F474615

General Info

Members Datasets Scaffolds Average Seq Length
677 289 1356 237

Family's Representative Sequence

Representative Sequence 3300053131|Ga0500652_020551|Ga0500652_020551_1010_1828
Length 272
Sequence VGNTFYKRCKTLIKNPFFAALKGVSPIKSLNGQSYMLPKYKRILVKLSGESLMGDKSFGMDPSILNQYAHDIKELVELGVQVAIVIGGGNIYRGMNEAETGIERAHGDYMGMLATVINGMAMQAMLEKIGVFTRLQSAIKMEQIAEPYIRRRAIRHVEKGRVVIFGAGTGNPYFTTDTAGSLRAIEIQADVILKGTRVDGIYTADPEKDPTAKKYESITFQECISKNLRVMDMTAFTLCMENNLPIIVFDMNKPGNLRRVACGERVGTLVKG

Samples

Sample ID Description Type Environment
1 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
186 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
187 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
188 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
189 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
192 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
193 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
198 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
199 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
248 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
249 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
250 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
251 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
268 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
269 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
270 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
271 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
272 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
273 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
274 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
277 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
280 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
281 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
282 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
287 2738541278 Niastella sp. CF465 Isolate Unclassified
288 2818991444 Filimonas endophytica 3197 Isolate Unclassified
289 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.43
Nodule 0
Rhizoplane 0.89
Rhizosphere 90.4
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500652_020551 3300053131 Bacteria 2472
2 CNXas_1002191 3300000545 Bacteria 1347
3 JGI24751J29686_10000297 3300002459 Bacteria 18753
4 rootH1_10038406 3300003316 Bacteria 5727
5 rootH1_10038406 3300003323 Bacteria 17804
6 rootH2_10007161 3300003320 Bacteria 44535
7 rootL2_10009250 3300003322 Bacteria 1661
8 rootH1_10001569 3300003323 Bacteria 19450
9 rootH1_10010732 3300003316 Bacteria 3448
10 rootH1_10010732 3300003323 Bacteria 14229
11 Ga0065704_10117876 3300005289 Bacteria 1827
12 Ga0065704_10134167 3300005289 Bacteria 1580
13 Ga0065712_10006725 3300005290 Bacteria 2538
14 Ga0065712_10069410 3300005290 Bacteria 7353
15 Ga0065712_10102063 3300005290 Bacteria 1988
16 Ga0065715_10020203 3300005293 Bacteria 2111
17 Ga0065715_10097890 3300005293 Bacteria 3634
18 Ga0065715_10131286 3300005293 Bacteria 2010
19 Ga0065707_10099164 3300005295 Bacteria 3026
20 Ga0065707_10113318 3300005295 Bacteria 2331
21 Ga0065707_10481629 3300005295 Bacteria 773
22 Ga0070658_10032384 3300005327 Bacteria 4202
23 Ga0070658_10032704 3300005327 Bacteria 4182
24 Ga0070658_10060952 3300005327 Bacteria 3073
25 Ga0070658_10242787 3300005327 Bacteria 1527
26 Ga0070683_100024991 3300005329 Bacteria 5358
27 Ga0070690_100029757 3300005330 Bacteria 3390
28 Ga0070690_100079437 3300005330 Bacteria 2145
29 Ga0070690_100235141 3300005330 Bacteria 1290
30 Ga0070670_100021507 3300005331 Bacteria 5549
31 Ga0070670_100028923 3300005331 Bacteria 4770
32 Ga0070670_100091548 3300005331 Bacteria 2615
33 Ga0070670_100146190 3300005331 Bacteria 2045
34 Ga0070670_100184343 3300005331 Bacteria 1812
35 Ga0070670_100301478 3300005331 Bacteria 1402
36 Ga0070677_10174143 3300005333 Bacteria 1020
37 Ga0068869_100022861 3300005334 Bacteria 4312
38 Ga0068869_100037645 3300005334 Bacteria 3441
39 Ga0068869_100053761 3300005334 Bacteria 2929
40 Ga0068869_100057863 3300005334 Bacteria 2832
41 Ga0068869_100060326 3300005334 Bacteria 2780
42 Ga0068869_100105840 3300005334 Bacteria 2134
43 Ga0070666_10000072 3300005335 Bacteria 75356
44 Ga0070666_10052394 3300005335 Bacteria 2750
45 Ga0070666_10081514 3300005335 Bacteria 2212
46 Ga0070666_10327654 3300005335 Bacteria 1093
47 Ga0070680_100068203 3300005336 Bacteria 2919
48 Ga0068868_100008885 3300005338 Bacteria 7202
49 Ga0068868_100118841 3300005338 Bacteria 2155
50 Ga0068868_100677507 3300005338 Bacteria 920
51 Ga0070660_100000353 3300005339 Bacteria 30722
52 Ga0070689_100083237 3300005340 Bacteria 2514
53 Ga0070689_100150368 3300005340 Bacteria 1877
54 Ga0070689_100295372 3300005340 Bacteria 1347
55 Ga0070691_10207953 3300005341 Bacteria 1031
56 Ga0070691_10225792 3300005341 Bacteria 994
57 Ga0070687_100055049 3300005343 Bacteria 2076
58 Ga0070661_100112590 3300005344 Bacteria 2033
59 Ga0070668_100072324 3300005347 Bacteria 2687
60 Ga0070669_100013179 3300005353 Bacteria 5876
61 Ga0070669_100066732 3300005353 Bacteria 2653
62 Ga0070669_100140846 3300005353 Bacteria 1859
63 Ga0070669_100480030 3300005353 Bacteria 1028
64 Ga0070675_100037007 3300005354 Bacteria 3973
65 Ga0070675_100096076 3300005354 Bacteria 2489
66 Ga0070675_100240237 3300005354 Bacteria 1583
67 Ga0070675_100515595 3300005354 Bacteria 1078
68 Ga0070671_100038078 3300005355 Bacteria 3992
69 Ga0070671_100475351 3300005355 Bacteria 1073
70 Ga0070673_100001930 3300005364 Bacteria 12471
71 Ga0070673_100056888 3300005364 Bacteria 3088
72 Ga0070673_100095119 3300005364 Bacteria 2443
73 Ga0070688_100001768 3300005365 Bacteria 10813
74 Ga0070688_100067168 3300005365 Bacteria 2283
75 Ga0070688_100126961 3300005365 Bacteria 1715
76 Ga0070688_100448606 3300005365 Bacteria 964
77 Ga0070659_100461105 3300005366 Bacteria 1079
78 Ga0070667_100031681 3300005367 Bacteria 4408
79 Ga0070667_100123398 3300005367 Bacteria 2255
80 Ga0070667_100346335 3300005367 Bacteria 1344
81 Ga0070708_100196646 3300005445 Bacteria 1887
82 Ga0070663_100047024 3300005455 Bacteria 3056
83 Ga0070663_100293639 3300005455 Bacteria 1299
84 Ga0070678_100042232 3300005456 Bacteria 3240
85 Ga0070678_100096160 3300005456 Bacteria 2284
86 Ga0070662_100059134 3300005457 Bacteria 2791
87 Ga0070662_100200584 3300005457 Bacteria 1583
88 Ga0070681_10032510 3300005458 Bacteria 5236
89 Ga0068867_100016063 3300005459 Bacteria 5315
90 Ga0068867_100359275 3300005459 Unclassified 1218
91 Ga0070685_10008872 3300005466 Bacteria 5185
92 Ga0070685_10045751 3300005466 Bacteria 2511
93 Ga0070685_10119568 3300005466 Bacteria 1634
94 Ga0070685_10423099 3300005466 Bacteria 927
95 Ga0070706_100106836 3300005467 Bacteria 2604
96 Ga0070707_100028019 3300005468 Bacteria 5358
97 Ga0070707_100068849 3300005468 Bacteria 3407
98 Ga0070707_100493878 3300005468 Bacteria 1186
99 Ga0070698_100089668 3300005471 Bacteria 3058
100 Ga0070699_100035304 3300005518 Bacteria 4322
101 Ga0070679_100328890 3300005530 Bacteria 1477
102 Ga0070684_100123300 3300005535 Bacteria 2332
103 Ga0068853_100005414 3300005539 Bacteria 10003
104 Ga0068853_100021530 3300005539 Bacteria 5377
105 Ga0068853_100027012 3300005539 Bacteria 4823
106 Ga0068853_100116726 3300005539 Bacteria 2377
107 Ga0068853_100221793 3300005539 Bacteria 1727
108 Ga0068853_100940301 3300005539 Bacteria 831
109 Ga0070672_100034513 3300005543 Bacteria 3839
110 Ga0070672_100104380 3300005543 Bacteria 2303
111 Ga0070672_100125084 3300005543 Bacteria 2108
112 Ga0070672_100178205 3300005543 Bacteria 1770
113 Ga0070672_100426605 3300005543 Bacteria 1139
114 Ga0070686_100155613 3300005544 Bacteria 1605
115 Ga0070704_100261834 3300005549 Bacteria 1425
116 Ga0068855_100001281 3300005563 Bacteria 31161
117 Ga0068855_100001364 3300005563 Bacteria 30276
118 Ga0068855_100005605 3300005563 Bacteria 15317
119 Ga0068855_100061780 3300005563 Bacteria 4376
120 Ga0068855_100170031 3300005563 Bacteria 2469
121 Ga0068855_100224735 3300005563 Bacteria 2104
122 Ga0070664_100025450 3300005564 Bacteria 4905
123 Ga0068857_100040989 3300005577 Bacteria 4105
124 Ga0068857_100475945 3300005577 Bacteria 1170
125 Ga0068857_100504050 3300005577 Bacteria 1136
126 Ga0068856_100025243 3300005614 Bacteria 5790
127 Ga0068852_100011225 3300005616 Bacteria 6733
128 Ga0068852_100223678 3300005616 Bacteria 1791
129 Ga0068852_100463858 3300005616 Bacteria 1256
130 Ga0068859_100000006 3300005617 Bacteria 421509
131 Ga0068859_100043650 3300005617 Bacteria 4506
132 Ga0068859_100055565 3300005617 Bacteria 3984
133 Ga0068859_100076850 3300005617 Bacteria 3379
134 Ga0068859_100090079 3300005617 Bacteria 3118
135 Ga0068859_100276535 3300005617 Bacteria 1772
136 Ga0068859_100441309 3300005617 Bacteria 1398
137 Ga0068859_100470606 3300005617 Bacteria 1352
138 Ga0068864_100000469 3300005618 Bacteria 34957
139 Ga0068864_100013747 3300005618 Bacteria 6714
140 Ga0068864_100026382 3300005618 Bacteria 4901
141 Ga0068864_100038927 3300005618 Bacteria 4063
142 Ga0068864_100075767 3300005618 Bacteria 2938
143 Ga0068864_100160788 3300005618 Bacteria 2041
144 Ga0068864_100186352 3300005618 Bacteria 1900
145 Ga0068861_100004575 3300005719 Bacteria 9286
146 Ga0068861_100006209 3300005719 Bacteria 8131
147 Ga0068861_100025586 3300005719 Bacteria 4281
148 Ga0068861_100130465 3300005719 Bacteria 2039
149 Ga0068861_100865576 3300005719 Bacteria 853
150 Ga0068851_10065975 3300005834 Bacteria 1864
151 Ga0068851_10101144 3300005834 Bacteria 1530
152 Ga0068851_10401648 3300005834 Bacteria 806
153 Ga0068870_10137798 3300005840 Bacteria 1425
154 Ga0068863_100002075 3300005841 Bacteria 19871
155 Ga0068863_100428969 3300005841 Bacteria 1296
156 Ga0068858_100000978 3300005842 Bacteria 29516
157 Ga0068858_100227240 3300005842 Bacteria 1769
158 Ga0068858_100659088 3300005842 Bacteria 1017
159 Ga0068858_100838392 3300005842 Bacteria 898
160 Ga0068860_100001713 3300005843 Bacteria 23427
161 Ga0068860_100060453 3300005843 Bacteria 3601
162 Ga0068860_100082085 3300005843 Bacteria 3066
163 Ga0068860_100211746 3300005843 Bacteria 1880
164 Ga0068862_100012568 3300005844 Bacteria 7011
165 Ga0068862_100020995 3300005844 Bacteria 5457
166 Ga0081540_1017706 3300005983 Bacteria 4399
167 Ga0070716_100101830 3300006173 Bacteria 1762
168 Ga0075366_10024460 3300006195 Bacteria 3523
169 Ga0075366_10113143 3300006195 Bacteria 1634
170 Ga0075366_10124486 3300006195 Bacteria 1554
171 Ga0097621_100019677 3300006237 Bacteria 5187
172 Ga0097621_100025089 3300006237 Bacteria 4661
173 Ga0097621_100111731 3300006237 Bacteria 2310
174 Ga0097621_100175542 3300006237 Bacteria 1849
175 Ga0097621_100211165 3300006237 Bacteria 1689
176 Ga0097621_100490485 3300006237 Bacteria 1112
177 Ga0097621_100992207 3300006237 Bacteria 785
178 Ga0068871_100036138 3300006358 Bacteria 3931
179 Ga0068871_100053211 3300006358 Bacteria 3280
180 Ga0068871_100252807 3300006358 Bacteria 1535
181 Ga0068871_100347101 3300006358 Bacteria 1312
182 Ga0068871_100402919 3300006358 Bacteria 1219
183 Ga0068871_100828302 3300006358 Bacteria 854
184 Ga0075428_100013757 3300006844 Bacteria 9011
185 Ga0075428_100014688 3300006844 Bacteria 8698
186 Ga0075430_100004920 3300006846 Bacteria 11237
187 Ga0075431_100058710 3300006847 Bacteria 3971
188 Ga0075431_100112689 3300006847 Bacteria 2807
189 Ga0075429_100004785 3300006880 Bacteria 11657
190 Ga0075429_100013242 3300006880 Bacteria 7152
191 Ga0075429_100022401 3300006880 Bacteria 5479
192 Ga0075429_100059697 3300006880 Bacteria 3322
193 Ga0068865_100031052 3300006881 Bacteria 3559
194 Ga0068865_100143641 3300006881 Bacteria 1802
195 Ga0097620_100000006 3300006931 Bacteria 421509
196 Ga0097620_100043648 3300006931 Bacteria 4506
197 Ga0097620_100055565 3300006931 Bacteria 3984
198 Ga0097620_100076849 3300006931 Bacteria 3379
199 Ga0097620_100090075 3300006931 Bacteria 3118
200 Ga0097620_100276522 3300006931 Bacteria 1772
201 Ga0097620_100441314 3300006931 Bacteria 1398
202 Ga0097620_100470639 3300006931 Bacteria 1352
203 Ga0105240_10003164 3300009093 Bacteria 25888
204 Ga0105240_10022849 3300009093 Bacteria 8285
205 Ga0105240_10037496 3300009093 Bacteria 6230
206 Ga0105240_10050750 3300009093 Bacteria 5227
207 Ga0105240_10051677 3300009093 Bacteria 5170
208 Ga0105240_10072721 3300009093 Bacteria 4249
209 Ga0105240_10164462 3300009093 Bacteria 2633
210 Ga0111539_10209325 3300009094 Bacteria 2272
211 Ga0111539_10417824 3300009094 Bacteria 1562
212 Ga0111539_10556141 3300009094 Bacteria 1336
213 Ga0111539_10774045 3300009094 Bacteria 1117
214 Ga0105247_10004725 3300009101 Bacteria 8673
215 Ga0105247_10007492 3300009101 Bacteria 6691
216 Ga0114129_10001062 3300009147 Bacteria 36084
217 Ga0114129_10290216 3300009147 Bacteria 2183
218 Ga0105243_10184436 3300009148 Bacteria 1817
219 Ga0105243_10248409 3300009148 Bacteria 1587
220 Ga0105241_10000324 3300009174 Bacteria 36128
221 Ga0105241_10002036 3300009174 Bacteria 15289
222 Ga0105241_10006293 3300009174 Bacteria 8755
223 Ga0105241_10042016 3300009174 Bacteria 3457
224 Ga0105241_10417594 3300009174 Bacteria 1180
225 Ga0105242_10005785 3300009176 Bacteria 9521
226 Ga0105242_10028617 3300009176 Bacteria 4438
227 Ga0105242_10058511 3300009176 Bacteria 3160
228 Ga0105242_10238699 3300009176 Bacteria 1633
229 Ga0105248_10236734 3300009177 Bacteria 2055
230 Ga0105248_10445460 3300009177 Bacteria 1459
231 Ga0105237_10000144 3300009545 Bacteria 100105
232 Ga0105237_10003823 3300009545 Bacteria 17699
233 Ga0105237_10006111 3300009545 Bacteria 13458
234 Ga0105237_10033838 3300009545 Bacteria 5178
235 Ga0105237_10346767 3300009545 Bacteria 1489
236 Ga0105238_10005010 3300009551 Bacteria 13090
237 Ga0105238_10256291 3300009551 Bacteria 1728
238 Ga0105238_10259217 3300009551 Bacteria 1718
239 Ga0105249_10001056 3300009553 Bacteria 24413
240 Ga0105249_10002054 3300009553 Bacteria 17468
241 Ga0105249_10007493 3300009553 Bacteria 9521
242 Ga0105249_10011216 3300009553 Bacteria 7870
243 Ga0105249_10053452 3300009553 Bacteria 3692
244 Ga0105249_10075154 3300009553 Bacteria 3129
245 Ga0105249_10742256 3300009553 Bacteria 1043
246 Ga0105239_10000488 3300010375 Bacteria 57554
247 Ga0105239_10000925 3300010375 Bacteria 41596
248 Ga0105239_10010461 3300010375 Bacteria 10371
249 Ga0105239_10011188 3300010375 Bacteria 10015
250 Ga0105239_10016597 3300010375 Bacteria 8140
251 Ga0105239_10020600 3300010375 Bacteria 7276
252 Ga0105239_10090488 3300010375 Bacteria 3376
253 Ga0105246_10091029 3300011119 Bacteria 2198
254 Ga0105246_10363290 3300011119 Bacteria 1190
255 Ga0157373_10008679 3300013100 Bacteria 7542
256 Ga0157371_10000451 3300013102 Bacteria 50405
257 Ga0157371_10001626 3300013102 Bacteria 22988
258 Ga0157371_10152895 3300013102 Bacteria 1646
259 Ga0157371_10230889 3300013102 Bacteria 1330
260 Ga0157371_10577840 3300013102 Bacteria 834
261 Ga0157370_10003865 3300013104 Bacteria 17457
262 Ga0157370_10006839 3300013104 Bacteria 12493
263 Ga0157370_10007606 3300013104 Bacteria 11766
264 Ga0157370_10089403 3300013104 Bacteria 2893
265 Ga0157370_10175065 3300013104 Bacteria 1994
266 Ga0157370_10391791 3300013104 Bacteria 1279
267 Ga0157370_10743179 3300013104 Bacteria 894
268 Ga0157369_10007223 3300013105 Bacteria 12797
269 Ga0157369_10037669 3300013105 Bacteria 5293
270 Ga0157369_10227713 3300013105 Bacteria 1950
271 Ga0157374_10000013 3300013296 Bacteria 461240
272 Ga0157374_10024890 3300013296 Bacteria 5370
273 Ga0157374_10107475 3300013296 Bacteria 2681
274 Ga0157374_10398592 3300013296 Bacteria 1373
275 Ga0157378_10048214 3300013297 Bacteria 3787
276 Ga0157378_10091377 3300013297 Bacteria 2767
277 Ga0157378_10171743 3300013297 Bacteria 2033
278 Ga0157378_10268289 3300013297 Bacteria 1640
279 Ga0163162_10000112 3300013306 Bacteria 72032
280 Ga0163162_10000253 3300013306 Bacteria 48450
281 Ga0163162_10002447 3300013306 Bacteria 17518
282 Ga0163162_11301536 3300013306 Bacteria 826
283 Ga0157372_10000667 3300013307 Bacteria 37793
284 Ga0157372_10071033 3300013307 Bacteria 3919
285 Ga0157372_10327274 3300013307 Bacteria 1784
286 Ga0157372_10349849 3300013307 Bacteria 1721
287 Ga0157375_10088688 3300013308 Bacteria 3148
288 Ga0157375_10154229 3300013308 Bacteria 2434
289 Ga0157375_10209843 3300013308 Bacteria 2105
290 Ga0157375_10361412 3300013308 Bacteria 1618
291 Ga0157375_10400674 3300013308 Bacteria 1539
292 Ga0163163_10470739 3300014325 Bacteria 1317
293 Ga0157380_10004180 3300014326 Bacteria 9977
294 Ga0157380_10055627 3300014326 Bacteria 3144
295 Ga0157380_10099713 3300014326 Bacteria 2416
296 Ga0157380_10101875 3300014326 Bacteria 2393
297 Ga0157380_10281935 3300014326 Bacteria 1521
298 Ga0157380_10431861 3300014326 Bacteria 1259
299 Ga0157377_10017312 3300014745 Bacteria 3725
300 Ga0157377_10017363 3300014745 Bacteria 3720
301 Ga0157377_10504318 3300014745 Bacteria 846
302 Ga0157379_10005275 3300014968 Bacteria 11097
303 Ga0157379_10029944 3300014968 Bacteria 4841
304 Ga0157379_10380303 3300014968 Bacteria 1295
305 Ga0157376_10001570 3300014969 Bacteria 15087
306 Ga0157376_10070136 3300014969 Bacteria 2974
307 Ga0157376_10152746 3300014969 Bacteria 2084
308 Ga0157376_10153384 3300014969 Bacteria 2080
309 Ga0157376_10230195 3300014969 Bacteria 1721
310 Ga0163161_10040483 3300017792 Bacteria 3347
311 Ga0163161_10068270 3300017792 Bacteria 2597
312 Ga0163161_10075295 3300017792 Bacteria 2476
313 Ga0163161_10157142 3300017792 Bacteria 1732
314 Ga0163161_10237323 3300017792 Bacteria 1417
315 Ga0163161_10288960 3300017792 Bacteria 1288
316 Ga0163161_10719308 3300017792 Bacteria 833
317 Ga0213876_10016061 3300021384 Bacteria 3960
318 Ga0207426_1000059 3300025302 Bacteria 363842
319 Ga0207697_10013942 3300025315 Bacteria 3346
320 Ga0207656_10085275 3300025321 Bacteria 1426
321 Ga0207682_10161128 3300025893 Bacteria 1016
322 Ga0207642_10054219 3300025899 Bacteria 1828
323 Ga0207710_10002364 3300025900 Bacteria 8816
324 Ga0207680_10020915 3300025903 Bacteria 3533
325 Ga0207680_10324646 3300025903 Bacteria 1077
326 Ga0207647_10064086 3300025904 Bacteria 2234
327 Ga0207647_10108484 3300025904 Bacteria 1642
328 Ga0207685_10114091 3300025905 Bacteria 1176
329 Ga0207645_10020710 3300025907 Bacteria 4300
330 Ga0207645_10027483 3300025907 Bacteria 3673
331 Ga0207645_10121810 3300025907 Bacteria 1693
332 Ga0207643_10012716 3300025908 Bacteria 4549
333 Ga0207643_10091760 3300025908 Bacteria 1772
334 Ga0207705_10216977 3300025909 Bacteria 1452
335 Ga0207654_10002079 3300025911 Bacteria 10262
336 Ga0207654_10009816 3300025911 Bacteria 4867
337 Ga0207654_10055609 3300025911 Bacteria 2292
338 Ga0207695_10000056 3300025913 Bacteria 382433
339 Ga0207695_10001122 3300025913 Bacteria 46534
340 Ga0207695_10010840 3300025913 Bacteria 11105
341 Ga0207695_10027732 3300025913 Bacteria 6301
342 Ga0207695_10028609 3300025913 Bacteria 6173
343 Ga0207695_10063527 3300025913 Bacteria 3806
344 Ga0207671_10000453 3300025914 Bacteria 56447
345 Ga0207671_10001502 3300025914 Bacteria 26900
346 Ga0207671_10001511 3300025914 Bacteria 26769
347 Ga0207671_10085996 3300025914 Bacteria 2363
348 Ga0207660_10072945 3300025917 Bacteria 2502
349 Ga0207662_10014896 3300025918 Bacteria 4368
350 Ga0207662_10060356 3300025918 Bacteria 2274
351 Ga0207657_10005517 3300025919 Bacteria 13209
352 Ga0207657_10046739 3300025919 Bacteria 3790
353 Ga0207657_10115053 3300025919 Bacteria 2217
354 Ga0207649_10179546 3300025920 Bacteria 1481
355 Ga0207649_10208190 3300025920 Bacteria 1386
356 Ga0207652_10009486 3300025921 Bacteria 7824
357 Ga0207652_10405891 3300025921 Bacteria 1229
358 Ga0207646_10012637 3300025922 Bacteria 8105
359 Ga0207646_10212194 3300025922 Bacteria 1748
360 Ga0207646_10473547 3300025922 Bacteria 1129
361 Ga0207681_10057701 3300025923 Bacteria 2654
362 Ga0207681_10564845 3300025923 Bacteria 937
363 Ga0207694_10106310 3300025924 Bacteria 2229
364 Ga0207650_10012500 3300025925 Bacteria 5861
365 Ga0207650_10047529 3300025925 Bacteria 3162
366 Ga0207650_10103533 3300025925 Bacteria 2195
367 Ga0207650_10170423 3300025925 Bacteria 1730
368 Ga0207659_10004571 3300025926 Bacteria 8368
369 Ga0207659_10012861 3300025926 Bacteria 5344
370 Ga0207659_10477265 3300025926 Bacteria 1053
371 Ga0207644_10123395 3300025931 Bacteria 1975
372 Ga0207644_10354278 3300025931 Bacteria 1192
373 Ga0207690_10317204 3300025932 Bacteria 1224
374 Ga0207706_10067636 3300025933 Bacteria 3143
375 Ga0207706_10228136 3300025933 Bacteria 1630
376 Ga0207686_10000351 3300025934 Bacteria 32797
377 Ga0207686_10169185 3300025934 Bacteria 1539
378 Ga0207709_10169214 3300025935 Bacteria 1532
379 Ga0207670_10048806 3300025936 Bacteria 2827
380 Ga0207670_10062784 3300025936 Bacteria 2540
381 Ga0207670_10432955 3300025936 Bacteria 1057
382 Ga0207670_10523278 3300025936 Bacteria 966
383 Ga0207669_10817614 3300025937 Bacteria 774
384 Ga0207704_10126127 3300025938 Bacteria 1763
385 Ga0207704_10134502 3300025938 Bacteria 1718
386 Ga0207691_10055953 3300025940 Bacteria 3595
387 Ga0207691_10075209 3300025940 Bacteria 3045
388 Ga0207691_10081826 3300025940 Bacteria 2901
389 Ga0207691_10145305 3300025940 Bacteria 2088
390 Ga0207691_10300203 3300025940 Bacteria 1380
391 Ga0207691_10320367 3300025940 Bacteria 1329
392 Ga0207711_10078140 3300025941 Bacteria 2886
393 Ga0207689_10001492 3300025942 Bacteria 22339
394 Ga0207689_10086393 3300025942 Bacteria 2578
395 Ga0207689_10104175 3300025942 Bacteria 2331
396 Ga0207661_10803567 3300025944 Bacteria 866
397 Ga0207679_10029827 3300025945 Bacteria 3802
398 Ga0207667_10007821 3300025949 Bacteria 12775
399 Ga0207667_10075292 3300025949 Bacteria 3505
400 Ga0207667_10134911 3300025949 Bacteria 2542
401 Ga0207667_10150742 3300025949 Bacteria 2393
402 Ga0207667_10155683 3300025949 Bacteria 2352
403 Ga0207651_10109139 3300025960 Bacteria 2072
404 Ga0207651_10147807 3300025960 Bacteria 1825
405 Ga0207651_10168833 3300025960 Bacteria 1723
406 Ga0207651_10232759 3300025960 Bacteria 1497
407 Ga0207651_10586049 3300025960 Bacteria 973
408 Ga0207712_10001599 3300025961 Bacteria 15251
409 Ga0207712_10003428 3300025961 Bacteria 10019
410 Ga0207712_10005438 3300025961 Bacteria 8039
411 Ga0207712_10014496 3300025961 Bacteria 5074
412 Ga0207712_10031442 3300025961 Bacteria 3576
413 Ga0207712_10319151 3300025961 Bacteria 1281
414 Ga0207668_10333519 3300025972 Bacteria 1263
415 Ga0207668_10435833 3300025972 Bacteria 1115
416 Ga0207658_10010564 3300025986 Bacteria 6273
417 Ga0207658_10032675 3300025986 Bacteria 3706
418 Ga0207658_10042638 3300025986 Bacteria 3293
419 Ga0207677_10045716 3300026023 Bacteria 2925
420 Ga0207677_10153583 3300026023 Bacteria 1779
421 Ga0207677_10229345 3300026023 Bacteria 1495
422 Ga0207703_10002804 3300026035 Bacteria 14887
423 Ga0207639_10012512 3300026041 Bacteria 5911
424 Ga0207639_10054200 3300026041 Bacteria 3064
425 Ga0207639_10085015 3300026041 Bacteria 2515
426 Ga0207639_10088393 3300026041 Bacteria 2472
427 Ga0207639_10142613 3300026041 Bacteria 1998
428 Ga0207639_10160505 3300026041 Bacteria 1894
429 Ga0207639_10413219 3300026041 Bacteria 1218
430 Ga0207708_10120038 3300026075 Bacteria 2048
431 Ga0207708_10348786 3300026075 Bacteria 1214
432 Ga0207702_10230502 3300026078 Bacteria 1731
433 Ga0207641_10000058 3300026088 Bacteria 166385
434 Ga0207641_10043574 3300026088 Bacteria 3769
435 Ga0207641_10166367 3300026088 Bacteria 2009
436 Ga0207648_10022185 3300026089 Bacteria 5703
437 Ga0207648_10102681 3300026089 Bacteria 2506
438 Ga0207648_10118817 3300026089 Bacteria 2323
439 Ga0207648_10185389 3300026089 Unclassified 1843
440 Ga0207676_10014686 3300026095 Bacteria 5641
441 Ga0207676_10045785 3300026095 Bacteria 3382
442 Ga0207676_10238300 3300026095 Bacteria 1630
443 Ga0207676_10282148 3300026095 Bacteria 1508
444 Ga0207674_10008410 3300026116 Bacteria 11925
445 Ga0207674_10008703 3300026116 Bacteria 11683
446 Ga0207674_10101275 3300026116 Bacteria 2861
447 Ga0207674_10787100 3300026116 Bacteria 918
448 Ga0207675_100000153 3300026118 Bacteria 60593
449 Ga0207675_100003754 3300026118 Bacteria 14797
450 Ga0207675_100027008 3300026118 Bacteria 5344
451 Ga0207675_100100301 3300026118 Bacteria 2727
452 Ga0207675_100140758 3300026118 Bacteria 2292
453 Ga0207683_10011891 3300026121 Bacteria 7428
454 Ga0207683_10037605 3300026121 Bacteria 4215
455 Ga0207683_10245750 3300026121 Bacteria 1632
456 Ga0207683_10390413 3300026121 Bacteria 1280
457 Ga0207698_10007272 3300026142 Bacteria 6937
458 Ga0207698_10055959 3300026142 Bacteria 3043
459 Ga0207698_10063132 3300026142 Bacteria 2897
460 Ga0207698_10172973 3300026142 Bacteria 1904
461 Ga0207698_10391926 3300026142 Bacteria 1325
462 Ga0207428_10033842 3300027907 Bacteria 4192
463 Ga0268265_10006773 3300028380 Bacteria 7752
464 Ga0268265_10082385 3300028380 Bacteria 2544
465 Ga0268265_10144805 3300028380 Bacteria 1995
466 Ga0268265_10195834 3300028380 Bacteria 1749
467 Ga0268264_10000726 3300028381 Bacteria 37807
468 Ga0268264_10063815 3300028381 Bacteria 3098
469 Ga0268264_10490517 3300028381 Bacteria 1196
470 Ga0268264_10597587 3300028381 Bacteria 1087
471 Ga0307517_10219728 3300028786 Bacteria 1157
472 Ga0307515_10000059 3300028794 Bacteria 257520
473 Ga0307515_10192629 3300028794 Bacteria 1943
474 Ga0307511_10000181 3300030521 Bacteria 62420
475 Ga0265327_10000172 3300031251 Bacteria 139400
476 Ga0307513_10030476 3300031456 Bacteria 6128
477 Ga0307513_10348214 3300031456 Bacteria 1230
478 Ga0307513_10377596 3300031456 Bacteria 1158
479 Ga0307509_10013918 3300031507 Bacteria 9490
480 Ga0307509_10093902 3300031507 Bacteria 3060
481 Ga0307509_10151950 3300031507 Bacteria 2229
482 Ga0307408_100285963 3300031548 Bacteria 1375
483 Ga0307508_10000485 3300031616 Bacteria 47975
484 Ga0307508_10057484 3300031616 Bacteria 3442
485 Ga0307516_10170989 3300031730 Bacteria 1914
486 Ga0307516_10202111 3300031730 Bacteria 1706
487 Ga0307405_10054867 3300031731 Bacteria 2490
488 Ga0307405_10184986 3300031731 Bacteria 1499
489 Ga0307413_10048737 3300031824 Bacteria 2534
490 Ga0307412_10524207 3300031911 Bacteria 990
491 Ga0307409_100256882 3300031995 Bacteria 1601
492 Ga0307416_100007276 3300032002 Bacteria 7019
493 Ga0307414_10050346 3300032004 Bacteria 2885
494 Ga0373935_0088048 3300035692 Bacteria 2028
495 Ga0395900_0456266 3300037418 Bacteria 1234
496 Ga0395898_0658837 3300037466 Bacteria 989
497 Ga0395905_0000002 3300037471 Bacteria 1356358
498 Ga0436364_1006406 3300037853 Bacteria 1339
499 Ga0395901_0002140 3300038443 Bacteria 20188
500 Ga0395901_0838566 3300038443 Bacteria 905
501 Ga0436365_1001352 3300039437 Bacteria 8242
502 Ga0439436_0004748 3300041404 Bacteria 4167
503 Ga0439439_0001927 3300041406 Bacteria 4289
504 Ga0439439_0080627 3300041406 Bacteria 880
505 Ga0439465_0108527 3300041413 Bacteria 964
506 Ga0451791_1381310 3300041451 Bacteria 1453
507 Ga0451800_1146729 3300041459 Bacteria 995
508 Ga0451800_1377849 3300041459 Bacteria 1738
509 Ga0451807_0414922 3300041486 Bacteria 1737
510 Ga0451841_1354039 3300041498 Bacteria 877
511 Ga0451845_0011729 3300041501 Bacteria 1045
512 Ga0451847_0209969 3300041503 Bacteria 865
513 Ga0451853_2563909 3300041512 Bacteria 7170
514 Ga0439442_039304 3300042002 Bacteria 992
515 Ga0439449_0015126 3300042007 Bacteria 2899
516 Ga0439457_000277 3300042014 Bacteria 14123
517 Ga0439462_0062632 3300042015 Bacteria 1007
518 Ga0439434_0130367 3300042435 Bacteria 825
519 Ga0451577_0001932 3300042876 Bacteria 26161
520 Ga0451577_0210143 3300042876 Bacteria 1758
521 Ga0466969_0000190 3300044656 Bacteria 33133
522 Ga0466969_0054828 3300044656 Bacteria 1952
523 Ga0466972_0000168 3300044658 Bacteria 51759
524 Ga0466972_0000337 3300044658 Bacteria 25976
525 Ga0466972_0007731 3300044658 Bacteria 5397
526 Ga0453683_0083947 3300044673 Bacteria 1996
527 Ga0466966_0013541 3300044684 Bacteria 5398
528 Ga0466966_0075817 3300044684 Bacteria 2100
529 Ga0466966_0395256 3300044684 Bacteria 831
530 Ga0466961_0064427 3300044693 Bacteria 2329
531 Ga0466961_0110285 3300044693 Bacteria 1731
532 Ga0466961_0119342 3300044693 Bacteria 1656
533 Ga0453684_0318611 3300044712 Bacteria 1762
534 Ga0466971_0003048 3300044719 Bacteria 7120
535 Ga0466971_0167919 3300044719 Bacteria 1029
536 Ga0466970_0018702 3300044765 Bacteria 3590
537 Ga0466970_0018946 3300044765 Bacteria 3566
538 Ga0466957_0000428 3300044842 Bacteria 20729
539 Ga0466957_0001546 3300044842 Bacteria 12103
540 Ga0466959_0000003 3300045049 Bacteria 285164
541 Ga0466959_0000488 3300045049 Bacteria 23122
542 Ga0466959_0067262 3300045049 Bacteria 2598
543 Ga0466967_0269720 3300045976 Bacteria 1631
544 Ga0466967_0527085 3300045976 Bacteria 1161
545 Ga0495638_0120656 3300046460 Bacteria 1550
546 Ga0495580_0401459 3300046472 Bacteria 924
547 Ga0495642_0016639 3300046528 Bacteria 2869
548 Ga0495668_0000302 3300046616 Bacteria 68079
549 Ga0495611_0000061 3300046648 Bacteria 77533
550 Ga0495635_0153703 3300046663 Bacteria 1566
551 Ga0495600_0411156 3300046809 Bacteria 841
552 Ga0495672_0005682 3300047320 Bacteria 9829
553 Ga0495672_0018449 3300047320 Bacteria 4630
554 Ga0495672_0234052 3300047320 Bacteria 900
555 Ga0495686_0000010 3300047472 Bacteria 573229
556 Ga0495686_0012477 3300047472 Bacteria 5941
557 Ga0495686_0284601 3300047472 Bacteria 918
558 Ga0496110_0589746 3300048913 Bacteria 1009
559 Ga0496115_0008884 3300048918 Bacteria 7448
560 Ga0501031_0303091 3300049568 Bacteria 1035
561 Ga0501032_0010324 3300049569 Bacteria 6737
562 Ga0501033_0385959 3300049570 Bacteria 978
563 Ga0501033_0398674 3300049570 Bacteria 960
564 Ga0501034_0000004 3300049571 Bacteria 382255
565 Ga0501034_0013427 3300049571 Bacteria 8430
566 Ga0501034_0043155 3300049571 Bacteria 4565
567 Ga0501034_0061010 3300049571 Bacteria 3788
568 Ga0501034_0148138 3300049571 Bacteria 2323
569 Ga0501034_0459750 3300049571 Bacteria 1190
570 Ga0501036_0022006 3300049572 Bacteria 5361
571 Ga0501036_0568815 3300049572 Bacteria 941
572 Ga0501036_0639647 3300049572 Bacteria 881
573 Ga0501037_0131682 3300049573 Bacteria 1793
574 Ga0501037_0348103 3300049573 Bacteria 1023
575 Ga0501038_0015262 3300049574 Bacteria 6984
576 Ga0501038_0226201 3300049574 Bacteria 1491
577 Ga0501039_0040701 3300049575 Bacteria 3587
578 Ga0501039_0076399 3300049575 Bacteria 2604
579 Ga0501040_0024014 3300049576 Bacteria 4090
580 Ga0501040_0138935 3300049576 Bacteria 1710
581 Ga0501042_0049268 3300049578 Bacteria 3005
582 Ga0501042_0203698 3300049578 Bacteria 1427
583 Ga0501043_0010690 3300049579 Bacteria 7189
584 Ga0501043_0117068 3300049579 Bacteria 2091
585 Ga0501043_0572441 3300049579 Bacteria 837
586 Ga0501046_0005998 3300049580 Bacteria 10807
587 Ga0501046_0055861 3300049580 Bacteria 3100
588 Ga0501046_0214974 3300049580 Bacteria 1426
589 Ga0501047_0009030 3300049581 Bacteria 9412
590 Ga0501047_0019423 3300049581 Bacteria 6520
591 Ga0501047_0156907 3300049581 Bacteria 2149
592 Ga0501047_0170288 3300049581 Bacteria 2047
593 Ga0501048_0267987 3300049582 Bacteria 1213
594 Ga0501067_0278172 3300049583 Bacteria 932
595 Ga0501068_0078592 3300049584 Bacteria 2022
596 Ga0501068_0191671 3300049584 Bacteria 1295
597 Ga0501070_0006613 3300049586 Bacteria 9866
598 Ga0501070_0019796 3300049586 Bacteria 5644
599 Ga0501071_0010198 3300049587 Bacteria 6287
600 Ga0501072_0004554 3300049588 Bacteria 10543
601 Ga0501072_0164130 3300049588 Bacteria 1772
602 Ga0501073_0100011 3300049589 Bacteria 2013
603 Ga0501074_0004746 3300049590 Bacteria 9743
604 Ga0501074_0453491 3300049590 Bacteria 909
605 Ga0501075_0007589 3300049591 Bacteria 7526
606 Ga0501076_0103654 3300049592 Bacteria 2295
607 Ga0501076_0528909 3300049592 Bacteria 972
608 Ga0501077_0009648 3300049593 Bacteria 6000
609 Ga0501077_0083098 3300049593 Bacteria 2029
610 Ga0501206_019297 3300049653 Bacteria 964
611 Ga0501207_000200 3300049654 Bacteria 5921
612 Ga0501243_037238 3300049675 Bacteria 845
613 Ga0501219_000321 3300049703 Bacteria 8334
614 Ga0501225_0003367 3300049705 Bacteria 4855
615 Ga0501079_0005805 3300049741 Bacteria 9227
616 Ga0501079_0042780 3300049741 Bacteria 3497
617 Ga0501079_0177956 3300049741 Bacteria 1659
618 Ga0501080_0033622 3300049742 Bacteria 4786
619 Ga0501080_0057387 3300049742 Bacteria 3624
620 Ga0501081_0006944 3300049743 Bacteria 7357
621 Ga0501083_0041069 3300049744 Bacteria 3138
622 Ga0501083_0074150 3300049744 Bacteria 2261
623 Ga0501083_0129585 3300049744 Bacteria 1653
624 Ga0501035_0023355 3300049822 Bacteria 5672
625 Ga0501035_0028623 3300049822 Bacteria 5086
626 Ga0501035_0038469 3300049822 Bacteria 4331
627 Ga0501035_0110505 3300049822 Bacteria 2409
628 Ga0501044_0009878 3300049823 Bacteria 10371
629 Ga0501044_0081954 3300049823 Bacteria 3265
630 Ga0501044_0095326 3300049823 Bacteria 2999
631 Ga0501045_0574996 3300049824 Bacteria 835
632 Ga0501284_00001 3300050005 Bacteria 261916
633 nmdc:mga0k408_47296_c1 3300050493 Bacteria 2486
634 nmdc:mga0k408_53148_c1 3300050493 Bacteria 2347
635 nmdc:mga0k408_54390_c1 3300050493 Bacteria 2320
636 nmdc:mga0k408_55646_c1 3300050493 Bacteria 2294
637 nmdc:mga0k408_68441_c1 3300050493 Bacteria 2071
638 nmdc:mga07m45_365277_c1 3300050496 Bacteria 838
639 nmdc:mga05p37_235046_c1 3300050507 Bacteria 2206
640 nmdc:mga05p37_482_c1 3300050507 Bacteria 43621
641 nmdc:mga09592_17643_c1 3300050508 Bacteria 5850
642 nmdc:mga09592_5311_c1 3300050508 Bacteria 10470
643 nmdc:mga0qj67_4695_c1 3300050509 Bacteria 9918
644 nmdc:mga0qj67_71409_c1 3300050509 Bacteria 2771
645 nmdc:mga06r32_13475_c1 3300050510 Bacteria 7408
646 nmdc:mga06r32_28324_c1 3300050510 Bacteria 5240
647 nmdc:mga06r32_352998_c1 3300050510 Bacteria 1455
648 nmdc:mga08y16_295698_c1 3300050511 Bacteria 1669
649 nmdc:mga08y16_360998_c1 3300050511 Bacteria 1491
650 nmdc:mga08y16_54079_c1 3300050511 Bacteria 4196
651 nmdc:mga08y16_733552_c1 3300050511 Bacteria 985
652 Ga0500578_0001290 3300053086 Bacteria 25877
653 Ga0500578_0129817 3300053086 Bacteria 1581
654 Ga0500644_0157097 3300053088 Bacteria 916
655 Ga0500646_0007918 3300053090 Bacteria 2716
656 Ga0500583_0000019 3300053092 Bacteria 130534
657 Ga0500583_0004286 3300053092 Bacteria 4628
658 Ga0500651_0181427 3300053093 Bacteria 1250
659 Ga0500554_040399 3300053102 Bacteria 1429
660 Ga0500594_0063049 3300053118 Bacteria 1073
661 Ga0500658_0045886 3300053134 Bacteria 1768
662 Ga0500568_0000208 3300053139 Bacteria 51266
663 Ga0500573_0138055 3300053140 Bacteria 1345
664 Ga0500588_0125342 3300053146 Bacteria 910
665 Ga0500588_0163015 3300053146 Bacteria 812
666 Ga0500616_0276094 3300053153 Bacteria 707
667 Ga0500622_0160846 3300053156 Bacteria 1053
668 Ga0500636_0156465 3300053177 Bacteria 1247
669 Ga0500637_0010936 3300053178 Bacteria 4669
670 Ga0500611_000001 3300053727 Bacteria 385744
671 Ga0501084_0041252 3300054114 Bacteria 3861
672 Ga0501084_0108657 3300054114 Bacteria 2330
673 Ga0501084_0118061 3300054114 Bacteria 2230
674 Ga0501082_0005462 3300060353 Bacteria 11037
675 Ga0466962_0001581 3300061719 Bacteria 10654
676 Ga0530510_0079881 3300061734 Bacteria 2379
677 2738725043 2738541278 Bacteria 9755573
678 2819585597 2818991444 Bacteria 6968812
679 3003235196 3003233435 Bacteria 4458031
680 Ga0500652_020551
681 CNXas_1002191
682 JGI24751J29686_10000297
683 rootH1_10038406
684 rootH2_10007161
685 rootL2_10009250
686 rootH1_10001569
687 rootH1_10010732
688 Ga0065704_10117876
689 Ga0065704_10134167
690 Ga0065712_10006725
691 Ga0065712_10069410
692 Ga0065712_10102063
693 Ga0065715_10020203
694 Ga0065715_10097890
695 Ga0065715_10131286
696 Ga0065707_10099164
697 Ga0065707_10113318
698 Ga0065707_10481629
699 Ga0070658_10032384
700 Ga0070658_10032704
701 Ga0070658_10060952
702 Ga0070658_10242787
703 Ga0070683_100024991
704 Ga0070690_100029757
705 Ga0070690_100079437
706 Ga0070690_100235141
707 Ga0070670_100021507
708 Ga0070670_100028923
709 Ga0070670_100091548
710 Ga0070670_100146190
711 Ga0070670_100184343
712 Ga0070670_100301478
713 Ga0070677_10174143
714 Ga0068869_100022861
715 Ga0068869_100037645
716 Ga0068869_100053761
717 Ga0068869_100057863
718 Ga0068869_100060326
719 Ga0068869_100105840
720 Ga0070666_10000072
721 Ga0070666_10052394
722 Ga0070666_10081514
723 Ga0070666_10327654
724 Ga0070680_100068203
725 Ga0068868_100008885
726 Ga0068868_100118841
727 Ga0068868_100677507
728 Ga0070660_100000353
729 Ga0070689_100083237
730 Ga0070689_100150368
731 Ga0070689_100295372
732 Ga0070691_10207953
733 Ga0070691_10225792
734 Ga0070687_100055049
735 Ga0070661_100112590
736 Ga0070668_100072324
737 Ga0070669_100013179
738 Ga0070669_100066732
739 Ga0070669_100140846
740 Ga0070669_100480030
741 Ga0070675_100037007
742 Ga0070675_100096076
743 Ga0070675_100240237
744 Ga0070675_100515595
745 Ga0070671_100038078
746 Ga0070671_100475351
747 Ga0070673_100001930
748 Ga0070673_100056888
749 Ga0070673_100095119
750 Ga0070688_100001768
751 Ga0070688_100067168
752 Ga0070688_100126961
753 Ga0070688_100448606
754 Ga0070659_100461105
755 Ga0070667_100031681
756 Ga0070667_100123398
757 Ga0070667_100346335
758 Ga0070708_100196646
759 Ga0070663_100047024
760 Ga0070663_100293639
761 Ga0070678_100042232
762 Ga0070678_100096160
763 Ga0070662_100059134
764 Ga0070662_100200584
765 Ga0070681_10032510
766 Ga0068867_100016063
767 Ga0068867_100359275
768 Ga0070685_10008872
769 Ga0070685_10045751
770 Ga0070685_10119568
771 Ga0070685_10423099
772 Ga0070706_100106836
773 Ga0070707_100028019
774 Ga0070707_100068849
775 Ga0070707_100493878
776 Ga0070698_100089668
777 Ga0070699_100035304
778 Ga0070679_100328890
779 Ga0070684_100123300
780 Ga0068853_100005414
781 Ga0068853_100021530
782 Ga0068853_100027012
783 Ga0068853_100116726
784 Ga0068853_100221793
785 Ga0068853_100940301
786 Ga0070672_100034513
787 Ga0070672_100104380
788 Ga0070672_100125084
789 Ga0070672_100178205
790 Ga0070672_100426605
791 Ga0070686_100155613
792 Ga0070704_100261834
793 Ga0068855_100001281
794 Ga0068855_100001364
795 Ga0068855_100005605
796 Ga0068855_100061780
797 Ga0068855_100170031
798 Ga0068855_100224735
799 Ga0070664_100025450
800 Ga0068857_100040989
801 Ga0068857_100475945
802 Ga0068857_100504050
803 Ga0068856_100025243
804 Ga0068852_100011225
805 Ga0068852_100223678
806 Ga0068852_100463858
807 Ga0068859_100000006
808 Ga0068859_100043650
809 Ga0068859_100055565
810 Ga0068859_100076850
811 Ga0068859_100090079
812 Ga0068859_100276535
813 Ga0068859_100441309
814 Ga0068859_100470606
815 Ga0068864_100000469
816 Ga0068864_100013747
817 Ga0068864_100026382
818 Ga0068864_100038927
819 Ga0068864_100075767
820 Ga0068864_100160788
821 Ga0068864_100186352
822 Ga0068861_100004575
823 Ga0068861_100006209
824 Ga0068861_100025586
825 Ga0068861_100130465
826 Ga0068861_100865576
827 Ga0068851_10065975
828 Ga0068851_10101144
829 Ga0068851_10401648
830 Ga0068870_10137798
831 Ga0068863_100002075
832 Ga0068863_100428969
833 Ga0068858_100000978
834 Ga0068858_100227240
835 Ga0068858_100659088
836 Ga0068858_100838392
837 Ga0068860_100001713
838 Ga0068860_100060453
839 Ga0068860_100082085
840 Ga0068860_100211746
841 Ga0068862_100012568
842 Ga0068862_100020995
843 Ga0081540_1017706
844 Ga0070716_100101830
845 Ga0075366_10024460
846 Ga0075366_10113143
847 Ga0075366_10124486
848 Ga0097621_100019677
849 Ga0097621_100025089
850 Ga0097621_100111731
851 Ga0097621_100175542
852 Ga0097621_100211165
853 Ga0097621_100490485
854 Ga0097621_100992207
855 Ga0068871_100036138
856 Ga0068871_100053211
857 Ga0068871_100252807
858 Ga0068871_100347101
859 Ga0068871_100402919
860 Ga0068871_100828302
861 Ga0075428_100013757
862 Ga0075428_100014688
863 Ga0075430_100004920
864 Ga0075431_100058710
865 Ga0075431_100112689
866 Ga0075429_100004785
867 Ga0075429_100013242
868 Ga0075429_100022401
869 Ga0075429_100059697
870 Ga0068865_100031052
871 Ga0068865_100143641
872 Ga0097620_100000006
873 Ga0097620_100043648
874 Ga0097620_100055565
875 Ga0097620_100076849
876 Ga0097620_100090075
877 Ga0097620_100276522
878 Ga0097620_100441314
879 Ga0097620_100470639
880 Ga0105240_10003164
881 Ga0105240_10022849
882 Ga0105240_10037496
883 Ga0105240_10050750
884 Ga0105240_10051677
885 Ga0105240_10072721
886 Ga0105240_10164462
887 Ga0111539_10209325
888 Ga0111539_10417824
889 Ga0111539_10556141
890 Ga0111539_10774045
891 Ga0105247_10004725
892 Ga0105247_10007492
893 Ga0114129_10001062
894 Ga0114129_10290216
895 Ga0105243_10184436
896 Ga0105243_10248409
897 Ga0105241_10000324
898 Ga0105241_10002036
899 Ga0105241_10006293
900 Ga0105241_10042016
901 Ga0105241_10417594
902 Ga0105242_10005785
903 Ga0105242_10028617
904 Ga0105242_10058511
905 Ga0105242_10238699
906 Ga0105248_10236734
907 Ga0105248_10445460
908 Ga0105237_10000144
909 Ga0105237_10003823
910 Ga0105237_10006111
911 Ga0105237_10033838
912 Ga0105237_10346767
913 Ga0105238_10005010
914 Ga0105238_10256291
915 Ga0105238_10259217
916 Ga0105249_10001056
917 Ga0105249_10002054
918 Ga0105249_10007493
919 Ga0105249_10011216
920 Ga0105249_10053452
921 Ga0105249_10075154
922 Ga0105249_10742256
923 Ga0105239_10000488
924 Ga0105239_10000925
925 Ga0105239_10010461
926 Ga0105239_10011188
927 Ga0105239_10016597
928 Ga0105239_10020600
929 Ga0105239_10090488
930 Ga0105246_10091029
931 Ga0105246_10363290
932 Ga0157373_10008679
933 Ga0157371_10000451
934 Ga0157371_10001626
935 Ga0157371_10152895
936 Ga0157371_10230889
937 Ga0157371_10577840
938 Ga0157370_10003865
939 Ga0157370_10006839
940 Ga0157370_10007606
941 Ga0157370_10089403
942 Ga0157370_10175065
943 Ga0157370_10391791
944 Ga0157370_10743179
945 Ga0157369_10007223
946 Ga0157369_10037669
947 Ga0157369_10227713
948 Ga0157374_10000013
949 Ga0157374_10024890
950 Ga0157374_10107475
951 Ga0157374_10398592
952 Ga0157378_10048214
953 Ga0157378_10091377
954 Ga0157378_10171743
955 Ga0157378_10268289
956 Ga0163162_10000112
957 Ga0163162_10000253
958 Ga0163162_10002447
959 Ga0163162_11301536
960 Ga0157372_10000667
961 Ga0157372_10071033
962 Ga0157372_10327274
963 Ga0157372_10349849
964 Ga0157375_10088688
965 Ga0157375_10154229
966 Ga0157375_10209843
967 Ga0157375_10361412
968 Ga0157375_10400674
969 Ga0163163_10470739
970 Ga0157380_10004180
971 Ga0157380_10055627
972 Ga0157380_10099713
973 Ga0157380_10101875
974 Ga0157380_10281935
975 Ga0157380_10431861
976 Ga0157377_10017312
977 Ga0157377_10017363
978 Ga0157377_10504318
979 Ga0157379_10005275
980 Ga0157379_10029944
981 Ga0157379_10380303
982 Ga0157376_10001570
983 Ga0157376_10070136
984 Ga0157376_10152746
985 Ga0157376_10153384
986 Ga0157376_10230195
987 Ga0163161_10040483
988 Ga0163161_10068270
989 Ga0163161_10075295
990 Ga0163161_10157142
991 Ga0163161_10237323
992 Ga0163161_10288960
993 Ga0163161_10719308
994 Ga0213876_10016061
995 Ga0207426_1000059
996 Ga0207697_10013942
997 Ga0207656_10085275
998 Ga0207682_10161128
999 Ga0207642_10054219
1000 Ga0207710_10002364
1001 Ga0207680_10020915
1002 Ga0207680_10324646
1003 Ga0207647_10064086
1004 Ga0207647_10108484
1005 Ga0207685_10114091
1006 Ga0207645_10020710
1007 Ga0207645_10027483
1008 Ga0207645_10121810
1009 Ga0207643_10012716
1010 Ga0207643_10091760
1011 Ga0207705_10216977
1012 Ga0207654_10002079
1013 Ga0207654_10009816
1014 Ga0207654_10055609
1015 Ga0207695_10000056
1016 Ga0207695_10001122
1017 Ga0207695_10010840
1018 Ga0207695_10027732
1019 Ga0207695_10028609
1020 Ga0207695_10063527
1021 Ga0207671_10000453
1022 Ga0207671_10001502
1023 Ga0207671_10001511
1024 Ga0207671_10085996
1025 Ga0207660_10072945
1026 Ga0207662_10014896
1027 Ga0207662_10060356
1028 Ga0207657_10005517
1029 Ga0207657_10046739
1030 Ga0207657_10115053
1031 Ga0207649_10179546
1032 Ga0207649_10208190
1033 Ga0207652_10009486
1034 Ga0207652_10405891
1035 Ga0207646_10012637
1036 Ga0207646_10212194
1037 Ga0207646_10473547
1038 Ga0207681_10057701
1039 Ga0207681_10564845
1040 Ga0207694_10106310
1041 Ga0207650_10012500
1042 Ga0207650_10047529
1043 Ga0207650_10103533
1044 Ga0207650_10170423
1045 Ga0207659_10004571
1046 Ga0207659_10012861
1047 Ga0207659_10477265
1048 Ga0207644_10123395
1049 Ga0207644_10354278
1050 Ga0207690_10317204
1051 Ga0207706_10067636
1052 Ga0207706_10228136
1053 Ga0207686_10000351
1054 Ga0207686_10169185
1055 Ga0207709_10169214
1056 Ga0207670_10048806
1057 Ga0207670_10062784
1058 Ga0207670_10432955
1059 Ga0207670_10523278
1060 Ga0207669_10817614
1061 Ga0207704_10126127
1062 Ga0207704_10134502
1063 Ga0207691_10055953
1064 Ga0207691_10075209
1065 Ga0207691_10081826
1066 Ga0207691_10145305
1067 Ga0207691_10300203
1068 Ga0207691_10320367
1069 Ga0207711_10078140
1070 Ga0207689_10001492
1071 Ga0207689_10086393
1072 Ga0207689_10104175
1073 Ga0207661_10803567
1074 Ga0207679_10029827
1075 Ga0207667_10007821
1076 Ga0207667_10075292
1077 Ga0207667_10134911
1078 Ga0207667_10150742
1079 Ga0207667_10155683
1080 Ga0207651_10109139
1081 Ga0207651_10147807
1082 Ga0207651_10168833
1083 Ga0207651_10232759
1084 Ga0207651_10586049
1085 Ga0207712_10001599
1086 Ga0207712_10003428
1087 Ga0207712_10005438
1088 Ga0207712_10014496
1089 Ga0207712_10031442
1090 Ga0207712_10319151
1091 Ga0207668_10333519
1092 Ga0207668_10435833
1093 Ga0207658_10010564
1094 Ga0207658_10032675
1095 Ga0207658_10042638
1096 Ga0207677_10045716
1097 Ga0207677_10153583
1098 Ga0207677_10229345
1099 Ga0207703_10002804
1100 Ga0207639_10012512
1101 Ga0207639_10054200
1102 Ga0207639_10085015
1103 Ga0207639_10088393
1104 Ga0207639_10142613
1105 Ga0207639_10160505
1106 Ga0207639_10413219
1107 Ga0207708_10120038
1108 Ga0207708_10348786
1109 Ga0207702_10230502
1110 Ga0207641_10000058
1111 Ga0207641_10043574
1112 Ga0207641_10166367
1113 Ga0207648_10022185
1114 Ga0207648_10102681
1115 Ga0207648_10118817
1116 Ga0207648_10185389
1117 Ga0207676_10014686
1118 Ga0207676_10045785
1119 Ga0207676_10238300
1120 Ga0207676_10282148
1121 Ga0207674_10008410
1122 Ga0207674_10008703
1123 Ga0207674_10101275
1124 Ga0207674_10787100
1125 Ga0207675_100000153
1126 Ga0207675_100003754
1127 Ga0207675_100027008
1128 Ga0207675_100100301
1129 Ga0207675_100140758
1130 Ga0207683_10011891
1131 Ga0207683_10037605
1132 Ga0207683_10245750
1133 Ga0207683_10390413
1134 Ga0207698_10007272
1135 Ga0207698_10055959
1136 Ga0207698_10063132
1137 Ga0207698_10172973
1138 Ga0207698_10391926
1139 Ga0207428_10033842
1140 Ga0268265_10006773
1141 Ga0268265_10082385
1142 Ga0268265_10144805
1143 Ga0268265_10195834
1144 Ga0268264_10000726
1145 Ga0268264_10063815
1146 Ga0268264_10490517
1147 Ga0268264_10597587
1148 Ga0307517_10219728
1149 Ga0307515_10000059
1150 Ga0307515_10192629
1151 Ga0307511_10000181
1152 Ga0265327_10000172
1153 Ga0307513_10030476
1154 Ga0307513_10348214
1155 Ga0307513_10377596
1156 Ga0307509_10013918
1157 Ga0307509_10093902
1158 Ga0307509_10151950
1159 Ga0307408_100285963
1160 Ga0307508_10000485
1161 Ga0307508_10057484
1162 Ga0307516_10170989
1163 Ga0307516_10202111
1164 Ga0307405_10054867
1165 Ga0307405_10184986
1166 Ga0307413_10048737
1167 Ga0307412_10524207
1168 Ga0307409_100256882
1169 Ga0307416_100007276
1170 Ga0307414_10050346
1171 Ga0373935_0088048
1172 Ga0395900_0456266
1173 Ga0395898_0658837
1174 Ga0395905_0000002
1175 Ga0436364_1006406
1176 Ga0395901_0002140
1177 Ga0395901_0838566
1178 Ga0436365_1001352
1179 Ga0439436_0004748
1180 Ga0439439_0001927
1181 Ga0439439_0080627
1182 Ga0439465_0108527
1183 Ga0451791_1381310
1184 Ga0451800_1146729
1185 Ga0451800_1377849
1186 Ga0451807_0414922
1187 Ga0451841_1354039
1188 Ga0451845_0011729
1189 Ga0451847_0209969
1190 Ga0451853_2563909
1191 Ga0439442_039304
1192 Ga0439449_0015126
1193 Ga0439457_000277
1194 Ga0439462_0062632
1195 Ga0439434_0130367
1196 Ga0451577_0001932
1197 Ga0451577_0210143
1198 Ga0466969_0000190
1199 Ga0466969_0054828
1200 Ga0466972_0000168
1201 Ga0466972_0000337
1202 Ga0466972_0007731
1203 Ga0453683_0083947
1204 Ga0466966_0013541
1205 Ga0466966_0075817
1206 Ga0466966_0395256
1207 Ga0466961_0064427
1208 Ga0466961_0110285
1209 Ga0466961_0119342
1210 Ga0453684_0318611
1211 Ga0466971_0003048
1212 Ga0466971_0167919
1213 Ga0466970_0018702
1214 Ga0466970_0018946
1215 Ga0466957_0000428
1216 Ga0466957_0001546
1217 Ga0466959_0000003
1218 Ga0466959_0000488
1219 Ga0466959_0067262
1220 Ga0466967_0269720
1221 Ga0466967_0527085
1222 Ga0495638_0120656
1223 Ga0495580_0401459
1224 Ga0495642_0016639
1225 Ga0495668_0000302
1226 Ga0495611_0000061
1227 Ga0495635_0153703
1228 Ga0495600_0411156
1229 Ga0495672_0005682
1230 Ga0495672_0018449
1231 Ga0495672_0234052
1232 Ga0495686_0000010
1233 Ga0495686_0012477
1234 Ga0495686_0284601
1235 Ga0496110_0589746
1236 Ga0496115_0008884
1237 Ga0501031_0303091
1238 Ga0501032_0010324
1239 Ga0501033_0385959
1240 Ga0501033_0398674
1241 Ga0501034_0000004
1242 Ga0501034_0013427
1243 Ga0501034_0043155
1244 Ga0501034_0061010
1245 Ga0501034_0148138
1246 Ga0501034_0459750
1247 Ga0501036_0022006
1248 Ga0501036_0568815
1249 Ga0501036_0639647
1250 Ga0501037_0131682
1251 Ga0501037_0348103
1252 Ga0501038_0015262
1253 Ga0501038_0226201
1254 Ga0501039_0040701
1255 Ga0501039_0076399
1256 Ga0501040_0024014
1257 Ga0501040_0138935
1258 Ga0501042_0049268
1259 Ga0501042_0203698
1260 Ga0501043_0010690
1261 Ga0501043_0117068
1262 Ga0501043_0572441
1263 Ga0501046_0005998
1264 Ga0501046_0055861
1265 Ga0501046_0214974
1266 Ga0501047_0009030
1267 Ga0501047_0019423
1268 Ga0501047_0156907
1269 Ga0501047_0170288
1270 Ga0501048_0267987
1271 Ga0501067_0278172
1272 Ga0501068_0078592
1273 Ga0501068_0191671
1274 Ga0501070_0006613
1275 Ga0501070_0019796
1276 Ga0501071_0010198
1277 Ga0501072_0004554
1278 Ga0501072_0164130
1279 Ga0501073_0100011
1280 Ga0501074_0004746
1281 Ga0501074_0453491
1282 Ga0501075_0007589
1283 Ga0501076_0103654
1284 Ga0501076_0528909
1285 Ga0501077_0009648
1286 Ga0501077_0083098
1287 Ga0501206_019297
1288 Ga0501207_000200
1289 Ga0501243_037238
1290 Ga0501219_000321
1291 Ga0501225_0003367
1292 Ga0501079_0005805
1293 Ga0501079_0042780
1294 Ga0501079_0177956
1295 Ga0501080_0033622
1296 Ga0501080_0057387
1297 Ga0501081_0006944
1298 Ga0501083_0041069
1299 Ga0501083_0074150
1300 Ga0501083_0129585
1301 Ga0501035_0023355
1302 Ga0501035_0028623
1303 Ga0501035_0038469
1304 Ga0501035_0110505
1305 Ga0501044_0009878
1306 Ga0501044_0081954
1307 Ga0501044_0095326
1308 Ga0501045_0574996
1309 Ga0501284_00001
1310 nmdc:mga0k408_47296_c1
1311 nmdc:mga0k408_53148_c1
1312 nmdc:mga0k408_54390_c1
1313 nmdc:mga0k408_55646_c1
1314 nmdc:mga0k408_68441_c1
1315 nmdc:mga07m45_365277_c1
1316 nmdc:mga05p37_235046_c1
1317 nmdc:mga05p37_482_c1
1318 nmdc:mga09592_17643_c1
1319 nmdc:mga09592_5311_c1
1320 nmdc:mga0qj67_4695_c1
1321 nmdc:mga0qj67_71409_c1
1322 nmdc:mga06r32_13475_c1
1323 nmdc:mga06r32_28324_c1
1324 nmdc:mga06r32_352998_c1
1325 nmdc:mga08y16_295698_c1
1326 nmdc:mga08y16_360998_c1
1327 nmdc:mga08y16_54079_c1
1328 nmdc:mga08y16_733552_c1
1329 Ga0500578_0001290
1330 Ga0500578_0129817
1331 Ga0500644_0157097
1332 Ga0500646_0007918
1333 Ga0500583_0000019
1334 Ga0500583_0004286
1335 Ga0500651_0181427
1336 Ga0500554_040399
1337 Ga0500594_0063049
1338 Ga0500658_0045886
1339 Ga0500568_0000208
1340 Ga0500573_0138055
1341 Ga0500588_0125342
1342 Ga0500588_0163015
1343 Ga0500616_0276094
1344 Ga0500622_0160846
1345 Ga0500636_0156465
1346 Ga0500637_0010936
1347 Ga0500611_000001
1348 Ga0501084_0041252
1349 Ga0501084_0108657
1350 Ga0501084_0118061
1351 Ga0501082_0005462
1352 Ga0466962_0001581
1353 Ga0530510_0079881
1354 2738725043
1355 2819585597
1356 3003235196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

41

250

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bnf-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with utp 0.922 1 237
2bnf-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with utp 0.9183 1 237
2bnd-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with udp 0.9176 1 237
2v4y-assembly1.cif.gz_C the structure of e. coli ump kinase in complex with its allosteric regulator gtp 0.9168 1 237
2bne-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with ump 0.9164 1 237
ID Description Score Start End Superfamily
af_P9WHK5_22_261_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9145 2 237 3.40.1160.10
2jjxC00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9088 5 236 3.40.1160.10
af_A0A1D6G3Z5_82_358_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9055 2 237 3.40.1160.10
3ek5B00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9048 1 237 3.40.1160.10
af_P9WHK5_22_261_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9034 2 237 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A520QIF5-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9969 140 237 GO:0005524
GO:0006225
GO:0033862
AF-A0A520QIF5-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9869 140 237 GO:0005524
GO:0006225
GO:0033862
AF-A0A359HF64-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9826 146 237 GO:0005524
GO:0006225
GO:0033862
AF-A0A3N5N269-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9789 137 237 GO:0005524
GO:0006225
GO:0033862
AF-Q4BV13-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9775 146 237 GO:0005524
GO:0006225
GO:0033862

Map