0495675_0024034 | Ga0495675_0024034_1033_2097 | 350 |
| 396 | 3300047447 | Ga0495685_035358 | Ga0495685_035358_205_1266 | 350 |
| 397 | 3300047471 | Ga0495684_0045437 | Ga0495684_0045437_1765_2829 | 350 |
| 398 | 3300047673 | Ga0495593_0005510 | Ga0495593_0005510_1205_2272 | 350 |
| 399 | 3300048089 | Ga0495614_0000601 | Ga0495614_0000601_7389_8456 | 350 |
| 400 | 3300048089 | Ga0495614_0091970 | Ga0495614_0091970_129_1196 | 350 |
| 401 | 3300048912 | Ga0496109_0388348 | Ga0496109_0388348_110_1174 | 350 |
| 402 | 3300048916 | Ga0496113_0057270 | Ga0496113_0057270_490_1554 | 350 |
| 403 | 3300048922 | Ga0496119_0054548 | Ga0496119_0054548_1243_2304 | 350 |
| 404 | 3300049568 | Ga0501031_0003559 | Ga0501031_0003559_5792_6928 | 350 |
| 405 | 3300049569 | Ga0501032_0004950 | Ga0501032_0004950_3082_4218 | 350 |
| 406 | 3300049571 | Ga0501034_0009889 | Ga0501034_0009889_5792_6928 | 350 |
| 407 | 3300049573 | Ga0501037_0013608 | Ga0501037_0013608_1579_2715 | 350 |
| 408 | 3300049574 | Ga0501038_0136685 | Ga0501038_0136685_510_1646 | 350 |
| 409 | 3300049575 | Ga0501039_0020591 | Ga0501039_0020591_1372_2508 | 350 |
| 410 | 3300049577 | Ga0501041_0015104 | Ga0501041_0015104_3327_4463 | 350 |
| 411 | 3300049580 | Ga0501046_0024825 | Ga0501046_0024825_3080_4216 | 350 |
| 412 | 3300049581 | Ga0501047_0021818 | Ga0501047_0021818_2537_3673 | 350 |
| 413 | 3300049582 | Ga0501048_0131548 | Ga0501048_0131548_65_1201 | 350 |
| 414 | 3300049583 | Ga0501067_0015476 | Ga0501067_0015476_1851_2987 | 350 |
| 415 | 3300049584 | Ga0501068_0012777 | Ga0501068_0012777_317_1453 | 350 |
| 416 | 3300049585 | Ga0501069_0004427 | Ga0501069_0004427_3766_4902 | 350 |
| 417 | 3300049587 | Ga0501071_0010148 | Ga0501071_0010148_1815_2951 | 350 |
| 418 | 3300049588 | Ga0501072_0004542 | Ga0501072_0004542_3377_4513 | 350 |
| 419 | 3300049589 | Ga0501073_0018809 | Ga0501073_0018809_3098_4234 | 350 |
| 420 | 3300049593 | Ga0501077_0026031 | Ga0501077_0026031_971_2107 | 350 |
| 421 | 3300049741 | Ga0501079_0025517 | Ga0501079_0025517_60_1196 | 350 |
| 422 | 3300049744 | Ga0501083_0008871 | Ga0501083_0008871_5914_7050 | 350 |
| 423 | 3300049823 | Ga0501044_0012714 | Ga0501044_0012714_5792_6928 | 350 |
| 424 | 3300053077 | Ga0495601_0121709 | Ga0495601_0121709_532_1596 | 350 |
| 425 | 3300053095 | Ga0500640_003785 | Ga0500640_003785_2598_3665 | 350 |
| 426 | 3300053101 | Ga0500553_078154 | Ga0500553_078154_167_1234 | 350 |
| 427 | iso_pu_bacteria | 8055172936 | 8055174599 | 350 |
| 428 | 3300005458 | Ga0070681_10082039 | Ga0070681_100820393 | 351 |
| 429 | 3300009147 | Ga0114129_10130049 | Ga0114129_101300492 | 351 |
| 430 | 3300037418 | Ga0395900_0098024 | Ga0395900_0098024_1681_2745 | 351 |
| 431 | 3300037466 | Ga0395898_0136673 | Ga0395898_0136673_206_1270 | 351 |
| 432 | 3300037471 | Ga0395905_0360754 | Ga0395905_0360754_167_1231 | 351 |
| 433 | iso_pu_bacteria | 2738541274 | 2738706982 | 351 |
| 434 | iso_pu_bacteria | 2738543028 | 2739333686 | 351 |
| 435 | iso_pu_bacteria | 2902799365 | 2902800534 | 351 |
| 436 | iso_pu_bacteria | 2902810491 | 2902814124 | 351 |
| 437 | iso_pu_bacteria | 3006493962 | 3006497250 | 351 |
| 438 | 3300005435 | Ga0070714_100188451 | Ga0070714_1001884511 | 352 |
| 439 | 3300006051 | Ga0075364_10074333 | Ga0075364_100743332 | 352 |
| 440 | 3300006186 | Ga0075369_10000432 | Ga0075369_1000043212 | 352 |
| 441 | 3300006186 | Ga0075369_10056568 | Ga0075369_100565682 | 352 |
| 442 | 3300041410 | Ga0439461_0000574 | Ga0439461_0000574_4145_5233 | 352 |
| 443 | 3300041411 | Ga0439466_0002159 | Ga0439466_0002159_237_1325 | 352 |
| 444 | 3300041997 | Ga0439431_0000447 | Ga0439431_0000447_5945_7033 | 352 |
| 445 | 3300042435 | Ga0439434_0003234 | Ga0439434_0003234_3464_4552 | 352 |
| 446 | 3300044683 | Ga0466965_0006756 | Ga0466965_0006756_1580_2668 | 352 |
| 447 | 3300044683 | Ga0466965_0011035 | Ga0466965_0011035_1465_2553 | 352 |
| 448 | 3300044735 | Ga0466968_0007037 | Ga0466968_0007037_3152_4240 | 352 |
| 449 | 3300044765 | Ga0466970_0018544 | Ga0466970_0018544_611_1699 | 352 |
| 450 | 3300044842 | Ga0466957_0011701 | Ga0466957_0011701_353_1441 | 352 |
| 451 | 3300044901 | Ga0466960_0000043 | Ga0466960_0000043_5781_6869 | 352 |
| 452 | 3300044901 | Ga0466960_0009641 | Ga0466960_0009641_2300_3388 | 352 |
| 453 | 3300045049 | Ga0466959_0041991 | Ga0466959_0041991_1605_2693 | 352 |
| 454 | 3300045836 | Ga0466958_0200396 | Ga0466958_0200396_41_1129 | 352 |
| 455 | 3300045976 | Ga0466967_0102573 | Ga0466967_0102573_1293_2381 | 352 |
| 456 | 3300046460 | Ga0495638_0172521 | Ga0495638_0172521_34_1146 | 352 |
| 457 | 3300048904 | Ga0496101_0038130 | Ga0496101_0038130_258_1346 | 352 |
| 458 | 3300048915 | Ga0496112_0021144 | Ga0496112_0021144_48_1136 | 352 |
| 459 | 3300048916 | Ga0496113_0195037 | Ga0496113_0195037_234_1322 | 352 |
| 460 | 3300048924 | Ga0496121_0140458 | Ga0496121_0140458_342_1409 | 352 |
| 461 | 3300048926 | Ga0496123_0056766 | Ga0496123_0056766_1260_2348 | 352 |
| 462 | 3300048929 | Ga0496126_0002219 | Ga0496126_0002219_1226_2314 | 352 |
| 463 | 3300048929 | Ga0496126_0079850 | Ga0496126_0079850_533_1600 | 352 |
| 464 | 3300049571 | Ga0501034_0030998 | Ga0501034_0030998_870_1958 | 352 |
| 465 | 3300049572 | Ga0501036_0029781 | Ga0501036_0029781_3459_4547 | 352 |
| 466 | 3300049574 | Ga0501038_0040632 | Ga0501038_0040632_1510_2598 | 352 |
| 467 | 3300049575 | Ga0501039_0000835 | Ga0501039_0000835_2950_4038 | 352 |
| 468 | 3300049579 | Ga0501043_0016855 | Ga0501043_0016855_3129_4217 | 352 |
| 469 | 3300049586 | Ga0501070_0008673 | Ga0501070_0008673_2955_4043 | 352 |
| 470 | 3300049589 | Ga0501073_0016582 | Ga0501073_0016582_1109_2197 | 352 |
| 471 | 3300049823 | Ga0501044_0005313 | Ga0501044_0005313_10110_11198 | 352 |
| 472 | 3300050491 | nmdc:mga00v17_48709_c1 | nmdc:mga00v17_48709_c1_1271_2359 | 352 |
| 473 | 3300050491 | nmdc:mga00v17_9568_c1 | nmdc:mga00v17_9568_c1_127_1194 | 352 |
| 474 | 3300050516 | nmdc:mga0sz30_1591_c2 | nmdc:mga0sz30_1591_c2_2205_3278 | 352 |
| 475 | 3300050516 | nmdc:mga0sz30_59301_c1 | nmdc:mga0sz30_59301_c1_234_1301 | 352 |
| 476 | 3300053087 | Ga0500643_008952 | Ga0500643_008952_731_1843 | 352 |
| 477 | 3300053131 | Ga0500652_026557 | Ga0500652_026557_505_1617 | 352 |
| 478 | 3300053158 | Ga0500627_0004080 | Ga0500627_0004080_2966_4078 | 352 |
| 479 | 3300053730 | Ga0500645_000188 | Ga0500645_000188_11425_12492 | 352 |
| 480 | 3300053730 | Ga0500645_027614 | Ga0500645_027614_431_1498 | 352 |
| 481 | iso_pu_bacteria | 2643221715 | 2644639003 | 352 |
| 482 | 3300001977 | JGI24746J21847_1002411 | JGI24746J21847_10024112 | 353 |
| 483 | 3300001989 | JGI24739J22299_10013268 | JGI24739J22299_100132682 | 353 |
| 484 | 3300001990 | JGI24737J22298_10007391 | JGI24737J22298_100073912 | 353 |
| 485 | 3300001991 | JGI24743J22301_10001106 | JGI24743J22301_100011062 | 353 |
| 486 | 3300002070 | JGI24750J21931_1001541 | JGI24750J21931_10015412 | 353 |
| 487 | 3300002077 | JGI24744J21845_10001375 | JGI24744J21845_100013753 | 353 |
| 488 | 3300002239 | JGI24034J26672_10001541 | JGI24034J26672_100015413 | 353 |
| 489 | 3300005329 | Ga0070683_100126221 | Ga0070683_1001262211 | 353 |
| 490 | 3300005336 | Ga0070680_100346219 | Ga0070680_1003462191 | 353 |
| 491 | 3300005341 | Ga0070691_10139672 | Ga0070691_101396721 | 353 |
| 492 | 3300005347 | Ga0070668_100156530 | Ga0070668_1001565302 | 353 |
| 493 | 3300005354 | Ga0070675_100050835 | Ga0070675_1000508353 | 353 |
| 494 | 3300005356 | Ga0070674_100008711 | Ga0070674_1000087116 | 353 |
| 495 | 3300005364 | Ga0070673_100192256 | Ga0070673_1001922562 | 353 |
| 496 | 3300005365 | Ga0070688_100006500 | Ga0070688_1000065006 | 353 |
| 497 | 3300005367 | Ga0070667_100438597 | Ga0070667_1004385971 | 353 |
| 498 | 3300005435 | Ga0070714_100049241 | Ga0070714_1000492412 | 353 |
| 499 | 3300005441 | Ga0070700_100033608 | Ga0070700_1000336083 | 353 |
| 500 | 3300005456 | Ga0070678_100143932 | Ga0070678_1001439322 | 353 |
| 501 | 3300005535 | Ga0070684_100167019 | Ga0070684_1001670192 | 353 |
| 502 | 3300005539 | Ga0068853_100272314 | Ga0068853_1002723142 | 353 |
| 503 | 3300005543 | Ga0070672_100079954 | Ga0070672_1000799541 | 353 |
| 504 | 3300005547 | Ga0070693_100025397 | Ga0070693_1000253972 | 353 |
| 505 | 3300005549 | Ga0070704_100140074 | Ga0070704_1001400742 | 353 |
| 506 | 3300005563 | Ga0068855_100308153 | Ga0068855_1003081532 | 353 |
| 507 | 3300005563 | Ga0068855_100610503 | Ga0068855_1006105031 | 353 |
| 508 | 3300005614 | Ga0068856_100363551 | Ga0068856_1003635512 | 353 |
| 509 | 3300005616 | Ga0068852_100085631 | Ga0068852_1000856312 | 353 |
| 510 | 3300005617 | Ga0068859_100130908 | Ga0068859_1001309082 | 353 |
| 511 | 3300005618 | Ga0068864_100329234 | Ga0068864_1003292342 | 353 |
| 512 | 3300005719 | Ga0068861_100052638 | Ga0068861_1000526381 | 353 |
| 513 | 3300005719 | Ga0068861_100441335 | Ga0068861_1004413351 | 353 |
| 514 | 3300005841 | Ga0068863_100021810 | Ga0068863_1000218103 | 353 |
| 515 | 3300005842 | Ga0068858_100162416 | Ga0068858_1001624162 | 353 |
| 516 | 3300005842 | Ga0068858_100437377 | Ga0068858_1004373772 | 353 |
| 517 | 3300005937 | Ga0081455_10055362 | Ga0081455_100553622 | 353 |
| 518 | 3300006038 | Ga0075365_10082714 | Ga0075365_100827142 | 353 |
| 519 | 3300006038 | Ga0075365_10170482 | Ga0075365_101704822 | 353 |
| 520 | 3300006048 | Ga0075363_100007673 | Ga0075363_1000076732 | 353 |
| 521 | 3300006048 | Ga0075363_100040039 | Ga0075363_1000400392 | 353 |
| 522 | 3300006051 | Ga0075364_10001908 | Ga0075364_100019082 | 353 |
| 523 | 3300006051 | Ga0075364_10004603 | Ga0075364_100046032 | 353 |
| 524 | 3300006175 | Ga0070712_100124993 | Ga0070712_1001249932 | 353 |
| 525 | 3300006177 | Ga0075362_10063002 | Ga0075362_100630022 | 353 |
| 526 | 3300006178 | Ga0075367_10023412 | Ga0075367_100234123 | 353 |
| 527 | 3300006186 | Ga0075369_10012593 | Ga0075369_100125932 | 353 |
| 528 | 3300006186 | Ga0075369_10071518 | Ga0075369_100715182 | 353 |
| 529 | 3300006237 | Ga0097621_100029904 | Ga0097621_1000299042 | 353 |
| 530 | 3300006353 | Ga0075370_10048108 | Ga0075370_100481082 | 353 |
| 531 | 3300006846 | Ga0075430_100224330 | Ga0075430_1002243301 | 353 |
| 532 | 3300006847 | Ga0075431_100056504 | Ga0075431_1000565043 | 353 |
| 533 | 3300006881 | Ga0068865_100104823 | Ga0068865_1001048233 | 353 |
| 534 | 3300006931 | Ga0097620_100130913 | Ga0097620_1001309132 | 353 |
| 535 | 3300009092 | Ga0105250_10007891 | Ga0105250_100078913 | 353 |
| 536 | 3300009098 | Ga0105245_10079624 | Ga0105245_100796243 | 353 |
| 537 | 3300009147 | Ga0114129_10022999 | Ga0114129_100229996 | 353 |
| 538 | 3300009148 | Ga0105243_10203574 | Ga0105243_102035742 | 353 |
| 539 | 3300009174 | Ga0105241_10424446 | Ga0105241_104244461 | 353 |
| 540 | 3300009545 | Ga0105237_10059499 | Ga0105237_100594992 | 353 |
| 541 | 3300009553 | Ga0105249_10050690 | Ga0105249_100506902 | 353 |
| 542 | 3300009553 | Ga0105249_10486663 | Ga0105249_104866632 | 353 |
| 543 | 3300010375 | Ga0105239_10290580 | Ga0105239_102905801 | 353 |
| 544 | 3300011119 | Ga0105246_10135595 | Ga0105246_101355953 | 353 |
| 545 | 3300013105 | Ga0157369_10065414 | Ga0157369_100654143 | 353 |
| 546 | 3300013296 | Ga0157374_10028848 | Ga0157374_100288483 | 353 |
| 547 | 3300013306 | Ga0163162_10169078 | Ga0163162_101690782 | 353 |
| 548 | 3300013306 | Ga0163162_10204831 | Ga0163162_102048312 | 353 |
| 549 | 3300013306 | Ga0163162_10366505 | Ga0163162_103665052 | 353 |
| 550 | 3300013308 | Ga0157375_10153402 | Ga0157375_101534022 | 353 |
| 551 | 3300014325 | Ga0163163_10010671 | Ga0163163_1001067110 | 353 |
| 552 | 3300014745 | Ga0157377_10034140 | Ga0157377_100341403 | 353 |
| 553 | 3300014745 | Ga0157377_10115503 | Ga0157377_101155032 | 353 |
| 554 | 3300014969 | Ga0157376_10325101 | Ga0157376_103251012 | 353 |
| 555 | 3300021384 | Ga0213876_10066336 | Ga0213876_100663361 | 353 |
| 556 | 3300021388 | Ga0213875_10009380 | Ga0213875_100093803 | 353 |
| 557 | 3300025899 | Ga0207642_10117544 | Ga0207642_101175442 | 353 |
| 558 | 3300025900 | Ga0207710_10001082 | Ga0207710_1000108210 | 353 |
| 559 | 3300025901 | Ga0207688_10007147 | Ga0207688_100071474 | 353 |
| 560 | 3300025904 | Ga0207647_10011346 | Ga0207647_100113463 | 353 |
| 561 | 3300025904 | Ga0207647_10131326 | Ga0207647_101313262 | 353 |
| 562 | 3300025907 | Ga0207645_10009109 | Ga0207645_100091094 | 353 |
| 563 | 3300025911 | Ga0207654_10069188 | Ga0207654_100691883 | 353 |
| 564 | 3300025915 | Ga0207693_10010959 | Ga0207693_100109592 | 353 |
| 565 | 3300025919 | Ga0207657_10018386 | Ga0207657_100183862 | 353 |
| 566 | 3300025923 | Ga0207681_10179757 | Ga0207681_101797572 | 353 |
| 567 | 3300025926 | Ga0207659_10200287 | Ga0207659_102002872 | 353 |
| 568 | 3300025927 | Ga0207687_10000594 | Ga0207687_100005943 | 353 |
| 569 | 3300025927 | Ga0207687_10047832 | Ga0207687_100478323 | 353 |
| 570 | 3300025929 | Ga0207664_10079939 | Ga0207664_100799392 | 353 |
| 571 | 3300025931 | Ga0207644_10084306 | Ga0207644_100843062 | 353 |
| 572 | 3300025932 | Ga0207690_10226193 | Ga0207690_102261932 | 353 |
| 573 | 3300025934 | Ga0207686_10003068 | Ga0207686_100030687 | 353 |
| 574 | 3300025937 | Ga0207669_10000196 | Ga0207669_1000019615 | 353 |
| 575 | 3300025938 | Ga0207704_10001017 | Ga0207704_1000101710 | 353 |
| 576 | 3300025938 | Ga0207704_10018203 | Ga0207704_100182032 | 353 |
| 577 | 3300025940 | Ga0207691_10054663 | Ga0207691_100546632 | 353 |
| 578 | 3300025940 | Ga0207691_10205210 | Ga0207691_102052101 | 353 |
| 579 | 3300025949 | Ga0207667_10285162 | Ga0207667_102851622 | 353 |
| 580 | 3300025961 | Ga0207712_10070324 | Ga0207712_100703243 | 353 |
| 581 | 3300025961 | Ga0207712_10141600 | Ga0207712_101416002 | 353 |
| 582 | 3300025972 | Ga0207668_10000708 | Ga0207668_100007081 | 353 |
| 583 | 3300025972 | Ga0207668_10237081 | Ga0207668_102370812 | 353 |
| 584 | 3300025981 | Ga0207640_10049193 | Ga0207640_100491933 | 353 |
| 585 | 3300026023 | Ga0207677_10038457 | Ga0207677_100384572 | 353 |
| 586 | 3300026035 | Ga0207703_10016663 | Ga0207703_100166633 | 353 |
| 587 | 3300026035 | Ga0207703_10037293 | Ga0207703_100372932 | 353 |
| 588 | 3300026067 | Ga0207678_10018104 | Ga0207678_100181042 | 353 |
| 589 | 3300026075 | Ga0207708_10000667 | Ga0207708_1000066712 | 353 |
| 590 | 3300026088 | Ga0207641_10133458 | Ga0207641_101334582 | 353 |
| 591 | 3300026089 | Ga0207648_10475692 | Ga0207648_104756921 | 353 |
| 592 | 3300026095 | Ga0207676_10249819 | Ga0207676_102498191 | 353 |
| 593 | 3300026118 | Ga0207675_100001148 | Ga0207675_1000011482 | 353 |
| 594 | 3300026118 | Ga0207675_100071618 | Ga0207675_1000716182 | 353 |
| 595 | 3300026121 | Ga0207683_10002485 | Ga0207683_1000248516 | 353 |
| 596 | 3300026121 | Ga0207683_10262030 | Ga0207683_102620302 | 353 |
| 597 | 3300027907 | Ga0207428_10199168 | Ga0207428_101991682 | 353 |
| 598 | 3300028379 | Ga0268266_10048719 | Ga0268266_100487192 | 353 |
| 599 | 3300028381 | Ga0268264_10001281 | Ga0268264_100012812 | 353 |
| 600 | 3300034817 | Ga0373948_0009169 | Ga0373948_0009169_606_1667 | 353 |
| 601 | 3300035090 | Ga0373949_0006400 | Ga0373949_0006400_1129_2190 | 353 |
| 602 | 3300035091 | Ga0373951_0007158 | Ga0373951_0007158_140_1201 | 353 |
| 603 | 3300035207 | Ga0373942_0012269 | Ga0373942_0012269_804_1865 | 353 |
| 604 | 3300036712 | Ga0316584_0166417 | Ga0316584_0166417_237_1307 | 353 |
| 605 | 3300037853 | Ga0436364_0271209 | Ga0436364_0271209_1240_2301 | 353 |
| 606 | 3300039437 | Ga0436365_0187823 | Ga0436365_0187823_4275_5336 | 353 |
| 607 | 3300039437 | Ga0436365_0810711 | Ga0436365_0810711_34846_35907 | 353 |
| 608 | 3300039437 | Ga0436365_1409440 | Ga0436365_1409440_1108_2169 | 353 |
| 609 | 3300042435 | Ga0439434_0029280 | Ga0439434_0029280_39_1100 | 353 |
| 610 | 3300044658 | Ga0466972_0035646 | Ga0466972_0035646_447_1508 | 353 |
| 611 | 3300044694 | Ga0466963_0045955 | Ga0466963_0045955_186_1247 | 353 |
| 612 | 3300044694 | Ga0466963_0254026 | Ga0466963_0254026_44_1105 | 353 |
| 613 | 3300044842 | Ga0466957_0018278 | Ga0466957_0018278_2997_4058 | 353 |
| 614 | 3300044901 | Ga0466960_0000893 | Ga0466960_0000893_4046_5107 | 353 |
| 615 | 3300045836 | Ga0466958_0027616 | Ga0466958_0027616_2143_3270 | 353 |
| 616 | 3300045836 | Ga0466958_0031525 | Ga0466958_0031525_763_1824 | 353 |
| 617 | 3300045976 | Ga0466967_0001278 | Ga0466967_0001278_7869_8930 | 353 |
| 618 | 3300045976 | Ga0466967_0078198 | Ga0466967_0078198_1726_2790 | 353 |
| 619 | 3300045976 | Ga0466967_0078503 | Ga0466967_0078503_1670_2755 | 353 |
| 620 | 3300045976 | Ga0466967_0081226 | Ga0466967_0081226_640_1701 | 353 |
| 621 | 3300045976 | Ga0466967_0194891 | Ga0466967_0194891_105_1172 | 353 |
| 622 | 3300046461 | Ga0495641_0037619 | Ga0495641_0037619_197_1267 | 353 |
| 623 | 3300046473 | Ga0495582_0059540 | Ga0495582_0059540_518_1588 | 353 |
| 624 | 3300046531 | Ga0495665_0082224 | Ga0495665_0082224_490_1560 | 353 |
| 625 | 3300047315 | Ga0495581_0070913 | Ga0495581_0070913_753_1823 | 353 |
| 626 | 3300047319 | Ga0495674_0021560 | Ga0495674_0021560_231_1301 | 353 |
| 627 | 3300047321 | Ga0495676_0040198 | Ga0495676_0040198_2730_3800 | 353 |
| 628 | 3300047673 | Ga0495593_0031540 | Ga0495593_0031540_345_1415 | 353 |
| 629 | 3300048903 | Ga0496100_0056016 | Ga0496100_0056016_1383_2444 | 353 |
| 630 | 3300048903 | Ga0496100_0100125 | Ga0496100_0100125_607_1677 | 353 |
| 631 | 3300048904 | Ga0496101_0006148 | Ga0496101_0006148_6022_7083 | 353 |
| 632 | 3300048904 | Ga0496101_0235950 | Ga0496101_0235950_64_1125 | 353 |
| 633 | 3300048905 | Ga0496102_0002940 | Ga0496102_0002940_3888_4949 | 353 |
| 634 | 3300048905 | Ga0496102_0014909 | Ga0496102_0014909_1601_2662 | 353 |
| 635 | 3300048905 | Ga0496102_0067515 | Ga0496102_0067515_880_1941 | 353 |
| 636 | 3300048905 | Ga0496102_0150096 | Ga0496102_0150096_1048_2109 | 353 |
| 637 | 3300048906 | Ga0496103_0008168 | Ga0496103_0008168_452_1513 | 353 |
| 638 | 3300048906 | Ga0496103_0012660 | Ga0496103_0012660_2705_3766 | 353 |
| 639 | 3300048907 | Ga0496104_0051861 | Ga0496104_0051861_1283_2344 | 353 |
| 640 | 3300048908 | Ga0496105_0021530 | Ga0496105_0021530_4083_5144 | 353 |
| 641 | 3300048909 | Ga0496106_0001251 | Ga0496106_0001251_6163_7224 | 353 |
| 642 | 3300048909 | Ga0496106_0133394 | Ga0496106_0133394_584_1666 | 353 |
| 643 | 3300048910 | Ga0496107_0064070 | Ga0496107_0064070_201_1262 | 353 |
| 644 | 3300048911 | Ga0496108_0000375 | Ga0496108_0000375_7380_8441 | 353 |
| 645 | 3300048911 | Ga0496108_0048600 | Ga0496108_0048600_912_1973 | 353 |
| 646 | 3300048911 | Ga0496108_0093243 | Ga0496108_0093243_1332_2414 | 353 |
| 647 | 3300048912 | Ga0496109_0011398 | Ga0496109_0011398_2129_3190 | 353 |
| 648 | 3300048912 | Ga0496109_0174396 | Ga0496109_0174396_218_1300 | 353 |
| 649 | 3300048913 | Ga0496110_0003151 | Ga0496110_0003151_10266_11327 | 353 |
| 650 | 3300048914 | Ga0496111_0064454 | Ga0496111_0064454_485_1546 | 353 |
| 651 | 3300048914 | Ga0496111_0124659 | Ga0496111_0124659_447_1508 | 353 |
| 652 | 3300048915 | Ga0496112_0007519 | Ga0496112_0007519_7287_8348 | 353 |
| 653 | 3300048915 | Ga0496112_0391299 | Ga0496112_0391299_134_1195 | 353 |
| 654 | 3300048915 | Ga0496112_0409967 | Ga0496112_0409967_202_1272 | 353 |
| 655 | 3300048917 | Ga0496114_0000766 | Ga0496114_0000766_22800_23861 | 353 |
| 656 | 3300048918 | Ga0496115_0011304 | Ga0496115_0011304_5386_6447 | 353 |
| 657 | 3300048921 | Ga0496118_0003869 | Ga0496118_0003869_188_1249 | 353 |
| 658 | 3300048921 | Ga0496118_0204330 | Ga0496118_0204330_89_1150 | 353 |
| 659 | 3300049571 | Ga0501034_0011034 | Ga0501034_0011034_1629_2690 | 353 |
| 660 | 3300049571 | Ga0501034_0067347 | Ga0501034_0067347_2212_3273 | 353 |
| 661 | 3300049572 | Ga0501036_0199188 | Ga0501036_0199188_552_1613 | 353 |
| 662 | 3300049573 | Ga0501037_0064465 | Ga0501037_0064465_1010_2071 | 353 |
| 663 | 3300049580 | Ga0501046_0009457 | Ga0501046_0009457_6291_7352 | 353 |
| 664 | 3300049581 | Ga0501047_0071460 | Ga0501047_0071460_442_1503 | 353 |
| 665 | 3300049586 | Ga0501070_0002995 | Ga0501070_0002995_3501_4562 | 353 |
| 666 | 3300049586 | Ga0501070_0203212 | Ga0501070_0203212_50_1129 | 353 |
| 667 | 3300049589 | Ga0501073_0157998 | Ga0501073_0157998_275_1354 | 353 |
| 668 | 3300049822 | Ga0501035_0150679 | Ga0501035_0150679_393_1454 | 353 |
| 669 | 3300050490 | nmdc:mga03n38_50100_c1 | nmdc:mga03n38_50100_c1_538_1599 | 353 |
| 670 | 3300050491 | nmdc:mga00v17_24328_c1 | nmdc:mga00v17_24328_c1_1379_2440 | 353 |
| 671 | 3300050492 | nmdc:mga0yw44_164926_c1 | nmdc:mga0yw44_164926_c1_364_1434 | 353 |
| 672 | 3300050492 | nmdc:mga0yw44_45819_c1 | nmdc:mga0yw44_45819_c1_1495_2556 | 353 |
| 673 | 3300050496 | nmdc:mga07m45_32573_c1 | nmdc:mga07m45_32573_c1_1303_2364 | 353 |
| 674 | 3300050510 | nmdc:mga06r32_9568_c1 | nmdc:mga06r32_9568_c1_6227_7288 | 353 |
| 675 | 3300050516 | nmdc:mga0sz30_95504_c1 | nmdc:mga0sz30_95504_c1_58_1119 | 353 |
| 676 | 3300061719 | Ga0466962_0066127 | Ga0466962_0066127_113_1174 | 353 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jap-assembly2.cif.gz_A | crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones | 0.9867 | 1 | 353 |
| 4jd3-assembly2.cif.gz_C | crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones | 0.9867 | 3 | 353 |
| 4jd3-assembly2.cif.gz_C | crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones | 0.9811 | 3 | 353 |
| 1u0m-assembly1.cif.gz_B | crystal structure of 1,3,6,8-tetrahydroxynaphthalene synthase (thns) from streptomyces coelicolor a3(2): a bacterial type iii polyketide synthase (pks) provides insights into enzymatic control of reactive polyketide intermediates | 0.9504 | 3 | 353 |
| 1u0m-assembly1.cif.gz_B | crystal structure of 1,3,6,8-tetrahydroxynaphthalene synthase (thns) from streptomyces coelicolor a3(2): a bacterial type iii polyketide synthase (pks) provides insights into enzymatic control of reactive polyketide intermediates | 0.9398 | 3 | 353 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jaoA02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9933 | 211 | 353 | 3.40.47.10 |
| af_P9WPF3_1_208_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9806 | 1 | 205 | 3.40.47.10 |
| 4jaoA02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.973 | 211 | 353 | 3.40.47.10 |
| af_P9WPF3_1_208_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9621 | 1 | 205 | 3.40.47.10 |
| 1tedA02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9545 | 211 | 352 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A109SWR2-F1-model_v4 | deleted | 0.9967 | 209 | 353 |
|
| AF-A0A0U0QWA4-F1-model_v4 | Chalcone synthase (EC 2.3.1.-, EC 2.3.1.74) | 0.9915 | 139 | 353 |
GO:0016210
GO:0030639 |
| AF-A0A0H5RSP8-F1-model_v4 | Chalcone synthase Pks10 | 0.9905 | 2 | 353 |
GO:0006633
GO:0016747 GO:0030639 |
| AF-A0A5B1AQ96-F1-model_v4 | Chalcone/stilbene synthase C-terminal domain-containing protein | 0.9896 | 210 | 319 |
GO:0016747
GO:0030639 |
| AF-A0A1V3WAZ6-F1-model_v4 | Alpha-pyrone synthesis polyketide synthase-like Pks11 (EC 2.3.1.-) | 0.9888 | 86 | 353 |
GO:0006633
GO:0016747 GO:0030639 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar