F474564

General Info

Members Datasets Scaffolds Average Seq Length
676 356 654 349

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8055172936|8055174599
Length 397
Sequence GKTQVSSTVSEPGIHMTRIAAVRGALPPNRYPQTEITDTFARICLPPGADRRLLDRLHTSARVGHRNLVLPLEQYAKLDGFGMANEIFIEAAVELGAEAVGAALEAAGLTPRDVDMIMFTSVTGIAAPSVDARLAGRLGLRPDVKRVPVFGLGCVAGAAGIGRLHDYLRGWPDHVAVLLSVELCSLTLQRGDSSPVNLVASGLFGDGAAAVVACGSGRAVPGSEGASVPGSEGAVGSGGMPGTGPTPGGPDAAGPTVIATRSHLYPDSEAVMGWEVSDTGFRVVLDTTVPEVVRTYLADDVHGFLADHGLTARDVTAWVCHPGGPKVLQAVAETLDLPDGALDLTWRSLADIGNLSSSSVLHVLRDTLALRPPPPGTPGVLIAMGPGFCSELVLLRW

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
5 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
6 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
7 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
8 2862574272 Streptomyces sp. AcE210 Isolate Nodule
9 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
10 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
11 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
12 2891562705 Microbispora tritici MT50 Isolate Unclassified
13 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
14 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
15 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
16 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
17 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
18 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
19 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
20 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
24 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
25 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
26 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
27 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
200 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
201 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
202 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
203 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
209 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
218 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
219 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
220 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
221 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
224 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
225 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
226 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
227 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
233 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
234 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
252 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
270 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
285 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
326 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
327 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
348 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
349 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
350 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
351 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
352 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
353 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
354 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
355 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
356 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.45
Metatranscriptomes 0.3
Isolates 3.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.36
Nodule 0.15
Rhizoplane 7.4
Rhizosphere 78.55
Stem 0
Stem Tuber 0
Unclassified 7.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1002411 3300001977 Bacteria 2982
2 JGI24739J22299_10013268 3300001989 Bacteria 3011
3 JGI24737J22298_10007391 3300001990 Bacteria 3711
4 JGI24743J22301_10001106 3300001991 Bacteria 3603
5 JGI24750J21931_1001541 3300002070 Bacteria 2839
6 JGI24744J21845_10001375 3300002077 Bacteria 4818
7 JGI24034J26672_10001541 3300002239 Bacteria 3064
8 JGI24742J22300_10002497 3300002244 Bacteria 2940
9 rootH2_10195207 3300003320 Bacteria 5915
10 Ga0070658_10006864 3300005327 Bacteria 9203
11 Ga0070683_100126221 3300005329 Bacteria 2419
12 Ga0070690_100009368 3300005330 Bacteria 5671
13 Ga0068869_100017484 3300005334 Bacteria 4862
14 Ga0070666_10012330 3300005335 Bacteria 5389
15 Ga0070680_100189573 3300005336 Bacteria 1732
16 Ga0070680_100346219 3300005336 Bacteria 1263
17 Ga0070682_100018767 3300005337 Bacteria 4049
18 Ga0068868_100001534 3300005338 Bacteria 15815
19 Ga0070660_100030184 3300005339 Bacteria 4066
20 Ga0070660_100193926 3300005339 Bacteria 1646
21 Ga0070691_10139672 3300005341 Bacteria 1233
22 Ga0070692_10148630 3300005345 Bacteria 1332
23 Ga0070668_100003591 3300005347 Bacteria 11440
24 Ga0070668_100156530 3300005347 Bacteria 1846
25 Ga0070669_100052715 3300005353 Bacteria 2977
26 Ga0070675_100050835 3300005354 Bacteria 3404
27 Ga0070671_100001055 3300005355 Bacteria 20319
28 Ga0070671_100082278 3300005355 Bacteria 2692
29 Ga0070674_100005222 3300005356 Bacteria 7472
30 Ga0070674_100008711 3300005356 Bacteria 6051
31 Ga0070674_100196880 3300005356 Bacteria 1553
32 Ga0070673_100148537 3300005364 Bacteria 1983
33 Ga0070673_100192256 3300005364 Bacteria 1753
34 Ga0070688_100006042 3300005365 Bacteria 6428
35 Ga0070688_100006500 3300005365 Bacteria 6250
36 Ga0070659_100066313 3300005366 Bacteria 2860
37 Ga0070659_100163309 3300005366 Bacteria 1822
38 Ga0070667_100003168 3300005367 Bacteria 14101
39 Ga0070667_100006233 3300005367 Bacteria 9924
40 Ga0070667_100033162 3300005367 Bacteria 4313
41 Ga0070667_100438597 3300005367 Bacteria 1192
42 Ga0070709_10074023 3300005434 Bacteria 2207
43 Ga0070709_10225796 3300005434 Bacteria 1337
44 Ga0070714_100049241 3300005435 Bacteria 3586
45 Ga0070714_100188451 3300005435 Bacteria 1881
46 Ga0070710_10001392 3300005437 Bacteria 11417
47 Ga0070710_10083407 3300005437 Bacteria 1870
48 Ga0070701_10006493 3300005438 Bacteria 4927
49 Ga0070711_100008288 3300005439 Bacteria 6359
50 Ga0070711_100028177 3300005439 Bacteria 3694
51 Ga0070705_100108009 3300005440 Bacteria 1772
52 Ga0070700_100005245 3300005441 Bacteria 6853
53 Ga0070700_100033608 3300005441 Bacteria 3090
54 Ga0070694_100004880 3300005444 Bacteria 8078
55 Ga0070663_100054446 3300005455 Bacteria 2860
56 Ga0070678_100002759 3300005456 Bacteria 9710
57 Ga0070678_100143932 3300005456 Bacteria 1911
58 Ga0070678_100222228 3300005456 Bacteria 1570
59 Ga0070662_100026108 3300005457 Bacteria 4042
60 Ga0070681_10042415 3300005458 Bacteria 4559
61 Ga0070681_10082039 3300005458 Bacteria 3180
62 Ga0070681_10182905 3300005458 Bacteria 2017
63 Ga0068867_100005802 3300005459 Bacteria 8761
64 Ga0068867_100112610 3300005459 Bacteria 2092
65 Ga0070684_100167019 3300005535 Bacteria 1998
66 Ga0068853_100010078 3300005539 Bacteria 7635
67 Ga0068853_100102204 3300005539 Bacteria 2536
68 Ga0068853_100120082 3300005539 Bacteria 2344
69 Ga0068853_100272314 3300005539 Bacteria 1559
70 Ga0070672_100079954 3300005543 Bacteria 2618
71 Ga0070686_100022138 3300005544 Bacteria 3783
72 Ga0070686_100044128 3300005544 Bacteria 2800
73 Ga0070695_100021292 3300005545 Bacteria 3966
74 Ga0070696_100057020 3300005546 Bacteria 2726
75 Ga0070693_100010110 3300005547 Bacteria 4712
76 Ga0070693_100025397 3300005547 Bacteria 3188
77 Ga0070665_100010566 3300005548 Bacteria 9343
78 Ga0070665_100037661 3300005548 Bacteria 4863
79 Ga0070665_100198972 3300005548 Bacteria 2004
80 Ga0070704_100000313 3300005549 Bacteria 21721
81 Ga0070704_100028516 3300005549 Bacteria 3715
82 Ga0070704_100140074 3300005549 Bacteria 1887
83 Ga0068855_100005049 3300005563 Bacteria 16107
84 Ga0068855_100308153 3300005563 Bacteria 1752
85 Ga0068855_100610503 3300005563 Bacteria 1175
86 Ga0068854_100001484 3300005578 Bacteria 14214
87 Ga0068854_100002893 3300005578 Bacteria 10668
88 Ga0068856_100035735 3300005614 Bacteria 4870
89 Ga0068856_100039164 3300005614 Bacteria 4653
90 Ga0068856_100363551 3300005614 Bacteria 1466
91 Ga0070702_100187142 3300005615 Bacteria 1359
92 Ga0068852_100015840 3300005616 Bacteria 5863
93 Ga0068852_100085631 3300005616 Bacteria 2808
94 Ga0068859_100004026 3300005617 Bacteria 14985
95 Ga0068859_100130908 3300005617 Bacteria 2580
96 Ga0068864_100329234 3300005618 Bacteria 1437
97 Ga0068866_10056984 3300005718 Bacteria 2011
98 Ga0068861_100001049 3300005719 Bacteria 16983
99 Ga0068861_100052638 3300005719 Bacteria 3095
100 Ga0068861_100242406 3300005719 Bacteria 1534
101 Ga0068861_100441335 3300005719 Bacteria 1164
102 Ga0068863_100006420 3300005841 Bacteria 11530
103 Ga0068863_100021810 3300005841 Bacteria 6112
104 Ga0068858_100014801 3300005842 Bacteria 7339
105 Ga0068858_100162416 3300005842 Bacteria 2103
106 Ga0068858_100437377 3300005842 Bacteria 1259
107 Ga0068860_100002092 3300005843 Bacteria 21025
108 Ga0068860_100368896 3300005843 Bacteria 1415
109 Ga0068862_100003302 3300005844 Bacteria 13953
110 Ga0068862_100075250 3300005844 Bacteria 2920
111 Ga0081455_10011250 3300005937 Bacteria 9003
112 Ga0081455_10055362 3300005937 Bacteria 3374
113 Ga0070717_10021403 3300006028 Bacteria 5095
114 Ga0075365_10082714 3300006038 Bacteria 2177
115 Ga0075365_10170482 3300006038 Bacteria 1519
116 Ga0075363_100007673 3300006048 Bacteria 4976
117 Ga0075363_100040039 3300006048 Bacteria 2469
118 Ga0075364_10001908 3300006051 Bacteria 11600
119 Ga0075364_10004603 3300006051 Bacteria 7947
120 Ga0075364_10074333 3300006051 Bacteria 2241
121 Ga0075364_10085463 3300006051 Bacteria 2089
122 Ga0070715_10000197 3300006163 Bacteria 14144
123 Ga0070716_100040545 3300006173 Bacteria 2591
124 Ga0070712_100006916 3300006175 Bacteria 7068
125 Ga0070712_100013001 3300006175 Bacteria 5309
126 Ga0070712_100124993 3300006175 Bacteria 1941
127 Ga0070712_100162377 3300006175 Bacteria 1726
128 Ga0075362_10063002 3300006177 Bacteria 1681
129 Ga0075367_10018625 3300006178 Bacteria 3835
130 Ga0075367_10023412 3300006178 Bacteria 3475
131 Ga0075369_10000432 3300006186 Bacteria 12737
132 Ga0075369_10012593 3300006186 Bacteria 3341
133 Ga0075369_10019582 3300006186 Bacteria 2764
134 Ga0075369_10056568 3300006186 Bacteria 1705
135 Ga0075369_10071518 3300006186 Bacteria 1527
136 Ga0097621_100029904 3300006237 Bacteria 4306
137 Ga0075370_10048108 3300006353 Bacteria 2416
138 Ga0068871_100090829 3300006358 Bacteria 2544
139 Ga0068871_100204345 3300006358 Bacteria 1707
140 Ga0075430_100224330 3300006846 Bacteria 1559
141 Ga0075431_100056504 3300006847 Bacteria 4048
142 Ga0075431_100313091 3300006847 Bacteria 1584
143 Ga0075429_100024137 3300006880 Bacteria 5274
144 Ga0068865_100104823 3300006881 Bacteria 2076
145 Ga0068865_100190268 3300006881 Bacteria 1586
146 Ga0097620_100004026 3300006931 Bacteria 14985
147 Ga0097620_100130913 3300006931 Bacteria 2580
148 Ga0099794_10001021 3300007265 Bacteria 9488
149 Ga0105251_10054305 3300009011 Bacteria 1903
150 Ga0105250_10007891 3300009092 Bacteria 4549
151 Ga0105240_10004501 3300009093 Bacteria 21181
152 Ga0105245_10005751 3300009098 Bacteria 10883
153 Ga0105245_10079624 3300009098 Bacteria 2992
154 Ga0105247_10003309 3300009101 Bacteria 10558
155 Ga0114129_10022999 3300009147 Bacteria 8843
156 Ga0114129_10054328 3300009147 Bacteria 5615
157 Ga0114129_10130049 3300009147 Bacteria 3459
158 Ga0105243_10000779 3300009148 Bacteria 30542
159 Ga0105243_10203574 3300009148 Bacteria 1738
160 Ga0105241_10008273 3300009174 Bacteria 7658
161 Ga0105241_10424446 3300009174 Bacteria 1171
162 Ga0105242_10000066 3300009176 Bacteria 73865
163 Ga0105248_10037978 3300009177 Bacteria 5387
164 Ga0105237_10059499 3300009545 Bacteria 3822
165 Ga0105237_10131334 3300009545 Bacteria 2499
166 Ga0105237_10223042 3300009545 Bacteria 1885
167 Ga0105237_10253280 3300009545 Bacteria 1763
168 Ga0105238_10188912 3300009551 Bacteria 2036
169 Ga0105249_10004766 3300009553 Bacteria 11701
170 Ga0105249_10050690 3300009553 Bacteria 3784
171 Ga0105249_10486663 3300009553 Bacteria 1277
172 Ga0105239_10015683 3300010375 Bacteria 8386
173 Ga0105239_10020214 3300010375 Bacteria 7345
174 Ga0105239_10290580 3300010375 Bacteria 1841
175 Ga0105239_10583957 3300010375 Bacteria 1274
176 Ga0105246_10135595 3300011119 Bacteria 1844
177 Ga0157373_10045936 3300013100 Bacteria 3117
178 Ga0157369_10022248 3300013105 Bacteria 7079
179 Ga0157369_10065414 3300013105 Bacteria 3913
180 Ga0157369_10077529 3300013105 Bacteria 3562
181 Ga0157374_10010125 3300013296 Bacteria 8100
182 Ga0157374_10028848 3300013296 Bacteria 5017
183 Ga0157374_10087228 3300013296 Bacteria 2970
184 Ga0157378_10002159 3300013297 Bacteria 17478
185 Ga0163162_10014890 3300013306 Bacteria 7594
186 Ga0163162_10075854 3300013306 Bacteria 3423
187 Ga0163162_10142805 3300013306 Bacteria 2508
188 Ga0163162_10169078 3300013306 Bacteria 2310
189 Ga0163162_10204831 3300013306 Bacteria 2102
190 Ga0163162_10366505 3300013306 Bacteria 1574
191 Ga0157372_10123852 3300013307 Bacteria 2972
192 Ga0157375_10000268 3300013308 Bacteria 47381
193 Ga0157375_10153402 3300013308 Bacteria 2440
194 Ga0163163_10010671 3300014325 Bacteria 8279
195 Ga0157380_10000036 3300014326 Bacteria 81892
196 Ga0157377_10031203 3300014745 Bacteria 2894
197 Ga0157377_10034140 3300014745 Bacteria 2782
198 Ga0157377_10115503 3300014745 Bacteria 1619
199 Ga0157379_10001562 3300014968 Bacteria 18866
200 Ga0157376_10065953 3300014969 Bacteria 3059
201 Ga0157376_10088990 3300014969 Bacteria 2669
202 Ga0157376_10325101 3300014969 Bacteria 1463
203 Ga0163161_10009914 3300017792 Bacteria 6598
204 Ga0197907_11018771 3300020069 Bacteria 1952
205 Ga0213872_10013785 3300021361 Bacteria 3781
206 Ga0213874_10015250 3300021377 Bacteria 2024
207 Ga0213874_10018415 3300021377 Unclassified 1887
208 Ga0213876_10013131 3300021384 Bacteria 4401
209 Ga0213876_10066336 3300021384 Bacteria 1905
210 Ga0213876_10092656 3300021384 Unclassified 1600
211 Ga0213875_10000575 3300021388 Bacteria 29979
212 Ga0213875_10009380 3300021388 Bacteria 4962
213 Ga0213875_10014462 3300021388 Unclassified 3850
214 Ga0213875_10042447 3300021388 Bacteria 2136
215 Ga0224712_10040707 3300022467 Bacteria 1750
216 Ga0207696_1024521 3300025711 Bacteria 1891
217 Ga0207692_10025507 3300025898 Bacteria 2762
218 Ga0207642_10004003 3300025899 Bacteria 4706
219 Ga0207642_10117544 3300025899 Bacteria 1366
220 Ga0207710_10001082 3300025900 Bacteria 14018
221 Ga0207688_10001014 3300025901 Bacteria 14331
222 Ga0207688_10007147 3300025901 Bacteria 6072
223 Ga0207647_10011346 3300025904 Bacteria 6253
224 Ga0207647_10041867 3300025904 Bacteria 2877
225 Ga0207647_10131326 3300025904 Bacteria 1472
226 Ga0207699_10054060 3300025906 Bacteria 2384
227 Ga0207645_10009109 3300025907 Bacteria 6885
228 Ga0207705_10003150 3300025909 Bacteria 12558
229 Ga0207705_10184033 3300025909 Unclassified 1578
230 Ga0207654_10011826 3300025911 Bacteria 4459
231 Ga0207654_10058692 3300025911 Bacteria 2241
232 Ga0207654_10069188 3300025911 Bacteria 2091
233 Ga0207707_10057685 3300025912 Bacteria 3379
234 Ga0207695_10002443 3300025913 Bacteria 27463
235 Ga0207671_10002910 3300025914 Bacteria 17666
236 Ga0207693_10000224 3300025915 Bacteria 51559
237 Ga0207693_10007684 3300025915 Bacteria 8853
238 Ga0207693_10010959 3300025915 Bacteria 7346
239 Ga0207693_10170608 3300025915 Bacteria 1713
240 Ga0207693_10236766 3300025915 Bacteria 1433
241 Ga0207663_10006226 3300025916 Bacteria 6087
242 Ga0207657_10018386 3300025919 Bacteria 6673
243 Ga0207681_10179757 3300025923 Bacteria 1610
244 Ga0207694_10001312 3300025924 Bacteria 21375
245 Ga0207659_10200287 3300025926 Bacteria 1594
246 Ga0207659_10206546 3300025926 Bacteria 1572
247 Ga0207687_10000594 3300025927 Bacteria 24499
248 Ga0207687_10008487 3300025927 Bacteria 6716
249 Ga0207687_10047832 3300025927 Bacteria 2967
250 Ga0207664_10079939 3300025929 Bacteria 2656
251 Ga0207644_10052351 3300025931 Bacteria 2933
252 Ga0207644_10084306 3300025931 Bacteria 2355
253 Ga0207690_10226193 3300025932 Bacteria 1434
254 Ga0207706_10000288 3300025933 Bacteria 54869
255 Ga0207686_10003068 3300025934 Bacteria 8987
256 Ga0207709_10007903 3300025935 Bacteria 5897
257 Ga0207670_10059445 3300025936 Bacteria 2600
258 Ga0207669_10000196 3300025937 Bacteria 27615
259 Ga0207669_10026418 3300025937 Bacteria 3157
260 Ga0207704_10001017 3300025938 Bacteria 12443
261 Ga0207704_10010220 3300025938 Bacteria 4567
262 Ga0207704_10013681 3300025938 Bacteria 4072
263 Ga0207704_10018203 3300025938 Bacteria 3663
264 Ga0207665_10008988 3300025939 Bacteria 6557
265 Ga0207665_10010453 3300025939 Bacteria 6099
266 Ga0207665_10065209 3300025939 Bacteria 2476
267 Ga0207691_10054663 3300025940 Bacteria 3642
268 Ga0207691_10205210 3300025940 Bacteria 1714
269 Ga0207711_10031606 3300025941 Bacteria 4470
270 Ga0207689_10027054 3300025942 Bacteria 4801
271 Ga0207667_10073808 3300025949 Bacteria 3544
272 Ga0207667_10285162 3300025949 Bacteria 1687
273 Ga0207712_10070324 3300025961 Bacteria 2514
274 Ga0207712_10141600 3300025961 Bacteria 1846
275 Ga0207712_10170739 3300025961 Bacteria 1700
276 Ga0207668_10000708 3300025972 Bacteria 20382
277 Ga0207668_10006971 3300025972 Bacteria 6702
278 Ga0207668_10237081 3300025972 Bacteria 1474
279 Ga0207640_10004862 3300025981 Bacteria 7298
280 Ga0207640_10049193 3300025981 Bacteria 2728
281 Ga0207658_10016511 3300025986 Bacteria 5078
282 Ga0207658_10016993 3300025986 Bacteria 5008
283 Ga0207677_10038457 3300026023 Bacteria 3137
284 Ga0207703_10007155 3300026035 Bacteria 8876
285 Ga0207703_10016663 3300026035 Bacteria 5732
286 Ga0207703_10037293 3300026035 Bacteria 3872
287 Ga0207703_10506197 3300026035 Bacteria 1134
288 Ga0207639_10083156 3300026041 Bacteria 2540
289 Ga0207678_10014277 3300026067 Bacteria 6984
290 Ga0207678_10018104 3300026067 Bacteria 6187
291 Ga0207678_10146433 3300026067 Bacteria 2016
292 Ga0207708_10000667 3300026075 Bacteria 26347
293 Ga0207708_10003048 3300026075 Bacteria 12338
294 Ga0207702_10026632 3300026078 Bacteria 4800
295 Ga0207702_10050180 3300026078 Bacteria 3523
296 Ga0207641_10042878 3300026088 Bacteria 3797
297 Ga0207641_10133458 3300026088 Bacteria 2232
298 Ga0207648_10001622 3300026089 Bacteria 24662
299 Ga0207648_10068522 3300026089 Bacteria 3092
300 Ga0207648_10475692 3300026089 Bacteria 1140
301 Ga0207676_10249819 3300026095 Bacteria 1596
302 Ga0207675_100000324 3300026118 Bacteria 45435
303 Ga0207675_100001148 3300026118 Bacteria 26257
304 Ga0207675_100071618 3300026118 Bacteria 3241
305 Ga0207675_100140160 3300026118 Bacteria 2297
306 Ga0207683_10000077 3300026121 Bacteria 77710
307 Ga0207683_10002485 3300026121 Bacteria 16082
308 Ga0207683_10040740 3300026121 Bacteria 4055
309 Ga0207683_10262030 3300026121 Bacteria 1578
310 Ga0207428_10199168 3300027907 Bacteria 1507
311 Ga0268266_10008138 3300028379 Bacteria 9363
312 Ga0268266_10011847 3300028379 Bacteria 7556
313 Ga0268266_10048719 3300028379 Bacteria 3632
314 Ga0268265_10008953 3300028380 Bacteria 6769
315 Ga0268264_10001281 3300028381 Bacteria 23793
316 Ga0268264_10011619 3300028381 Bacteria 7262
317 Ga0307515_10023269 3300028794 Bacteria 10866
318 Ga0265338_10001088 3300028800 Bacteria 45144
319 Ga0307512_10016297 3300030522 Bacteria 6864
320 Ga0265339_10003630 3300031249 Bacteria 10767
321 Ga0307513_10032914 3300031456 Bacteria 5837
322 Ga0307513_10074084 3300031456 Bacteria 3542
323 Ga0307508_10063119 3300031616 Bacteria 3269
324 Ga0307514_10107836 3300031649 Bacteria 1982
325 Ga0265314_10132941 3300031711 Bacteria 1549
326 Ga0316576_10004486 3300031727 Bacteria 8384
327 Ga0316577_10119780 3300031733 Bacteria 1479
328 Ga0307518_10002821 3300031838 Bacteria 12609
329 Ga0373948_0009169 3300034817 Bacteria 1702
330 Ga0373949_0006400 3300035090 Bacteria 2591
331 Ga0373951_0007158 3300035091 Bacteria 2538
332 Ga0373932_0057322 3300035112 Bacteria 1174
333 Ga0373942_0012269 3300035207 Bacteria 2044
334 Ga0373935_0114160 3300035692 Bacteria 1796
335 Ga0316582_0016179 3300036647 Bacteria 4285
336 Ga0316584_0166417 3300036712 Bacteria 1637
337 Ga0395900_0098024 3300037418 Bacteria 3012
338 Ga0395898_0136673 3300037466 Bacteria 2347
339 Ga0395905_0360754 3300037471 Bacteria 1346
340 Ga0436364_0108822 3300037853 Bacteria 3669
341 Ga0436364_0271209 3300037853 Bacteria 17136
342 Ga0436364_0934343 3300037853 Bacteria 2136
343 Ga0436364_1008502 3300037853 Bacteria 66010
344 Ga0436364_1345478 3300037853 Unclassified 4922
345 Ga0436365_0187823 3300039437 Bacteria 22544
346 Ga0436365_0464118 3300039437 Bacteria 5357
347 Ga0436365_0588267 3300039437 Bacteria 3146
348 Ga0436365_0810711 3300039437 Bacteria 50192
349 Ga0436365_1409440 3300039437 Bacteria 11548
350 Ga0436361_0474393 3300039447 Bacteria 166415
351 Ga0436363_0010176 3300039450 Unclassified 2173
352 Ga0436363_0360664 3300039450 Bacteria 5780
353 Ga0439461_0000574 3300041410 Bacteria 5329
354 Ga0439466_0002159 3300041411 Bacteria 7706
355 Ga0439465_0047262 3300041413 Bacteria 1402
356 Ga0451793_0215871 3300041452 Bacteria 2155
357 Ga0451797_1104098 3300041453 Bacteria 1926
358 Ga0439431_0000447 3300041997 Bacteria 8689
359 Ga0439442_017270 3300042002 Bacteria 1489
360 Ga0439434_0003234 3300042435 Bacteria 4784
361 Ga0439434_0029280 3300042435 Bacteria 1669
362 Ga0466969_0003976 3300044656 Bacteria 7849
363 Ga0466972_0033971 3300044658 Bacteria 2501
364 Ga0466972_0035646 3300044658 Bacteria 2435
365 Ga0466965_0000686 3300044683 Bacteria 12514
366 Ga0466965_0006756 3300044683 Bacteria 5234
367 Ga0466965_0011035 3300044683 Bacteria 4225
368 Ga0466966_0001411 3300044684 Bacteria 15471
369 Ga0466966_0075782 3300044684 Bacteria 2101
370 Ga0466961_0001880 3300044693 Bacteria 13054
371 Ga0466963_0001442 3300044694 Bacteria 12805
372 Ga0466963_0045955 3300044694 Bacteria 2877
373 Ga0466963_0254026 3300044694 Bacteria 1234
374 Ga0453684_0360009 3300044712 Bacteria 1638
375 Ga0466971_0047062 3300044719 Bacteria 1938
376 Ga0466968_0007037 3300044735 Bacteria 4263
377 Ga0466970_0000235 3300044765 Bacteria 27066
378 Ga0466970_0018544 3300044765 Bacteria 3603
379 Ga0466970_0021565 3300044765 Bacteria 3355
380 Ga0466957_0011701 3300044842 Bacteria 5071
381 Ga0466957_0013117 3300044842 Bacteria 4803
382 Ga0466957_0018278 3300044842 Bacteria 4116
383 Ga0466957_0044037 3300044842 Bacteria 2704
384 Ga0466960_0000043 3300044901 Bacteria 40805
385 Ga0466960_0000893 3300044901 Bacteria 10550
386 Ga0466960_0009641 3300044901 Bacteria 3987
387 Ga0466960_0017115 3300044901 Bacteria 3155
388 Ga0466959_0000228 3300045049 Bacteria 35389
389 Ga0466959_0041991 3300045049 Bacteria 3374
390 Ga0466958_0003793 3300045836 Bacteria 7889
391 Ga0466958_0027616 3300045836 Bacteria 3360
392 Ga0466958_0031525 3300045836 Bacteria 3151
393 Ga0466958_0036071 3300045836 Bacteria 2958
394 Ga0466958_0200396 3300045836 Bacteria 1270
395 Ga0466967_0001278 3300045976 Bacteria 14303
396 Ga0466967_0035672 3300045976 Bacteria 4236
397 Ga0466967_0078198 3300045976 Bacteria 2980
398 Ga0466967_0078503 3300045976 Bacteria 2974
399 Ga0466967_0081226 3300045976 Bacteria 2928
400 Ga0466967_0102573 3300045976 Bacteria 2617
401 Ga0466967_0194891 3300045976 Bacteria 1916
402 Ga0495617_008207 3300046452 Bacteria 3606
403 Ga0495592_0001429 3300046454 Bacteria 16573
404 Ga0495592_0066581 3300046454 Bacteria 2635
405 Ga0495592_0077813 3300046454 Bacteria 2403
406 Ga0495592_0164446 3300046454 Bacteria 1524
407 Ga0495603_0000765 3300046455 Bacteria 18365
408 Ga0495603_0003497 3300046455 Bacteria 9346
409 Ga0495603_0012031 3300046455 Bacteria 5238
410 Ga0495629_0004675 3300046459 Bacteria 10257
411 Ga0495629_0005953 3300046459 Bacteria 9079
412 Ga0495629_0022019 3300046459 Bacteria 4545
413 Ga0495629_0056176 3300046459 Bacteria 2753
414 Ga0495629_0078102 3300046459 Bacteria 2311
415 Ga0495638_0172521 3300046460 Bacteria 1240
416 Ga0495641_0037619 3300046461 Bacteria 2266
417 Ga0495641_0050006 3300046461 Bacteria 1912
418 Ga0495651_0002255 3300046462 Bacteria 14897
419 Ga0495651_0007772 3300046462 Bacteria 8205
420 Ga0495651_0009658 3300046462 Bacteria 7418
421 Ga0495651_0045916 3300046462 Bacteria 3382
422 Ga0495653_0015204 3300046463 Bacteria 6273
423 Ga0495653_0152298 3300046463 Bacteria 1614
424 Ga0495582_0059540 3300046473 Bacteria 2107
425 Ga0495582_0138703 3300046473 Bacteria 1377
426 Ga0495662_0004034 3300046476 Bacteria 7394
427 Ga0495662_0009605 3300046476 Bacteria 4743
428 Ga0495662_0010308 3300046476 Bacteria 4579
429 Ga0495662_0018701 3300046476 Bacteria 3354
430 Ga0495664_0003276 3300046477 Bacteria 8801
431 Ga0495664_0009224 3300046477 Bacteria 5515
432 Ga0495664_0235376 3300046477 Bacteria 1108
433 Ga0495585_0001761 3300046492 Bacteria 16474
434 Ga0495585_0038486 3300046492 Bacteria 2692
435 Ga0495594_0044024 3300046499 Bacteria 2448
436 Ga0495594_0079672 3300046499 Bacteria 1829
437 Ga0495594_0084619 3300046499 Bacteria 1774
438 Ga0495607_0064977 3300046501 Bacteria 2059
439 Ga0495583_0020098 3300046506 Bacteria 3468
440 Ga0495628_0010353 3300046516 Bacteria 7929
441 Ga0495628_0059510 3300046516 Bacteria 2999
442 Ga0495630_0020357 3300046517 Bacteria 4891
443 Ga0495630_0043526 3300046517 Bacteria 3354
444 Ga0495652_0012110 3300046529 Bacteria 7792
445 Ga0495652_0038924 3300046529 Bacteria 4114
446 Ga0495652_0147174 3300046529 Bacteria 1845
447 Ga0495665_0082224 3300046531 Bacteria 1693
448 Ga0495640_0001256 3300046533 Bacteria 19903
449 Ga0495640_0004019 3300046533 Bacteria 11767
450 Ga0495640_0010089 3300046533 Bacteria 7321
451 Ga0495640_0065115 3300046533 Bacteria 2462
452 Ga0495587_0001809 3300046536 Bacteria 14267
453 Ga0495587_0006340 3300046536 Bacteria 7713
454 Ga0495587_0010691 3300046536 Bacteria 5827
455 Ga0495645_0010749 3300046543 Bacteria 6432
456 Ga0495645_0054714 3300046543 Bacteria 2899
457 Ga0495667_0016349 3300046559 Bacteria 5014
458 Ga0495667_0034528 3300046559 Bacteria 3382
459 Ga0495634_0000535 3300046642 Bacteria 37286
460 Ga0495634_0035550 3300046642 Bacteria 3410
461 Ga0495634_0086632 3300046642 Bacteria 2040
462 Ga0495611_0003683 3300046648 Bacteria 6712
463 Ga0495635_0001798 3300046663 Bacteria 14499
464 Ga0495635_0007371 3300046663 Bacteria 7675
465 Ga0495635_0142665 3300046663 Bacteria 1631
466 Ga0495635_0217688 3300046663 Bacteria 1292
467 Ga0495588_0023666 3300046674 Bacteria 3043
468 Ga0495588_0038616 3300046674 Bacteria 2429
469 Ga0495657_0002019 3300046675 Bacteria 17285
470 Ga0495657_0002058 3300046675 Bacteria 17117
471 Ga0495657_0008280 3300046675 Bacteria 7966
472 Ga0495657_0011542 3300046675 Bacteria 6602
473 Ga0495657_0032941 3300046675 Bacteria 3612
474 Ga0495599_0005251 3300046678 Bacteria 7728
475 Ga0495623_0005019 3300046679 Bacteria 8678
476 Ga0495646_0001682 3300046680 Bacteria 13232
477 Ga0495646_0004122 3300046680 Bacteria 9123
478 Ga0495658_0040562 3300046683 Bacteria 2589
479 Ga0495613_0003158 3300046689 Bacteria 12343
480 Ga0495613_0003801 3300046689 Bacteria 11318
481 Ga0495613_0004186 3300046689 Bacteria 10795
482 Ga0495613_0004495 3300046689 Bacteria 10453
483 Ga0495613_0008195 3300046689 Bacteria 7762
484 Ga0495613_0009210 3300046689 Bacteria 7320
485 Ga0495624_0068387 3300046690 Bacteria 2214
486 Ga0495670_0138863 3300046691 Bacteria 1270
487 Ga0495589_0020033 3300046794 Bacteria 3421
488 Ga0495600_0004749 3300046809 Bacteria 8152
489 Ga0495600_0053138 3300046809 Bacteria 2645
490 Ga0495600_0092713 3300046809 Bacteria 1970
491 Ga0495660_0003633 3300046810 Bacteria 9494
492 Ga0495581_0006822 3300047315 Bacteria 6624
493 Ga0495581_0025921 3300047315 Bacteria 3400
494 Ga0495581_0035263 3300047315 Bacteria 2895
495 Ga0495581_0070913 3300047315 Bacteria 2016
496 Ga0495604_0000284 3300047317 Bacteria 45236
497 Ga0495604_0001320 3300047317 Bacteria 20245
498 Ga0495604_0010657 3300047317 Bacteria 7291
499 Ga0495604_0023894 3300047317 Bacteria 4878
500 Ga0495604_0055515 3300047317 Bacteria 3052
501 Ga0495604_0068210 3300047317 Bacteria 2700
502 Ga0495636_0011349 3300047318 Bacteria 3526
503 Ga0495674_0021560 3300047319 Bacteria 5957
504 Ga0495674_0049107 3300047319 Bacteria 3730
505 Ga0495672_0088365 3300047320 Bacteria 1708
506 Ga0495676_0028092 3300047321 Bacteria 4812
507 Ga0495676_0040198 3300047321 Bacteria 3863
508 Ga0495676_0049517 3300047321 Bacteria 3377
509 Ga0495676_0057414 3300047321 Bacteria 3070
510 Ga0495683_0001156 3300047323 Bacteria 18115
511 Ga0495687_002795 3300047443 Bacteria 13470
512 Ga0495675_0003362 3300047444 Bacteria 9635
513 Ga0495675_0015699 3300047444 Bacteria 4788
514 Ga0495675_0024034 3300047444 Bacteria 3882
515 Ga0495675_0066185 3300047444 Bacteria 2284
516 Ga0495685_035358 3300047447 Bacteria 1717
517 Ga0495684_0005393 3300047471 Bacteria 9956
518 Ga0495684_0045437 3300047471 Bacteria 3361
519 Ga0495593_0005510 3300047673 Bacteria 7471
520 Ga0495593_0013924 3300047673 Bacteria 4582
521 Ga0495593_0031540 3300047673 Bacteria 2894
522 Ga0495602_0010713 3300048088 Bacteria 9507
523 Ga0495614_0000601 3300048089 Bacteria 15073
524 Ga0495614_0091970 3300048089 Bacteria 1320
525 Ga0496100_0038245 3300048903 Bacteria 3040
526 Ga0496100_0056016 3300048903 Bacteria 2578
527 Ga0496100_0069841 3300048903 Bacteria 2340
528 Ga0496100_0100125 3300048903 Bacteria 1996
529 Ga0496101_0006148 3300048904 Bacteria 7707
530 Ga0496101_0038130 3300048904 Bacteria 3412
531 Ga0496101_0235950 3300048904 Bacteria 1423
532 Ga0496102_0000915 3300048905 Bacteria 27833
533 Ga0496102_0002940 3300048905 Bacteria 14452
534 Ga0496102_0014909 3300048905 Bacteria 6762
535 Ga0496102_0067515 3300048905 Bacteria 3280
536 Ga0496102_0150096 3300048905 Bacteria 2189
537 Ga0496103_0008168 3300048906 Bacteria 6212
538 Ga0496103_0012660 3300048906 Bacteria 5004
539 Ga0496103_0020319 3300048906 Bacteria 3989
540 Ga0496104_0051861 3300048907 Bacteria 3873
541 Ga0496105_0021530 3300048908 Bacteria 5216
542 Ga0496106_0001251 3300048909 Bacteria 19027
543 Ga0496106_0095081 3300048909 Bacteria 2304
544 Ga0496106_0133394 3300048909 Bacteria 1949
545 Ga0496107_0000854 3300048910 Bacteria 17883
546 Ga0496107_0064070 3300048910 Bacteria 2664
547 Ga0496107_0134032 3300048910 Bacteria 1830
548 Ga0496108_0000375 3300048911 Bacteria 37222
549 Ga0496108_0045273 3300048911 Bacteria 3675
550 Ga0496108_0048600 3300048911 Bacteria 3547
551 Ga0496108_0093243 3300048911 Bacteria 2561
552 Ga0496109_0011398 3300048912 Bacteria 7640
553 Ga0496109_0013758 3300048912 Bacteria 7030
554 Ga0496109_0170304 3300048912 Bacteria 2043
555 Ga0496109_0174396 3300048912 Bacteria 2018
556 Ga0496109_0388348 3300048912 Bacteria 1319
557 Ga0496110_0003151 3300048913 Bacteria 12541
558 Ga0496111_0064454 3300048914 Bacteria 2658
559 Ga0496111_0124659 3300048914 Bacteria 1904
560 Ga0496112_0007519 3300048915 Bacteria 9671
561 Ga0496112_0012218 3300048915 Bacteria 7882
562 Ga0496112_0021144 3300048915 Bacteria 6183
563 Ga0496112_0391299 3300048915 Bacteria 1330
564 Ga0496112_0409967 3300048915 Bacteria 1294
565 Ga0496113_0057270 3300048916 Bacteria 2929
566 Ga0496113_0195037 3300048916 Bacteria 1608
567 Ga0496114_0000045 3300048917 Bacteria 126886
568 Ga0496114_0000766 3300048917 Bacteria 24011
569 Ga0496114_0001108 3300048917 Bacteria 20364
570 Ga0496115_0005192 3300048918 Bacteria 9467
571 Ga0496115_0008253 3300048918 Bacteria 7698
572 Ga0496115_0011304 3300048918 Bacteria 6689
573 Ga0496118_0003869 3300048921 Bacteria 18393
574 Ga0496118_0204330 3300048921 Bacteria 1166
575 Ga0496119_0054548 3300048922 Unclassified 2433
576 Ga0496121_0140458 3300048924 Bacteria 1793
577 Ga0496123_0056766 3300048926 Bacteria 2555
578 Ga0496126_0002219 3300048929 Bacteria 26885
579 Ga0496126_0079850 3300048929 Bacteria 2895
580 Ga0501031_0003559 3300049568 Bacteria 10007
581 Ga0501032_0004950 3300049569 Bacteria 9963
582 Ga0501034_0009889 3300049571 Bacteria 9969
583 Ga0501034_0011034 3300049571 Bacteria 9379
584 Ga0501034_0030998 3300049571 Bacteria 5434
585 Ga0501034_0067347 3300049571 Bacteria 3594
586 Ga0501036_0029781 3300049572 Bacteria 4613
587 Ga0501036_0199188 3300049572 Bacteria 1684
588 Ga0501037_0013608 3300049573 Bacteria 5993
589 Ga0501037_0064465 3300049573 Bacteria 2670
590 Ga0501038_0040632 3300049574 Bacteria 4059
591 Ga0501038_0136685 3300049574 Bacteria 2007
592 Ga0501039_0000835 3300049575 Bacteria 22275
593 Ga0501039_0020591 3300049575 Bacteria 5054
594 Ga0501041_0015104 3300049577 Bacteria 4586
595 Ga0501043_0016855 3300049579 Bacteria 5726
596 Ga0501046_0009457 3300049580 Bacteria 8422
597 Ga0501046_0024825 3300049580 Bacteria 4911
598 Ga0501047_0021818 3300049581 Bacteria 6148
599 Ga0501047_0071460 3300049581 Bacteria 3341
600 Ga0501047_0217158 3300049581 Bacteria 1769
601 Ga0501047_0266952 3300049581 Unclassified 1558
602 Ga0501048_0131548 3300049582 Bacteria 1768
603 Ga0501067_0015476 3300049583 Bacteria 4222
604 Ga0501068_0012777 3300049584 Bacteria 4767
605 Ga0501069_0004427 3300049585 Bacteria 7255
606 Ga0501070_0002995 3300049586 Bacteria 14699
607 Ga0501070_0008673 3300049586 Bacteria 8595
608 Ga0501070_0203212 3300049586 Bacteria 1627
609 Ga0501071_0010148 3300049587 Bacteria 6301
610 Ga0501072_0004542 3300049588 Bacteria 10550
611 Ga0501073_0016582 3300049589 Bacteria 5338
612 Ga0501073_0018809 3300049589 Bacteria 4992
613 Ga0501073_0157998 3300049589 Bacteria 1571
614 Ga0501077_0026031 3300049593 Bacteria 3712
615 Ga0501079_0025517 3300049741 Bacteria 4531
616 Ga0501080_0131573 3300049742 Bacteria 2316
617 Ga0501083_0008871 3300049744 Bacteria 7100
618 Ga0501035_0150679 3300049822 Bacteria 2018
619 Ga0501044_0005313 3300049823 Bacteria 14326
620 Ga0501044_0012714 3300049823 Bacteria 9117
621 nmdc:mga03n38_50100_c1 3300050490 Bacteria 1860
622 nmdc:mga03n38_66081_c1 3300050490 Bacteria 1660
623 nmdc:mga00v17_24328_c1 3300050491 Bacteria 3512
624 nmdc:mga00v17_48709_c1 3300050491 Bacteria 2569
625 nmdc:mga00v17_9568_c1 3300050491 Bacteria 5251
626 nmdc:mga0yw44_164926_c1 3300050492 Bacteria 1452
627 nmdc:mga0yw44_45819_c1 3300050492 Bacteria 2623
628 nmdc:mga06z11_43196_c1 3300050494 Bacteria 2266
629 nmdc:mga07m45_32573_c1 3300050496 Bacteria 2890
630 nmdc:mga05p37_168234_c1 3300050507 Bacteria 2674
631 nmdc:mga05p37_91320_c1 3300050507 Bacteria 3752
632 nmdc:mga06r32_205740_c1 3300050510 Bacteria 1956
633 nmdc:mga06r32_281962_c1 3300050510 Bacteria 1648
634 nmdc:mga06r32_9568_c1 3300050510 Bacteria 8753
635 nmdc:mga0sz30_1591_c2 3300050516 Bacteria 6325
636 nmdc:mga0sz30_17951_c1 3300050516 Bacteria 2827
637 nmdc:mga0sz30_19557_c1 3300050516 Bacteria 1378
638 nmdc:mga0sz30_59301_c1 3300050516 Bacteria 1633
639 nmdc:mga0sz30_95504_c1 3300050516 Bacteria 1296
640 nmdc:mga0sz30_95696_c1 3300050516 Bacteria 1295
641 Ga0495601_0121709 3300053077 Bacteria 1695
642 Ga0500643_000213 3300053087 Bacteria 54707
643 Ga0500643_008952 3300053087 Bacteria 3874
644 Ga0500640_003785 3300053095 Bacteria 5373
645 Ga0500553_078154 3300053101 Bacteria 1499
646 Ga0500652_026557 3300053131 Bacteria 2231
647 Ga0500559_0035783 3300053136 Bacteria 2146
648 Ga0500559_0074466 3300053136 Bacteria 1534
649 Ga0500573_0012180 3300053140 Bacteria 4827
650 Ga0500627_0004080 3300053158 Bacteria 4628
651 Ga0500645_000188 3300053730 Bacteria 48061
652 Ga0500645_027614 3300053730 Bacteria 1720
653 Ga0466962_0014026 3300061719 Bacteria 3859
654 Ga0466962_0066127 3300061719 Bacteria 1726

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0108822 Ga0436364_0108822_40_924 293
2 3300046499 Ga0495594_0044024 Ga0495594_0044024_127_1026 297
3 3300005459 Ga0068867_100112610 Ga0068867_1001126103 298
4 3300005546 Ga0070696_100057020 Ga0070696_1000570203 298
5 3300046454 Ga0495592_0077813 Ga0495592_0077813_1459_2382 299
6 3300046809 Ga0495600_0053138 Ga0495600_0053138_18_929 300
7 3300050494 nmdc:mga06z11_43196_c1 nmdc:mga06z11_43196_c1_1339_2250 300
8 3300025961 Ga0207712_10170739 Ga0207712_101707391 301
9 3300025913 Ga0207695_10002443 Ga0207695_1000244311 313
10 3300005355 Ga0070671_100001055 Ga0070671_10000105515 316
11 3300005367 Ga0070667_100006233 Ga0070667_1000062332 316
12 3300005544 Ga0070686_100044128 Ga0070686_1000441283 316
13 3300005548 Ga0070665_100010566 Ga0070665_1000105662 316
14 3300005841 Ga0068863_100006420 Ga0068863_1000064203 316
15 3300025931 Ga0207644_10052351 Ga0207644_100523512 316
16 3300025986 Ga0207658_10016511 Ga0207658_100165112 316
17 3300026035 Ga0207703_10506197 Ga0207703_105061971 316
18 3300026088 Ga0207641_10042878 Ga0207641_100428782 316
19 3300028379 Ga0268266_10008138 Ga0268266_100081383 316
20 3300048912 Ga0496109_0170304 Ga0496109_0170304_71_1021 316
21 3300050516 nmdc:mga0sz30_19557_c1 nmdc:mga0sz30_19557_c1_311_1261 316
22 3300049742 Ga0501080_0131573 Ga0501080_0131573_27_1010 323
23 3300041452 Ga0451793_0215871 Ga0451793_0215871_904_1902 325
24 3300041453 Ga0451797_1104098 Ga0451797_1104098_523_1521 325
25 3300022467 Ga0224712_10040707 Ga0224712_100407072 326
26 3300006178 Ga0075367_10018625 Ga0075367_100186254 327
27 3300031838 Ga0307518_10002821 Ga0307518_1000282111 327
28 3300046529 Ga0495652_0147174 Ga0495652_0147174_807_1805 327
29 3300046663 Ga0495635_0217688 Ga0495635_0217688_282_1280 327
30 3300047317 Ga0495604_0068210 Ga0495604_0068210_52_1050 327
31 3300002244 JGI24742J22300_10002497 JGI24742J22300_100024972 330
32 3300005330 Ga0070690_100009368 Ga0070690_1000093682 330
33 3300005334 Ga0068869_100017484 Ga0068869_1000174842 330
34 3300005337 Ga0070682_100018767 Ga0070682_1000187674 330
35 3300005338 Ga0068868_100001534 Ga0068868_10000153410 330
36 3300005339 Ga0070660_100193926 Ga0070660_1001939262 330
37 3300005345 Ga0070692_10148630 Ga0070692_101486301 330
38 3300005347 Ga0070668_100003591 Ga0070668_1000035916 330
39 3300005353 Ga0070669_100052715 Ga0070669_1000527152 330
40 3300005355 Ga0070671_100082278 Ga0070671_1000822782 330
41 3300005356 Ga0070674_100005222 Ga0070674_1000052224 330
42 3300005364 Ga0070673_100148537 Ga0070673_1001485372 330
43 3300005365 Ga0070688_100006042 Ga0070688_1000060425 330
44 3300005366 Ga0070659_100163309 Ga0070659_1001633091 330
45 3300005367 Ga0070667_100003168 Ga0070667_1000031684 330
46 3300005434 Ga0070709_10074023 Ga0070709_100740233 330
47 3300005437 Ga0070710_10001392 Ga0070710_100013923 330
48 3300005438 Ga0070701_10006493 Ga0070701_100064934 330
49 3300005439 Ga0070711_100008288 Ga0070711_1000082883 330
50 3300005441 Ga0070700_100005245 Ga0070700_1000052452 330
51 3300005444 Ga0070694_100004880 Ga0070694_1000048803 330
52 3300005456 Ga0070678_100002759 Ga0070678_1000027596 330
53 3300005457 Ga0070662_100026108 Ga0070662_1000261082 330
54 3300005459 Ga0068867_100005802 Ga0068867_1000058025 330
55 3300005539 Ga0068853_100010078 Ga0068853_1000100783 330
56 3300005544 Ga0070686_100022138 Ga0070686_1000221382 330
57 3300005545 Ga0070695_100021292 Ga0070695_1000212923 330
58 3300005547 Ga0070693_100010110 Ga0070693_1000101102 330
59 3300005549 Ga0070704_100000313 Ga0070704_1000003134 330
60 3300005578 Ga0068854_100001484 Ga0068854_10000148410 330
61 3300005617 Ga0068859_100004026 Ga0068859_10000402612 330
62 3300005719 Ga0068861_100001049 Ga0068861_10000104911 330
63 3300005842 Ga0068858_100014801 Ga0068858_1000148013 330
64 3300005843 Ga0068860_100002092 Ga0068860_10000209222 330
65 3300005844 Ga0068862_100003302 Ga0068862_1000033025 330
66 3300006163 Ga0070715_10000197 Ga0070715_100001974 330
67 3300006175 Ga0070712_100006916 Ga0070712_1000069163 330
68 3300006358 Ga0068871_100090829 Ga0068871_1000908293 330
69 3300006931 Ga0097620_100004026 Ga0097620_10000402612 330
70 3300009098 Ga0105245_10005751 Ga0105245_100057515 330
71 3300009101 Ga0105247_10003309 Ga0105247_100033096 330
72 3300009148 Ga0105243_10000779 Ga0105243_1000077912 330
73 3300009174 Ga0105241_10008273 Ga0105241_100082732 330
74 3300009176 Ga0105242_10000066 Ga0105242_100000665 330
75 3300009177 Ga0105248_10037978 Ga0105248_100379783 330
76 3300009545 Ga0105237_10131334 Ga0105237_101313343 330
77 3300009553 Ga0105249_10004766 Ga0105249_100047663 330
78 3300010375 Ga0105239_10015683 Ga0105239_100156835 330
79 3300013297 Ga0157378_10002159 Ga0157378_100021597 330
80 3300013306 Ga0163162_10014890 Ga0163162_100148903 330
81 3300013308 Ga0157375_10000268 Ga0157375_100002688 330
82 3300014326 Ga0157380_10000036 Ga0157380_1000003662 330
83 3300014745 Ga0157377_10031203 Ga0157377_100312031 330
84 3300014968 Ga0157379_10001562 Ga0157379_100015628 330
85 3300014969 Ga0157376_10065953 Ga0157376_100659534 330
86 3300017792 Ga0163161_10009914 Ga0163161_100099143 330
87 3300025899 Ga0207642_10004003 Ga0207642_100040032 330
88 3300025901 Ga0207688_10001014 Ga0207688_100010146 330
89 3300025904 Ga0207647_10041867 Ga0207647_100418672 330
90 3300025911 Ga0207654_10058692 Ga0207654_100586922 330
91 3300025915 Ga0207693_10000224 Ga0207693_1000022441 330
92 3300025916 Ga0207663_10006226 Ga0207663_100062263 330
93 3300025926 Ga0207659_10206546 Ga0207659_102065462 330
94 3300025927 Ga0207687_10008487 Ga0207687_100084872 330
95 3300025933 Ga0207706_10000288 Ga0207706_1000028834 330
96 3300025935 Ga0207709_10007903 Ga0207709_100079032 330
97 3300025936 Ga0207670_10059445 Ga0207670_100594452 330
98 3300025937 Ga0207669_10026418 Ga0207669_100264182 330
99 3300025938 Ga0207704_10010220 Ga0207704_100102203 330
100 3300025939 Ga0207665_10008988 Ga0207665_100089882 330
101 3300025941 Ga0207711_10031606 Ga0207711_100316062 330
102 3300025942 Ga0207689_10027054 Ga0207689_100270543 330
103 3300025972 Ga0207668_10006971 Ga0207668_100069717 330
104 3300026035 Ga0207703_10007155 Ga0207703_100071558 330
105 3300026075 Ga0207708_10003048 Ga0207708_1000304811 330
106 3300026089 Ga0207648_10001622 Ga0207648_100016226 330
107 3300026118 Ga0207675_100000324 Ga0207675_10000032415 330
108 3300026121 Ga0207683_10000077 Ga0207683_1000007770 330
109 3300028379 Ga0268266_10011847 Ga0268266_100118475 330
110 3300028380 Ga0268265_10008953 Ga0268265_100089533 330
111 3300028381 Ga0268264_10011619 Ga0268264_100116193 330
112 3300035112 Ga0373932_0057322 Ga0373932_0057322_111_1103 330
113 3300044712 Ga0453684_0360009 Ga0453684_0360009_290_1384 330
114 3300048903 Ga0496100_0069841 Ga0496100_0069841_74_1066 330
115 3300048905 Ga0496102_0000915 Ga0496102_0000915_4918_5910 330
116 3300048910 Ga0496107_0000854 Ga0496107_0000854_1114_2106 330
117 3300048917 Ga0496114_0001108 Ga0496114_0001108_18601_19593 330
118 3300048918 Ga0496115_0005192 Ga0496115_0005192_2295_3287 330
119 3300005327 Ga0070658_10006864 Ga0070658_100068643 331
120 3300005336 Ga0070680_100189573 Ga0070680_1001895731 331
121 3300005458 Ga0070681_10042415 Ga0070681_100424151 331
122 3300005563 Ga0068855_100005049 Ga0068855_1000050499 331
123 3300025909 Ga0207705_10003150 Ga0207705_100031509 331
124 3300025912 Ga0207707_10057685 Ga0207707_100576853 331
125 3300025949 Ga0207667_10073808 Ga0207667_100738083 331
126 3300003320 rootH2_10195207 rootH2_101952075 336
127 3300026067 Ga0207678_10146433 Ga0207678_101464331 336
128 3300025906 Ga0207699_10054060 Ga0207699_100540602 338
129 3300009545 Ga0105237_10253280 Ga0105237_102532802 340
130 3300025939 Ga0207665_10065209 Ga0207665_100652093 341
131 3300044765 Ga0466970_0021565 Ga0466970_0021565_1063_2124 341
132 3300044842 Ga0466957_0013117 Ga0466957_0013117_1537_2598 341
133 3300053136 Ga0500559_0035783 Ga0500559_0035783_234_1277 343
134 iso_pu_bacteria 2873314349 2873319488 343
135 3300005335 Ga0070666_10012330 Ga0070666_100123302 344
136 3300005356 Ga0070674_100196880 Ga0070674_1001968802 344
137 3300005367 Ga0070667_100033162 Ga0070667_1000331624 344
138 3300005434 Ga0070709_10225796 Ga0070709_102257961 344
139 3300005437 Ga0070710_10083407 Ga0070710_100834071 344
140 3300005439 Ga0070711_100028177 Ga0070711_1000281771 344
141 3300005440 Ga0070705_100108009 Ga0070705_1001080091 344
142 3300005455 Ga0070663_100054446 Ga0070663_1000544462 344
143 3300005456 Ga0070678_100222228 Ga0070678_1002222282 344
144 3300005539 Ga0068853_100120082 Ga0068853_1001200822 344
145 3300005548 Ga0070665_100037661 Ga0070665_1000376615 344
146 3300005549 Ga0070704_100028516 Ga0070704_1000285164 344
147 3300005578 Ga0068854_100002893 Ga0068854_1000028935 344
148 3300005615 Ga0070702_100187142 Ga0070702_1001871421 344
149 3300005616 Ga0068852_100015840 Ga0068852_1000158404 344
150 3300005718 Ga0068866_10056984 Ga0068866_100569843 344
151 3300005719 Ga0068861_100242406 Ga0068861_1002424062 344
152 3300005843 Ga0068860_100368896 Ga0068860_1003688962 344
153 3300005844 Ga0068862_100075250 Ga0068862_1000752502 344
154 3300006051 Ga0075364_10085463 Ga0075364_100854632 344
155 3300006173 Ga0070716_100040545 Ga0070716_1000405453 344
156 3300006175 Ga0070712_100013001 Ga0070712_1000130013 344
157 3300006186 Ga0075369_10019582 Ga0075369_100195823 344
158 3300006358 Ga0068871_100204345 Ga0068871_1002043452 344
159 3300006847 Ga0075431_100313091 Ga0075431_1003130912 344
160 3300006881 Ga0068865_100190268 Ga0068865_1001902682 344
161 3300007265 Ga0099794_10001021 Ga0099794_100010217 344
162 3300009093 Ga0105240_10004501 Ga0105240_100045014 344
163 3300009545 Ga0105237_10223042 Ga0105237_102230422 344
164 3300010375 Ga0105239_10020214 Ga0105239_100202143 344
165 3300010375 Ga0105239_10583957 Ga0105239_105839571 344
166 3300013306 Ga0163162_10075854 Ga0163162_100758543 344
167 3300013306 Ga0163162_10142805 Ga0163162_101428052 344
168 3300020069 Ga0197907_11018771 Ga0197907_110187711 344
169 3300025711 Ga0207696_1024521 Ga0207696_10245213 344
170 3300025898 Ga0207692_10025507 Ga0207692_100255071 344
171 3300025909 Ga0207705_10184033 Ga0207705_101840332 344
172 3300025911 Ga0207654_10011826 Ga0207654_100118262 344
173 3300025914 Ga0207671_10002910 Ga0207671_100029107 344
174 3300025915 Ga0207693_10007684 Ga0207693_100076842 344
175 3300025915 Ga0207693_10236766 Ga0207693_102367661 344
176 3300025924 Ga0207694_10001312 Ga0207694_1000131211 344
177 3300025938 Ga0207704_10013681 Ga0207704_100136812 344
178 3300025939 Ga0207665_10010453 Ga0207665_100104533 344
179 3300025981 Ga0207640_10004862 Ga0207640_100048625 344
180 3300025986 Ga0207658_10016993 Ga0207658_100169933 344
181 3300026067 Ga0207678_10014277 Ga0207678_100142777 344
182 3300026089 Ga0207648_10068522 Ga0207648_100685222 344
183 3300026118 Ga0207675_100140160 Ga0207675_1001401602 344
184 3300026121 Ga0207683_10040740 Ga0207683_100407403 344
185 3300031616 Ga0307508_10063119 Ga0307508_100631194 344
186 3300031727 Ga0316576_10004486 Ga0316576_100044865 344
187 3300031733 Ga0316577_10119780 Ga0316577_101197802 344
188 3300035692 Ga0373935_0114160 Ga0373935_0114160_640_1689 344
189 3300036647 Ga0316582_0016179 Ga0316582_0016179_1954_3003 344
190 3300041413 Ga0439465_0047262 Ga0439465_0047262_179_1213 344
191 3300042002 Ga0439442_017270 Ga0439442_017270_340_1374 344
192 3300046459 Ga0495629_0022019 Ga0495629_0022019_1639_2673 344
193 3300046461 Ga0495641_0050006 Ga0495641_0050006_809_1843 344
194 3300046462 Ga0495651_0007772 Ga0495651_0007772_2097_3161 344
195 3300046463 Ga0495653_0015204 Ga0495653_0015204_1615_2679 344
196 3300046473 Ga0495582_0138703 Ga0495582_0138703_285_1319 344
197 3300046477 Ga0495664_0235376 Ga0495664_0235376_19_1083 344
198 3300046517 Ga0495630_0020357 Ga0495630_0020357_2206_3270 344
199 3300046529 Ga0495652_0012110 Ga0495652_0012110_5045_6109 344
200 3300046533 Ga0495640_0004019 Ga0495640_0004019_7946_9010 344
201 3300046536 Ga0495587_0006340 Ga0495587_0006340_5039_6103 344
202 3300046559 Ga0495667_0016349 Ga0495667_0016349_2229_3293 344
203 3300046663 Ga0495635_0007371 Ga0495635_0007371_1620_2684 344
204 3300046663 Ga0495635_0142665 Ga0495635_0142665_488_1522 344
205 3300046675 Ga0495657_0011542 Ga0495657_0011542_1622_2686 344
206 3300046678 Ga0495599_0005251 Ga0495599_0005251_5045_6109 344
207 3300046679 Ga0495623_0005019 Ga0495623_0005019_2097_3161 344
208 3300046689 Ga0495613_0003801 Ga0495613_0003801_8571_9635 344
209 3300046809 Ga0495600_0004749 Ga0495600_0004749_2097_3161 344
210 3300047315 Ga0495581_0035263 Ga0495581_0035263_1422_2456 344
211 3300047317 Ga0495604_0023894 Ga0495604_0023894_2097_3161 344
212 3300047320 Ga0495672_0088365 Ga0495672_0088365_621_1655 344
213 3300047444 Ga0495675_0003362 Ga0495675_0003362_3527_4591 344
214 3300047471 Ga0495684_0005393 Ga0495684_0005393_6796_7860 344
215 3300047673 Ga0495593_0013924 Ga0495593_0013924_1641_2675 344
216 3300048088 Ga0495602_0010713 Ga0495602_0010713_3399_4463 344
217 3300048903 Ga0496100_0038245 Ga0496100_0038245_564_1598 344
218 3300048906 Ga0496103_0020319 Ga0496103_0020319_912_1946 344
219 3300048909 Ga0496106_0095081 Ga0496106_0095081_216_1250 344
220 3300048910 Ga0496107_0134032 Ga0496107_0134032_186_1220 344
221 3300048917 Ga0496114_0000045 Ga0496114_0000045_56002_57051 344
222 3300050490 nmdc:mga03n38_66081_c1 nmdc:mga03n38_66081_c1_276_1310 344
223 3300050507 nmdc:mga05p37_168234_c1 nmdc:mga05p37_168234_c1_658_1716 344
224 3300050510 nmdc:mga06r32_205740_c1 nmdc:mga06r32_205740_c1_640_1698 344
225 3300050516 nmdc:mga0sz30_17951_c1 nmdc:mga0sz30_17951_c1_1708_2742 344
226 3300050516 nmdc:mga0sz30_95696_c1 nmdc:mga0sz30_95696_c1_86_1120 344
227 3300053136 Ga0500559_0074466 Ga0500559_0074466_406_1452 344
228 iso_pu_bacteria 2862574272 2862581869 344
229 iso_pu_bacteria 3006393351 3006397985 344
230 3300044656 Ga0466969_0003976 Ga0466969_0003976_3792_4928 345
231 3300044658 Ga0466972_0033971 Ga0466972_0033971_564_1700 345
232 3300044683 Ga0466965_0000686 Ga0466965_0000686_9134_10270 345
233 3300044684 Ga0466966_0001411 Ga0466966_0001411_2366_3502 345
234 3300044693 Ga0466961_0001880 Ga0466961_0001880_6679_7815 345
235 3300044694 Ga0466963_0001442 Ga0466963_0001442_182_1318 345
236 3300044719 Ga0466971_0047062 Ga0466971_0047062_55_1191 345
237 3300044765 Ga0466970_0000235 Ga0466970_0000235_12097_13233 345
238 3300044842 Ga0466957_0044037 Ga0466957_0044037_55_1191 345
239 3300044901 Ga0466960_0017115 Ga0466960_0017115_642_1763 345
240 3300045049 Ga0466959_0000228 Ga0466959_0000228_13188_14324 345
241 3300045836 Ga0466958_0003793 Ga0466958_0003793_5240_6376 345
242 3300045976 Ga0466967_0035672 Ga0466967_0035672_2384_3520 345
243 3300053087 Ga0500643_000213 Ga0500643_000213_1828_2874 345
244 3300061719 Ga0466962_0014026 Ga0466962_0014026_1210_2346 345
245 iso_pu_bacteria 2891395885 2891400604 345
246 iso_pu_bacteria 2891554331 2891562294 345
247 3300005339 Ga0070660_100030184 Ga0070660_1000301842 346
248 3300005366 Ga0070659_100066313 Ga0070659_1000663134 346
249 3300005458 Ga0070681_10182905 Ga0070681_101829052 346
250 3300005539 Ga0068853_100102204 Ga0068853_1001022043 346
251 3300005548 Ga0070665_100198972 Ga0070665_1001989722 346
252 3300005614 Ga0068856_100035735 Ga0068856_1000357353 346
253 3300005614 Ga0068856_100039164 Ga0068856_1000391642 346
254 3300005937 Ga0081455_10011250 Ga0081455_100112505 346
255 3300006028 Ga0070717_10021403 Ga0070717_100214035 346
256 3300006175 Ga0070712_100162377 Ga0070712_1001623772 346
257 3300009551 Ga0105238_10188912 Ga0105238_101889121 346
258 3300013100 Ga0157373_10045936 Ga0157373_100459362 346
259 3300013105 Ga0157369_10022248 Ga0157369_100222487 346
260 3300013105 Ga0157369_10077529 Ga0157369_100775294 346
261 3300013296 Ga0157374_10010125 Ga0157374_100101257 346
262 3300013296 Ga0157374_10087228 Ga0157374_100872282 346
263 3300013307 Ga0157372_10123852 Ga0157372_101238521 346
264 3300014969 Ga0157376_10088990 Ga0157376_100889902 346
265 3300021361 Ga0213872_10013785 Ga0213872_100137852 346
266 3300021377 Ga0213874_10015250 Ga0213874_100152502 346
267 3300021377 Ga0213874_10018415 Ga0213874_100184153 346
268 3300021384 Ga0213876_10013131 Ga0213876_100131312 346
269 3300021384 Ga0213876_10092656 Ga0213876_100926562 346
270 3300021388 Ga0213875_10000575 Ga0213875_1000057511 346
271 3300021388 Ga0213875_10014462 Ga0213875_100144622 346
272 3300021388 Ga0213875_10042447 Ga0213875_100424472 346
273 3300025915 Ga0207693_10170608 Ga0207693_101706082 346
274 3300026041 Ga0207639_10083156 Ga0207639_100831562 346
275 3300026078 Ga0207702_10026632 Ga0207702_100266324 346
276 3300026078 Ga0207702_10050180 Ga0207702_100501802 346
277 3300028800 Ga0265338_10001088 Ga0265338_1000108816 346
278 3300031249 Ga0265339_10003630 Ga0265339_100036303 346
279 3300031711 Ga0265314_10132941 Ga0265314_101329412 346
280 3300037853 Ga0436364_0934343 Ga0436364_0934343_59_1108 346
281 3300037853 Ga0436364_1008502 Ga0436364_1008502_53315_54364 346
282 3300037853 Ga0436364_1345478 Ga0436364_1345478_3258_4307 346
283 3300039437 Ga0436365_0588267 Ga0436365_0588267_470_1519 346
284 3300039447 Ga0436361_0474393 Ga0436361_0474393_4445_5494 346
285 3300039450 Ga0436363_0010176 Ga0436363_0010176_939_1988 346
286 3300044684 Ga0466966_0075782 Ga0466966_0075782_646_1695 346
287 3300048915 Ga0496112_0012218 Ga0496112_0012218_4567_5616 346
288 3300048918 Ga0496115_0008253 Ga0496115_0008253_3776_4825 346
289 iso_pu_bacteria 2808606359 2808842749 346
290 iso_pu_bacteria 2856741275 2856745442 346
291 iso_pu_bacteria 2856741275 2856747955 346
292 iso_pu_bacteria 2891562705 2891566429 346
293 iso_pu_bacteria 2891562705 2891569680 346
294 iso_pu_bacteria 2912757875 2912758362 346
295 iso_pu_bacteria 2997451912 2997452291 346
296 3300006880 Ga0075429_100024137 Ga0075429_1000241372 347
297 3300009147 Ga0114129_10054328 Ga0114129_100543287 347
298 3300039437 Ga0436365_0464118 Ga0436365_0464118_1922_2965 347
299 3300039450 Ga0436363_0360664 Ga0436363_0360664_1773_2876 347
300 3300045836 Ga0466958_0036071 Ga0466958_0036071_693_1781 347
301 3300046462 Ga0495651_0002255 Ga0495651_0002255_7718_8785 347
302 3300046492 Ga0495585_0038486 Ga0495585_0038486_251_1303 347
303 3300046499 Ga0495594_0079672 Ga0495594_0079672_175_1227 347
304 3300046516 Ga0495628_0010353 Ga0495628_0010353_4262_5329 347
305 3300046533 Ga0495640_0065115 Ga0495640_0065115_341_1393 347
306 3300046543 Ga0495645_0054714 Ga0495645_0054714_317_1384 347
307 3300046809 Ga0495600_0092713 Ga0495600_0092713_883_1950 347
308 3300047317 Ga0495604_0010657 Ga0495604_0010657_107_1174 347
309 3300049581 Ga0501047_0217158 Ga0501047_0217158_597_1649 347
310 3300050507 nmdc:mga05p37_91320_c1 nmdc:mga05p37_91320_c1_1760_2818 347
311 3300050510 nmdc:mga06r32_281962_c1 nmdc:mga06r32_281962_c1_301_1350 347
312 iso_pu_bacteria 2554235005 2554261079 347
313 iso_pu_bacteria 2818991472 2819743668 347
314 iso_pu_bacteria 2995463766 2995466437 347
315 3300009011 Ga0105251_10054305 Ga0105251_100543052 348
316 3300046455 Ga0495603_0000765 Ga0495603_0000765_12729_13787 348
317 3300046455 Ga0495603_0003497 Ga0495603_0003497_123_1181 348
318 3300046455 Ga0495603_0012031 Ga0495603_0012031_1866_2924 348
319 3300046459 Ga0495629_0004675 Ga0495629_0004675_5801_6859 348
320 3300046459 Ga0495629_0056176 Ga0495629_0056176_430_1488 348
321 3300046476 Ga0495662_0009605 Ga0495662_0009605_1646_2704 348
322 3300046476 Ga0495662_0018701 Ga0495662_0018701_1072_2130 348
323 3300046499 Ga0495594_0084619 Ga0495594_0084619_264_1322 348
324 3300046674 Ga0495588_0038616 Ga0495588_0038616_744_1802 348
325 3300046675 Ga0495657_0002058 Ga0495657_0002058_6700_7758 348
326 3300046689 Ga0495613_0004186 Ga0495613_0004186_3230_4288 348
327 3300046689 Ga0495613_0009210 Ga0495613_0009210_4925_5983 348
328 3300046691 Ga0495670_0138863 Ga0495670_0138863_166_1224 348
329 3300046794 Ga0495589_0020033 Ga0495589_0020033_1174_2232 348
330 3300047315 Ga0495581_0025921 Ga0495581_0025921_1232_2290 348
331 3300047318 Ga0495636_0011349 Ga0495636_0011349_2282_3340 348
332 3300047321 Ga0495676_0028092 Ga0495676_0028092_558_1616 348
333 3300047321 Ga0495676_0057414 Ga0495676_0057414_1702_2760 348
334 3300047444 Ga0495675_0066185 Ga0495675_0066185_1078_2136 348
335 3300048911 Ga0496108_0045273 Ga0496108_0045273_1726_2784 348
336 3300048912 Ga0496109_0013758 Ga0496109_0013758_4218_5276 348
337 3300049581 Ga0501047_0266952 Ga0501047_0266952_137_1195 348
338 3300053140 Ga0500573_0012180 Ga0500573_0012180_1229_2287 348
339 3300046454 Ga0495592_0066581 Ga0495592_0066581_238_1395 349
340 3300028794 Ga0307515_10023269 Ga0307515_1002326910 350
341 3300030522 Ga0307512_10016297 Ga0307512_100162976 350
342 3300031456 Ga0307513_10032914 Ga0307513_100329142 350
343 3300031456 Ga0307513_10074084 Ga0307513_100740844 350
344 3300031649 Ga0307514_10107836 Ga0307514_101078362 350
345 3300046452 Ga0495617_008207 Ga0495617_008207_196_1263 350
346 3300046454 Ga0495592_0001429 Ga0495592_0001429_4497_5561 350
347 3300046454 Ga0495592_0164446 Ga0495592_0164446_84_1151 350
348 3300046459 Ga0495629_0005953 Ga0495629_0005953_7180_8247 350
349 3300046459 Ga0495629_0078102 Ga0495629_0078102_195_1352 350
350 3300046462 Ga0495651_0009658 Ga0495651_0009658_5730_6797 350
351 3300046462 Ga0495651_0045916 Ga0495651_0045916_1786_2850 350
352 3300046463 Ga0495653_0152298 Ga0495653_0152298_31_1095 350
353 3300046476 Ga0495662_0004034 Ga0495662_0004034_981_2051 350
354 3300046476 Ga0495662_0010308 Ga0495662_0010308_1462_2526 350
355 3300046477 Ga0495664_0003276 Ga0495664_0003276_2054_3118 350
356 3300046477 Ga0495664_0009224 Ga0495664_0009224_3390_4457 350
357 3300046492 Ga0495585_0001761 Ga0495585_0001761_9955_11022 350
358 3300046501 Ga0495607_0064977 Ga0495607_0064977_104_1171 350
359 3300046506 Ga0495583_0020098 Ga0495583_0020098_1227_2294 350
360 3300046516 Ga0495628_0059510 Ga0495628_0059510_843_2000 350
361 3300046517 Ga0495630_0043526 Ga0495630_0043526_505_1569 350
362 3300046529 Ga0495652_0038924 Ga0495652_0038924_1786_2850 350
363 3300046533 Ga0495640_0001256 Ga0495640_0001256_2979_4136 350
364 3300046533 Ga0495640_0010089 Ga0495640_0010089_4930_5994 350
365 3300046536 Ga0495587_0001809 Ga0495587_0001809_9704_10771 350
366 3300046536 Ga0495587_0010691 Ga0495587_0010691_1786_2850 350
367 3300046543 Ga0495645_0010749 Ga0495645_0010749_1472_2602 350
368 3300046559 Ga0495667_0034528 Ga0495667_0034528_1786_2850 350
369 3300046642 Ga0495634_0000535 Ga0495634_0000535_24709_25776 350
370 3300046642 Ga0495634_0035550 Ga0495634_0035550_663_1727 350
371 3300046642 Ga0495634_0086632 Ga0495634_0086632_39_1106 350
372 3300046648 Ga0495611_0003683 Ga0495611_0003683_4956_6023 350
373 3300046663 Ga0495635_0001798 Ga0495635_0001798_7391_8458 350
374 3300046674 Ga0495588_0023666 Ga0495588_0023666_248_1309 350
375 3300046675 Ga0495657_0002019 Ga0495657_0002019_8851_9918 350
376 3300046675 Ga0495657_0008280 Ga0495657_0008280_4395_5462 350
377 3300046675 Ga0495657_0032941 Ga0495657_0032941_1469_2626 350
378 3300046680 Ga0495646_0001682 Ga0495646_0001682_7424_8491 350
379 3300046680 Ga0495646_0004122 Ga0495646_0004122_7025_8089 350
380 3300046683 Ga0495658_0040562 Ga0495658_0040562_605_1672 350
381 3300046689 Ga0495613_0003158 Ga0495613_0003158_4532_5599 350
382 3300046689 Ga0495613_0004495 Ga0495613_0004495_2831_3988 350
383 3300046689 Ga0495613_0008195 Ga0495613_0008195_1494_2561 350
384 3300046690 Ga0495624_0068387 Ga0495624_0068387_93_1250 350
385 3300046810 Ga0495660_0003633 Ga0495660_0003633_4458_5525 350
386 3300047315 Ga0495581_0006822 Ga0495581_0006822_1398_2465 350
387 3300047317 Ga0495604_0000284 Ga0495604_0000284_8832_9899 350
388 3300047317 Ga0495604_0001320 Ga0495604_0001320_11202_12266 350
389 3300047317 Ga0495604_0055515 Ga0495604_0055515_1378_2535 350
390 3300047319 Ga0495674_0049107 Ga0495674_0049107_905_1969 350
391 3300047321 Ga0495676_0049517 Ga0495676_0049517_980_2137 350
392 3300047323 Ga0495683_0001156 Ga0495683_0001156_6362_7429 350
393 3300047443 Ga0495687_002795 Ga0495687_002795_11174_12241 350
394 3300047444 Ga0495675_0015699 Ga0495675_0015699_712_1842 350
395 3300047444 Ga0495675_0024034 Ga0495675_0024034_1033_2097 350
396 3300047447 Ga0495685_035358 Ga0495685_035358_205_1266 350
397 3300047471 Ga0495684_0045437 Ga0495684_0045437_1765_2829 350
398 3300047673 Ga0495593_0005510 Ga0495593_0005510_1205_2272 350
399 3300048089 Ga0495614_0000601 Ga0495614_0000601_7389_8456 350
400 3300048089 Ga0495614_0091970 Ga0495614_0091970_129_1196 350
401 3300048912 Ga0496109_0388348 Ga0496109_0388348_110_1174 350
402 3300048916 Ga0496113_0057270 Ga0496113_0057270_490_1554 350
403 3300048922 Ga0496119_0054548 Ga0496119_0054548_1243_2304 350
404 3300049568 Ga0501031_0003559 Ga0501031_0003559_5792_6928 350
405 3300049569 Ga0501032_0004950 Ga0501032_0004950_3082_4218 350
406 3300049571 Ga0501034_0009889 Ga0501034_0009889_5792_6928 350
407 3300049573 Ga0501037_0013608 Ga0501037_0013608_1579_2715 350
408 3300049574 Ga0501038_0136685 Ga0501038_0136685_510_1646 350
409 3300049575 Ga0501039_0020591 Ga0501039_0020591_1372_2508 350
410 3300049577 Ga0501041_0015104 Ga0501041_0015104_3327_4463 350
411 3300049580 Ga0501046_0024825 Ga0501046_0024825_3080_4216 350
412 3300049581 Ga0501047_0021818 Ga0501047_0021818_2537_3673 350
413 3300049582 Ga0501048_0131548 Ga0501048_0131548_65_1201 350
414 3300049583 Ga0501067_0015476 Ga0501067_0015476_1851_2987 350
415 3300049584 Ga0501068_0012777 Ga0501068_0012777_317_1453 350
416 3300049585 Ga0501069_0004427 Ga0501069_0004427_3766_4902 350
417 3300049587 Ga0501071_0010148 Ga0501071_0010148_1815_2951 350
418 3300049588 Ga0501072_0004542 Ga0501072_0004542_3377_4513 350
419 3300049589 Ga0501073_0018809 Ga0501073_0018809_3098_4234 350
420 3300049593 Ga0501077_0026031 Ga0501077_0026031_971_2107 350
421 3300049741 Ga0501079_0025517 Ga0501079_0025517_60_1196 350
422 3300049744 Ga0501083_0008871 Ga0501083_0008871_5914_7050 350
423 3300049823 Ga0501044_0012714 Ga0501044_0012714_5792_6928 350
424 3300053077 Ga0495601_0121709 Ga0495601_0121709_532_1596 350
425 3300053095 Ga0500640_003785 Ga0500640_003785_2598_3665 350
426 3300053101 Ga0500553_078154 Ga0500553_078154_167_1234 350
427 iso_pu_bacteria 8055172936 8055174599 350
428 3300005458 Ga0070681_10082039 Ga0070681_100820393 351
429 3300009147 Ga0114129_10130049 Ga0114129_101300492 351
430 3300037418 Ga0395900_0098024 Ga0395900_0098024_1681_2745 351
431 3300037466 Ga0395898_0136673 Ga0395898_0136673_206_1270 351
432 3300037471 Ga0395905_0360754 Ga0395905_0360754_167_1231 351
433 iso_pu_bacteria 2738541274 2738706982 351
434 iso_pu_bacteria 2738543028 2739333686 351
435 iso_pu_bacteria 2902799365 2902800534 351
436 iso_pu_bacteria 2902810491 2902814124 351
437 iso_pu_bacteria 3006493962 3006497250 351
438 3300005435 Ga0070714_100188451 Ga0070714_1001884511 352
439 3300006051 Ga0075364_10074333 Ga0075364_100743332 352
440 3300006186 Ga0075369_10000432 Ga0075369_1000043212 352
441 3300006186 Ga0075369_10056568 Ga0075369_100565682 352
442 3300041410 Ga0439461_0000574 Ga0439461_0000574_4145_5233 352
443 3300041411 Ga0439466_0002159 Ga0439466_0002159_237_1325 352
444 3300041997 Ga0439431_0000447 Ga0439431_0000447_5945_7033 352
445 3300042435 Ga0439434_0003234 Ga0439434_0003234_3464_4552 352
446 3300044683 Ga0466965_0006756 Ga0466965_0006756_1580_2668 352
447 3300044683 Ga0466965_0011035 Ga0466965_0011035_1465_2553 352
448 3300044735 Ga0466968_0007037 Ga0466968_0007037_3152_4240 352
449 3300044765 Ga0466970_0018544 Ga0466970_0018544_611_1699 352
450 3300044842 Ga0466957_0011701 Ga0466957_0011701_353_1441 352
451 3300044901 Ga0466960_0000043 Ga0466960_0000043_5781_6869 352
452 3300044901 Ga0466960_0009641 Ga0466960_0009641_2300_3388 352
453 3300045049 Ga0466959_0041991 Ga0466959_0041991_1605_2693 352
454 3300045836 Ga0466958_0200396 Ga0466958_0200396_41_1129 352
455 3300045976 Ga0466967_0102573 Ga0466967_0102573_1293_2381 352
456 3300046460 Ga0495638_0172521 Ga0495638_0172521_34_1146 352
457 3300048904 Ga0496101_0038130 Ga0496101_0038130_258_1346 352
458 3300048915 Ga0496112_0021144 Ga0496112_0021144_48_1136 352
459 3300048916 Ga0496113_0195037 Ga0496113_0195037_234_1322 352
460 3300048924 Ga0496121_0140458 Ga0496121_0140458_342_1409 352
461 3300048926 Ga0496123_0056766 Ga0496123_0056766_1260_2348 352
462 3300048929 Ga0496126_0002219 Ga0496126_0002219_1226_2314 352
463 3300048929 Ga0496126_0079850 Ga0496126_0079850_533_1600 352
464 3300049571 Ga0501034_0030998 Ga0501034_0030998_870_1958 352
465 3300049572 Ga0501036_0029781 Ga0501036_0029781_3459_4547 352
466 3300049574 Ga0501038_0040632 Ga0501038_0040632_1510_2598 352
467 3300049575 Ga0501039_0000835 Ga0501039_0000835_2950_4038 352
468 3300049579 Ga0501043_0016855 Ga0501043_0016855_3129_4217 352
469 3300049586 Ga0501070_0008673 Ga0501070_0008673_2955_4043 352
470 3300049589 Ga0501073_0016582 Ga0501073_0016582_1109_2197 352
471 3300049823 Ga0501044_0005313 Ga0501044_0005313_10110_11198 352
472 3300050491 nmdc:mga00v17_48709_c1 nmdc:mga00v17_48709_c1_1271_2359 352
473 3300050491 nmdc:mga00v17_9568_c1 nmdc:mga00v17_9568_c1_127_1194 352
474 3300050516 nmdc:mga0sz30_1591_c2 nmdc:mga0sz30_1591_c2_2205_3278 352
475 3300050516 nmdc:mga0sz30_59301_c1 nmdc:mga0sz30_59301_c1_234_1301 352
476 3300053087 Ga0500643_008952 Ga0500643_008952_731_1843 352
477 3300053131 Ga0500652_026557 Ga0500652_026557_505_1617 352
478 3300053158 Ga0500627_0004080 Ga0500627_0004080_2966_4078 352
479 3300053730 Ga0500645_000188 Ga0500645_000188_11425_12492 352
480 3300053730 Ga0500645_027614 Ga0500645_027614_431_1498 352
481 iso_pu_bacteria 2643221715 2644639003 352
482 3300001977 JGI24746J21847_1002411 JGI24746J21847_10024112 353
483 3300001989 JGI24739J22299_10013268 JGI24739J22299_100132682 353
484 3300001990 JGI24737J22298_10007391 JGI24737J22298_100073912 353
485 3300001991 JGI24743J22301_10001106 JGI24743J22301_100011062 353
486 3300002070 JGI24750J21931_1001541 JGI24750J21931_10015412 353
487 3300002077 JGI24744J21845_10001375 JGI24744J21845_100013753 353
488 3300002239 JGI24034J26672_10001541 JGI24034J26672_100015413 353
489 3300005329 Ga0070683_100126221 Ga0070683_1001262211 353
490 3300005336 Ga0070680_100346219 Ga0070680_1003462191 353
491 3300005341 Ga0070691_10139672 Ga0070691_101396721 353
492 3300005347 Ga0070668_100156530 Ga0070668_1001565302 353
493 3300005354 Ga0070675_100050835 Ga0070675_1000508353 353
494 3300005356 Ga0070674_100008711 Ga0070674_1000087116 353
495 3300005364 Ga0070673_100192256 Ga0070673_1001922562 353
496 3300005365 Ga0070688_100006500 Ga0070688_1000065006 353
497 3300005367 Ga0070667_100438597 Ga0070667_1004385971 353
498 3300005435 Ga0070714_100049241 Ga0070714_1000492412 353
499 3300005441 Ga0070700_100033608 Ga0070700_1000336083 353
500 3300005456 Ga0070678_100143932 Ga0070678_1001439322 353
501 3300005535 Ga0070684_100167019 Ga0070684_1001670192 353
502 3300005539 Ga0068853_100272314 Ga0068853_1002723142 353
503 3300005543 Ga0070672_100079954 Ga0070672_1000799541 353
504 3300005547 Ga0070693_100025397 Ga0070693_1000253972 353
505 3300005549 Ga0070704_100140074 Ga0070704_1001400742 353
506 3300005563 Ga0068855_100308153 Ga0068855_1003081532 353
507 3300005563 Ga0068855_100610503 Ga0068855_1006105031 353
508 3300005614 Ga0068856_100363551 Ga0068856_1003635512 353
509 3300005616 Ga0068852_100085631 Ga0068852_1000856312 353
510 3300005617 Ga0068859_100130908 Ga0068859_1001309082 353
511 3300005618 Ga0068864_100329234 Ga0068864_1003292342 353
512 3300005719 Ga0068861_100052638 Ga0068861_1000526381 353
513 3300005719 Ga0068861_100441335 Ga0068861_1004413351 353
514 3300005841 Ga0068863_100021810 Ga0068863_1000218103 353
515 3300005842 Ga0068858_100162416 Ga0068858_1001624162 353
516 3300005842 Ga0068858_100437377 Ga0068858_1004373772 353
517 3300005937 Ga0081455_10055362 Ga0081455_100553622 353
518 3300006038 Ga0075365_10082714 Ga0075365_100827142 353
519 3300006038 Ga0075365_10170482 Ga0075365_101704822 353
520 3300006048 Ga0075363_100007673 Ga0075363_1000076732 353
521 3300006048 Ga0075363_100040039 Ga0075363_1000400392 353
522 3300006051 Ga0075364_10001908 Ga0075364_100019082 353
523 3300006051 Ga0075364_10004603 Ga0075364_100046032 353
524 3300006175 Ga0070712_100124993 Ga0070712_1001249932 353
525 3300006177 Ga0075362_10063002 Ga0075362_100630022 353
526 3300006178 Ga0075367_10023412 Ga0075367_100234123 353
527 3300006186 Ga0075369_10012593 Ga0075369_100125932 353
528 3300006186 Ga0075369_10071518 Ga0075369_100715182 353
529 3300006237 Ga0097621_100029904 Ga0097621_1000299042 353
530 3300006353 Ga0075370_10048108 Ga0075370_100481082 353
531 3300006846 Ga0075430_100224330 Ga0075430_1002243301 353
532 3300006847 Ga0075431_100056504 Ga0075431_1000565043 353
533 3300006881 Ga0068865_100104823 Ga0068865_1001048233 353
534 3300006931 Ga0097620_100130913 Ga0097620_1001309132 353
535 3300009092 Ga0105250_10007891 Ga0105250_100078913 353
536 3300009098 Ga0105245_10079624 Ga0105245_100796243 353
537 3300009147 Ga0114129_10022999 Ga0114129_100229996 353
538 3300009148 Ga0105243_10203574 Ga0105243_102035742 353
539 3300009174 Ga0105241_10424446 Ga0105241_104244461 353
540 3300009545 Ga0105237_10059499 Ga0105237_100594992 353
541 3300009553 Ga0105249_10050690 Ga0105249_100506902 353
542 3300009553 Ga0105249_10486663 Ga0105249_104866632 353
543 3300010375 Ga0105239_10290580 Ga0105239_102905801 353
544 3300011119 Ga0105246_10135595 Ga0105246_101355953 353
545 3300013105 Ga0157369_10065414 Ga0157369_100654143 353
546 3300013296 Ga0157374_10028848 Ga0157374_100288483 353
547 3300013306 Ga0163162_10169078 Ga0163162_101690782 353
548 3300013306 Ga0163162_10204831 Ga0163162_102048312 353
549 3300013306 Ga0163162_10366505 Ga0163162_103665052 353
550 3300013308 Ga0157375_10153402 Ga0157375_101534022 353
551 3300014325 Ga0163163_10010671 Ga0163163_1001067110 353
552 3300014745 Ga0157377_10034140 Ga0157377_100341403 353
553 3300014745 Ga0157377_10115503 Ga0157377_101155032 353
554 3300014969 Ga0157376_10325101 Ga0157376_103251012 353
555 3300021384 Ga0213876_10066336 Ga0213876_100663361 353
556 3300021388 Ga0213875_10009380 Ga0213875_100093803 353
557 3300025899 Ga0207642_10117544 Ga0207642_101175442 353
558 3300025900 Ga0207710_10001082 Ga0207710_1000108210 353
559 3300025901 Ga0207688_10007147 Ga0207688_100071474 353
560 3300025904 Ga0207647_10011346 Ga0207647_100113463 353
561 3300025904 Ga0207647_10131326 Ga0207647_101313262 353
562 3300025907 Ga0207645_10009109 Ga0207645_100091094 353
563 3300025911 Ga0207654_10069188 Ga0207654_100691883 353
564 3300025915 Ga0207693_10010959 Ga0207693_100109592 353
565 3300025919 Ga0207657_10018386 Ga0207657_100183862 353
566 3300025923 Ga0207681_10179757 Ga0207681_101797572 353
567 3300025926 Ga0207659_10200287 Ga0207659_102002872 353
568 3300025927 Ga0207687_10000594 Ga0207687_100005943 353
569 3300025927 Ga0207687_10047832 Ga0207687_100478323 353
570 3300025929 Ga0207664_10079939 Ga0207664_100799392 353
571 3300025931 Ga0207644_10084306 Ga0207644_100843062 353
572 3300025932 Ga0207690_10226193 Ga0207690_102261932 353
573 3300025934 Ga0207686_10003068 Ga0207686_100030687 353
574 3300025937 Ga0207669_10000196 Ga0207669_1000019615 353
575 3300025938 Ga0207704_10001017 Ga0207704_1000101710 353
576 3300025938 Ga0207704_10018203 Ga0207704_100182032 353
577 3300025940 Ga0207691_10054663 Ga0207691_100546632 353
578 3300025940 Ga0207691_10205210 Ga0207691_102052101 353
579 3300025949 Ga0207667_10285162 Ga0207667_102851622 353
580 3300025961 Ga0207712_10070324 Ga0207712_100703243 353
581 3300025961 Ga0207712_10141600 Ga0207712_101416002 353
582 3300025972 Ga0207668_10000708 Ga0207668_100007081 353
583 3300025972 Ga0207668_10237081 Ga0207668_102370812 353
584 3300025981 Ga0207640_10049193 Ga0207640_100491933 353
585 3300026023 Ga0207677_10038457 Ga0207677_100384572 353
586 3300026035 Ga0207703_10016663 Ga0207703_100166633 353
587 3300026035 Ga0207703_10037293 Ga0207703_100372932 353
588 3300026067 Ga0207678_10018104 Ga0207678_100181042 353
589 3300026075 Ga0207708_10000667 Ga0207708_1000066712 353
590 3300026088 Ga0207641_10133458 Ga0207641_101334582 353
591 3300026089 Ga0207648_10475692 Ga0207648_104756921 353
592 3300026095 Ga0207676_10249819 Ga0207676_102498191 353
593 3300026118 Ga0207675_100001148 Ga0207675_1000011482 353
594 3300026118 Ga0207675_100071618 Ga0207675_1000716182 353
595 3300026121 Ga0207683_10002485 Ga0207683_1000248516 353
596 3300026121 Ga0207683_10262030 Ga0207683_102620302 353
597 3300027907 Ga0207428_10199168 Ga0207428_101991682 353
598 3300028379 Ga0268266_10048719 Ga0268266_100487192 353
599 3300028381 Ga0268264_10001281 Ga0268264_100012812 353
600 3300034817 Ga0373948_0009169 Ga0373948_0009169_606_1667 353
601 3300035090 Ga0373949_0006400 Ga0373949_0006400_1129_2190 353
602 3300035091 Ga0373951_0007158 Ga0373951_0007158_140_1201 353
603 3300035207 Ga0373942_0012269 Ga0373942_0012269_804_1865 353
604 3300036712 Ga0316584_0166417 Ga0316584_0166417_237_1307 353
605 3300037853 Ga0436364_0271209 Ga0436364_0271209_1240_2301 353
606 3300039437 Ga0436365_0187823 Ga0436365_0187823_4275_5336 353
607 3300039437 Ga0436365_0810711 Ga0436365_0810711_34846_35907 353
608 3300039437 Ga0436365_1409440 Ga0436365_1409440_1108_2169 353
609 3300042435 Ga0439434_0029280 Ga0439434_0029280_39_1100 353
610 3300044658 Ga0466972_0035646 Ga0466972_0035646_447_1508 353
611 3300044694 Ga0466963_0045955 Ga0466963_0045955_186_1247 353
612 3300044694 Ga0466963_0254026 Ga0466963_0254026_44_1105 353
613 3300044842 Ga0466957_0018278 Ga0466957_0018278_2997_4058 353
614 3300044901 Ga0466960_0000893 Ga0466960_0000893_4046_5107 353
615 3300045836 Ga0466958_0027616 Ga0466958_0027616_2143_3270 353
616 3300045836 Ga0466958_0031525 Ga0466958_0031525_763_1824 353
617 3300045976 Ga0466967_0001278 Ga0466967_0001278_7869_8930 353
618 3300045976 Ga0466967_0078198 Ga0466967_0078198_1726_2790 353
619 3300045976 Ga0466967_0078503 Ga0466967_0078503_1670_2755 353
620 3300045976 Ga0466967_0081226 Ga0466967_0081226_640_1701 353
621 3300045976 Ga0466967_0194891 Ga0466967_0194891_105_1172 353
622 3300046461 Ga0495641_0037619 Ga0495641_0037619_197_1267 353
623 3300046473 Ga0495582_0059540 Ga0495582_0059540_518_1588 353
624 3300046531 Ga0495665_0082224 Ga0495665_0082224_490_1560 353
625 3300047315 Ga0495581_0070913 Ga0495581_0070913_753_1823 353
626 3300047319 Ga0495674_0021560 Ga0495674_0021560_231_1301 353
627 3300047321 Ga0495676_0040198 Ga0495676_0040198_2730_3800 353
628 3300047673 Ga0495593_0031540 Ga0495593_0031540_345_1415 353
629 3300048903 Ga0496100_0056016 Ga0496100_0056016_1383_2444 353
630 3300048903 Ga0496100_0100125 Ga0496100_0100125_607_1677 353
631 3300048904 Ga0496101_0006148 Ga0496101_0006148_6022_7083 353
632 3300048904 Ga0496101_0235950 Ga0496101_0235950_64_1125 353
633 3300048905 Ga0496102_0002940 Ga0496102_0002940_3888_4949 353
634 3300048905 Ga0496102_0014909 Ga0496102_0014909_1601_2662 353
635 3300048905 Ga0496102_0067515 Ga0496102_0067515_880_1941 353
636 3300048905 Ga0496102_0150096 Ga0496102_0150096_1048_2109 353
637 3300048906 Ga0496103_0008168 Ga0496103_0008168_452_1513 353
638 3300048906 Ga0496103_0012660 Ga0496103_0012660_2705_3766 353
639 3300048907 Ga0496104_0051861 Ga0496104_0051861_1283_2344 353
640 3300048908 Ga0496105_0021530 Ga0496105_0021530_4083_5144 353
641 3300048909 Ga0496106_0001251 Ga0496106_0001251_6163_7224 353
642 3300048909 Ga0496106_0133394 Ga0496106_0133394_584_1666 353
643 3300048910 Ga0496107_0064070 Ga0496107_0064070_201_1262 353
644 3300048911 Ga0496108_0000375 Ga0496108_0000375_7380_8441 353
645 3300048911 Ga0496108_0048600 Ga0496108_0048600_912_1973 353
646 3300048911 Ga0496108_0093243 Ga0496108_0093243_1332_2414 353
647 3300048912 Ga0496109_0011398 Ga0496109_0011398_2129_3190 353
648 3300048912 Ga0496109_0174396 Ga0496109_0174396_218_1300 353
649 3300048913 Ga0496110_0003151 Ga0496110_0003151_10266_11327 353
650 3300048914 Ga0496111_0064454 Ga0496111_0064454_485_1546 353
651 3300048914 Ga0496111_0124659 Ga0496111_0124659_447_1508 353
652 3300048915 Ga0496112_0007519 Ga0496112_0007519_7287_8348 353
653 3300048915 Ga0496112_0391299 Ga0496112_0391299_134_1195 353
654 3300048915 Ga0496112_0409967 Ga0496112_0409967_202_1272 353
655 3300048917 Ga0496114_0000766 Ga0496114_0000766_22800_23861 353
656 3300048918 Ga0496115_0011304 Ga0496115_0011304_5386_6447 353
657 3300048921 Ga0496118_0003869 Ga0496118_0003869_188_1249 353
658 3300048921 Ga0496118_0204330 Ga0496118_0204330_89_1150 353
659 3300049571 Ga0501034_0011034 Ga0501034_0011034_1629_2690 353
660 3300049571 Ga0501034_0067347 Ga0501034_0067347_2212_3273 353
661 3300049572 Ga0501036_0199188 Ga0501036_0199188_552_1613 353
662 3300049573 Ga0501037_0064465 Ga0501037_0064465_1010_2071 353
663 3300049580 Ga0501046_0009457 Ga0501046_0009457_6291_7352 353
664 3300049581 Ga0501047_0071460 Ga0501047_0071460_442_1503 353
665 3300049586 Ga0501070_0002995 Ga0501070_0002995_3501_4562 353
666 3300049586 Ga0501070_0203212 Ga0501070_0203212_50_1129 353
667 3300049589 Ga0501073_0157998 Ga0501073_0157998_275_1354 353
668 3300049822 Ga0501035_0150679 Ga0501035_0150679_393_1454 353
669 3300050490 nmdc:mga03n38_50100_c1 nmdc:mga03n38_50100_c1_538_1599 353
670 3300050491 nmdc:mga00v17_24328_c1 nmdc:mga00v17_24328_c1_1379_2440 353
671 3300050492 nmdc:mga0yw44_164926_c1 nmdc:mga0yw44_164926_c1_364_1434 353
672 3300050492 nmdc:mga0yw44_45819_c1 nmdc:mga0yw44_45819_c1_1495_2556 353
673 3300050496 nmdc:mga07m45_32573_c1 nmdc:mga07m45_32573_c1_1303_2364 353
674 3300050510 nmdc:mga06r32_9568_c1 nmdc:mga06r32_9568_c1_6227_7288 353
675 3300050516 nmdc:mga0sz30_95504_c1 nmdc:mga0sz30_95504_c1_58_1119 353
676 3300061719 Ga0466962_0066127 Ga0466962_0066127_113_1174 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

305

397

0.94

PF08392

FAE1_CUT1_RppA

FAE1/Type III polyketide synthase-like protein

73

220

0.93

PF00195

Chal_sti_synt_N

Chalcone and stilbene synthases, N-terminal domain

4

217

0.89

PF02797

Chal_sti_synt_C

Chalcone and stilbene synthases, C-terminal domain

256

397

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jap-assembly2.cif.gz_A crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones 0.9867 1 353
4jd3-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones 0.9867 3 353
4jd3-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones 0.9811 3 353
1u0m-assembly1.cif.gz_B crystal structure of 1,3,6,8-tetrahydroxynaphthalene synthase (thns) from streptomyces coelicolor a3(2): a bacterial type iii polyketide synthase (pks) provides insights into enzymatic control of reactive polyketide intermediates 0.9504 3 353
1u0m-assembly1.cif.gz_B crystal structure of 1,3,6,8-tetrahydroxynaphthalene synthase (thns) from streptomyces coelicolor a3(2): a bacterial type iii polyketide synthase (pks) provides insights into enzymatic control of reactive polyketide intermediates 0.9398 3 353
ID Description Score Start End Superfamily
4jaoA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9933 211 353 3.40.47.10
af_P9WPF3_1_208_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9806 1 205 3.40.47.10
4jaoA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.973 211 353 3.40.47.10
af_P9WPF3_1_208_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9621 1 205 3.40.47.10
1tedA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9545 211 352 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A109SWR2-F1-model_v4 deleted 0.9967 209 353
AF-A0A0U0QWA4-F1-model_v4 Chalcone synthase (EC 2.3.1.-, EC 2.3.1.74) 0.9915 139 353 GO:0016210
GO:0030639
AF-A0A0H5RSP8-F1-model_v4 Chalcone synthase Pks10 0.9905 2 353 GO:0006633
GO:0016747
GO:0030639
AF-A0A5B1AQ96-F1-model_v4 Chalcone/stilbene synthase C-terminal domain-containing protein 0.9896 210 319 GO:0016747
GO:0030639
AF-A0A1V3WAZ6-F1-model_v4 Alpha-pyrone synthesis polyketide synthase-like Pks11 (EC 2.3.1.-) 0.9888 86 353 GO:0006633
GO:0016747
GO:0030639

Feature Viewer

pLDDT pTM Quality
94.35 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map