F474628
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 678 | 271 | 678 | 94 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100273950|Ga0070714_1002739501 |
| Length | 101 |
| Sequence | MPYAPGMPLFILLSTLSQQGVQTLKSNPERLRQVNRDVEELGAKVLHQWATLGEFDFVNVVEAADVETIAKVSVALGARGSTRIETLPALEIEHFLQTLSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 75 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 109 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 110 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 111 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 112 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 113 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 114 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 115 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 118 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 119 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 120 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 129 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 130 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 131 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 132 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 133 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 134 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 135 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 136 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 137 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 138 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 139 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 140 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 141 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 142 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 143 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 145 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 146 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 147 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 155 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 156 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 157 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 158 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 159 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 160 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 161 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 162 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 163 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 164 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 165 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 166 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 167 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 168 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 169 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 170 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 171 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 172 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 173 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 174 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 175 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 176 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 225 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 230 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 233 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 264 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 271 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.05 |
| Metatranscriptomes | 2.95 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 8.11 |
| Rhizosphere | 90.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10821782 | 3300005295 | Bacteria | 592 |
| 2 | Ga0070658_10021374 | 3300005327 | Bacteria | 5186 |
| 3 | Ga0070658_10040945 | 3300005327 | Bacteria | 3737 |
| 4 | Ga0070658_10141706 | 3300005327 | Bacteria | 2008 |
| 5 | Ga0070658_10783245 | 3300005327 | Bacteria | 828 |
| 6 | Ga0070658_10843920 | 3300005327 | Unclassified | 796 |
| 7 | Ga0070658_12001161 | 3300005327 | Unclassified | 500 |
| 8 | Ga0070683_100014698 | 3300005329 | Bacteria | 6857 |
| 9 | Ga0070683_100020650 | 3300005329 | Bacteria | 5863 |
| 10 | Ga0070683_100031073 | 3300005329 | Bacteria | 4852 |
| 11 | Ga0070683_100291229 | 3300005329 | Bacteria | 1553 |
| 12 | Ga0070680_100056475 | 3300005336 | Bacteria | 3208 |
| 13 | Ga0070680_100269672 | 3300005336 | Unclassified | 1441 |
| 14 | Ga0070680_100467451 | 3300005336 | Bacteria | 1078 |
| 15 | Ga0070682_100387730 | 3300005337 | Bacteria | 1053 |
| 16 | Ga0068868_100335390 | 3300005338 | Bacteria | 1292 |
| 17 | Ga0070660_100017422 | 3300005339 | Bacteria | 5236 |
| 18 | Ga0070660_100049844 | 3300005339 | Bacteria | 3220 |
| 19 | Ga0070660_101321331 | 3300005339 | Unclassified | 612 |
| 20 | Ga0070660_101794307 | 3300005339 | Bacteria | 523 |
| 21 | Ga0070691_10274037 | 3300005341 | Bacteria | 913 |
| 22 | Ga0070661_100044592 | 3300005344 | Bacteria | 3239 |
| 23 | Ga0070659_101109324 | 3300005366 | Bacteria | 697 |
| 24 | Ga0070667_101174723 | 3300005367 | Unclassified | 718 |
| 25 | Ga0070709_10635926 | 3300005434 | Unclassified | 825 |
| 26 | Ga0070714_100020688 | 3300005435 | Bacteria | 5378 |
| 27 | Ga0070714_100094704 | 3300005435 | Bacteria | 2621 |
| 28 | Ga0070714_100138448 | 3300005435 | Bacteria | 2182 |
| 29 | Ga0070714_100273950 | 3300005435 | Bacteria | 1566 |
| 30 | Ga0070714_100528123 | 3300005435 | Bacteria | 1128 |
| 31 | Ga0070714_100533785 | 3300005435 | Bacteria | 1122 |
| 32 | Ga0070714_100589247 | 3300005435 | Archaea | 1067 |
| 33 | Ga0070714_101516646 | 3300005435 | Bacteria | 655 |
| 34 | Ga0070714_101735191 | 3300005435 | Unclassified | 610 |
| 35 | Ga0070714_101858748 | 3300005435 | Bacteria | 588 |
| 36 | Ga0070714_101889914 | 3300005435 | Unclassified | 583 |
| 37 | Ga0070714_102513187 | 3300005435 | Unclassified | 500 |
| 38 | Ga0070713_100119772 | 3300005436 | Unclassified | 2307 |
| 39 | Ga0070713_102365723 | 3300005436 | Bacteria | 514 |
| 40 | Ga0070710_10175128 | 3300005437 | Unclassified | 1339 |
| 41 | Ga0070710_10593691 | 3300005437 | Bacteria | 770 |
| 42 | Ga0070701_10829418 | 3300005438 | Bacteria | 633 |
| 43 | Ga0070711_100049404 | 3300005439 | Bacteria | 2881 |
| 44 | Ga0070711_100384353 | 3300005439 | Bacteria | 1136 |
| 45 | Ga0070705_100517370 | 3300005440 | Bacteria | 909 |
| 46 | Ga0070708_100397865 | 3300005445 | Bacteria | 1299 |
| 47 | Ga0070708_100653065 | 3300005445 | Bacteria | 991 |
| 48 | Ga0070663_100553450 | 3300005455 | Unclassified | 962 |
| 49 | Ga0070663_101407142 | 3300005455 | Bacteria | 618 |
| 50 | Ga0070678_100262227 | 3300005456 | Bacteria | 1454 |
| 51 | Ga0070678_100664440 | 3300005456 | Bacteria | 936 |
| 52 | Ga0070681_10019900 | 3300005458 | Bacteria | 6726 |
| 53 | Ga0070681_10161994 | 3300005458 | Bacteria | 2161 |
| 54 | Ga0070681_10302264 | 3300005458 | Unclassified | 1510 |
| 55 | Ga0070681_10492540 | 3300005458 | Bacteria | 1139 |
| 56 | Ga0068867_101077209 | 3300005459 | Unclassified | 733 |
| 57 | Ga0070706_100414084 | 3300005467 | Bacteria | 1255 |
| 58 | Ga0070707_100509886 | 3300005468 | Bacteria | 1165 |
| 59 | Ga0070707_100777730 | 3300005468 | Bacteria | 921 |
| 60 | Ga0070707_100888074 | 3300005468 | Bacteria | 856 |
| 61 | Ga0070698_101565635 | 3300005471 | Bacteria | 611 |
| 62 | Ga0070699_100364724 | 3300005518 | Bacteria | 1303 |
| 63 | Ga0070699_101561117 | 3300005518 | Bacteria | 605 |
| 64 | Ga0070679_100065073 | 3300005530 | Bacteria | 3634 |
| 65 | Ga0070679_100109947 | 3300005530 | Bacteria | 2742 |
| 66 | Ga0070679_100167364 | 3300005530 | Bacteria | 2171 |
| 67 | Ga0070679_100895170 | 3300005530 | Unclassified | 831 |
| 68 | Ga0070679_101210101 | 3300005530 | Unclassified | 701 |
| 69 | Ga0070679_101586879 | 3300005530 | Bacteria | 602 |
| 70 | Ga0070684_100058628 | 3300005535 | Bacteria | 3365 |
| 71 | Ga0070684_100059382 | 3300005535 | Bacteria | 3343 |
| 72 | Ga0070684_100410114 | 3300005535 | Bacteria | 1250 |
| 73 | Ga0070684_101738357 | 3300005535 | Bacteria | 588 |
| 74 | Ga0070697_100529133 | 3300005536 | Bacteria | 1032 |
| 75 | Ga0070697_101551672 | 3300005536 | Bacteria | 592 |
| 76 | Ga0068853_101339029 | 3300005539 | Unclassified | 692 |
| 77 | Ga0070695_100534343 | 3300005545 | Bacteria | 912 |
| 78 | Ga0070695_100705813 | 3300005545 | Bacteria | 801 |
| 79 | Ga0068855_100103445 | 3300005563 | Bacteria | 3276 |
| 80 | Ga0068855_100480351 | 3300005563 | Bacteria | 1353 |
| 81 | Ga0068855_102519068 | 3300005563 | Bacteria | 512 |
| 82 | Ga0070664_101260651 | 3300005564 | Unclassified | 698 |
| 83 | Ga0068857_100098496 | 3300005577 | Bacteria | 2622 |
| 84 | Ga0068856_100168136 | 3300005614 | Bacteria | 2204 |
| 85 | Ga0068856_101040788 | 3300005614 | Bacteria | 836 |
| 86 | Ga0068856_101108220 | 3300005614 | Bacteria | 809 |
| 87 | Ga0070702_100557016 | 3300005615 | Bacteria | 852 |
| 88 | Ga0068852_100320733 | 3300005616 | Bacteria | 1505 |
| 89 | Ga0068870_10052226 | 3300005840 | Bacteria | 2167 |
| 90 | Ga0068863_101741703 | 3300005841 | Unclassified | 633 |
| 91 | Ga0081455_10020969 | 3300005937 | Bacteria | 6140 |
| 92 | Ga0070717_10206692 | 3300006028 | Unclassified | 1722 |
| 93 | Ga0070717_10420690 | 3300006028 | Unclassified | 1202 |
| 94 | Ga0070717_10901160 | 3300006028 | Unclassified | 805 |
| 95 | Ga0070717_10989482 | 3300006028 | Bacteria | 766 |
| 96 | Ga0070717_11300949 | 3300006028 | Bacteria | 661 |
| 97 | Ga0070717_11847699 | 3300006028 | Bacteria | 546 |
| 98 | Ga0070717_12024794 | 3300006028 | Bacteria | 519 |
| 99 | Ga0070712_100013377 | 3300006175 | Bacteria | 5243 |
| 100 | Ga0070712_100467619 | 3300006175 | Bacteria | 1052 |
| 101 | Ga0070712_100939653 | 3300006175 | Bacteria | 747 |
| 102 | Ga0097621_102391097 | 3300006237 | Bacteria | 506 |
| 103 | Ga0068871_100981371 | 3300006358 | Bacteria | 786 |
| 104 | Ga0075434_100256343 | 3300006871 | Bacteria | 1768 |
| 105 | Ga0075434_101123386 | 3300006871 | Bacteria | 799 |
| 106 | Ga0068865_100498195 | 3300006881 | Unclassified | 1015 |
| 107 | Ga0099795_10381309 | 3300007788 | Archaea | 636 |
| 108 | Ga0105240_10255691 | 3300009093 | Bacteria | 2023 |
| 109 | Ga0105240_10488401 | 3300009093 | Bacteria | 1371 |
| 110 | Ga0105245_10883840 | 3300009098 | Unclassified | 935 |
| 111 | Ga0105245_11363227 | 3300009098 | Bacteria | 759 |
| 112 | Ga0105245_11435914 | 3300009098 | Bacteria | 740 |
| 113 | Ga0114129_12987954 | 3300009147 | Unclassified | 556 |
| 114 | Ga0105241_11386207 | 3300009174 | Unclassified | 672 |
| 115 | Ga0105248_10682833 | 3300009177 | Unclassified | 1158 |
| 116 | Ga0105238_11388797 | 3300009551 | Bacteria | 729 |
| 117 | Ga0157373_10182999 | 3300013100 | Bacteria | 1475 |
| 118 | Ga0157373_10411135 | 3300013100 | Bacteria | 970 |
| 119 | Ga0157373_10921079 | 3300013100 | Unclassified | 649 |
| 120 | Ga0157371_10172416 | 3300013102 | Bacteria | 1546 |
| 121 | Ga0157370_10032471 | 3300013104 | Bacteria | 5098 |
| 122 | Ga0157370_10088924 | 3300013104 | Bacteria | 2901 |
| 123 | Ga0157370_10346077 | 3300013104 | Bacteria | 1370 |
| 124 | Ga0157370_10976749 | 3300013104 | Bacteria | 767 |
| 125 | Ga0157370_11142537 | 3300013104 | Bacteria | 703 |
| 126 | Ga0157369_10003200 | 3300013105 | Bacteria | 19524 |
| 127 | Ga0157369_10004869 | 3300013105 | Bacteria | 15753 |
| 128 | Ga0157369_10626808 | 3300013105 | Bacteria | 1109 |
| 129 | Ga0157369_10694822 | 3300013105 | Bacteria | 1048 |
| 130 | Ga0157369_11648417 | 3300013105 | Bacteria | 652 |
| 131 | Ga0157369_11823415 | 3300013105 | Unclassified | 618 |
| 132 | Ga0157369_12403477 | 3300013105 | Unclassified | 534 |
| 133 | Ga0157374_11132829 | 3300013296 | Unclassified | 803 |
| 134 | Ga0157374_12746538 | 3300013296 | Unclassified | 520 |
| 135 | Ga0157378_13046789 | 3300013297 | Bacteria | 520 |
| 136 | Ga0163162_13067028 | 3300013306 | Unclassified | 536 |
| 137 | Ga0157372_10590391 | 3300013307 | Bacteria | 1295 |
| 138 | Ga0157372_11454430 | 3300013307 | Bacteria | 790 |
| 139 | Ga0157372_13460984 | 3300013307 | Unclassified | 502 |
| 140 | Ga0157375_11264911 | 3300013308 | Bacteria | 867 |
| 141 | Ga0163163_10941083 | 3300014325 | Unclassified | 927 |
| 142 | Ga0182008_10005314 | 3300014497 | Bacteria | 7353 |
| 143 | Ga0157376_10140291 | 3300014969 | Bacteria | 2167 |
| 144 | Ga0157376_10305385 | 3300014969 | Archaea | 1508 |
| 145 | Ga0182006_1025671 | 3300015261 | Bacteria | 2418 |
| 146 | Ga0182007_10076073 | 3300015262 | Unclassified | 1100 |
| 147 | Ga0182007_10427022 | 3300015262 | Bacteria | 508 |
| 148 | Ga0197907_10267437 | 3300020069 | Bacteria | 1671 |
| 149 | Ga0197907_10963986 | 3300020069 | Unclassified | 1285 |
| 150 | Ga0197907_11254682 | 3300020069 | Bacteria | 608 |
| 151 | Ga0206356_10174204 | 3300020070 | Unclassified | 1090 |
| 152 | Ga0206356_10701452 | 3300020070 | Bacteria | 1493 |
| 153 | Ga0206356_11028757 | 3300020070 | Bacteria | 750 |
| 154 | Ga0206356_11192081 | 3300020070 | Bacteria | 1402 |
| 155 | Ga0206356_11883155 | 3300020070 | Bacteria | 2235 |
| 156 | Ga0206352_10574231 | 3300020078 | Bacteria | 501 |
| 157 | Ga0206354_10004548 | 3300020081 | Unclassified | 1596 |
| 158 | Ga0206354_10142278 | 3300020081 | Bacteria | 5542 |
| 159 | Ga0206354_10301941 | 3300020081 | Unclassified | 1091 |
| 160 | Ga0206353_10051125 | 3300020082 | Bacteria | 4168 |
| 161 | Ga0206353_10282100 | 3300020082 | Bacteria | 584 |
| 162 | Ga0206353_10317063 | 3300020082 | Bacteria | 650 |
| 163 | Ga0154015_1261422 | 3300020610 | Unclassified | 715 |
| 164 | Ga0224712_10195365 | 3300022467 | Bacteria | 918 |
| 165 | Ga0224712_10275473 | 3300022467 | Unclassified | 782 |
| 166 | Ga0207692_10439431 | 3300025898 | Unclassified | 819 |
| 167 | Ga0207710_10488447 | 3300025900 | Unclassified | 638 |
| 168 | Ga0207680_11176960 | 3300025903 | Bacteria | 547 |
| 169 | Ga0207699_10348603 | 3300025906 | Unclassified | 1045 |
| 170 | Ga0207643_10163680 | 3300025908 | Unclassified | 1339 |
| 171 | Ga0207705_10129920 | 3300025909 | Bacteria | 1874 |
| 172 | Ga0207705_10132690 | 3300025909 | Bacteria | 1854 |
| 173 | Ga0207705_10314570 | 3300025909 | Bacteria | 1202 |
| 174 | Ga0207705_10411764 | 3300025909 | Bacteria | 1046 |
| 175 | Ga0207705_10509120 | 3300025909 | Bacteria | 935 |
| 176 | Ga0207705_11029514 | 3300025909 | Unclassified | 636 |
| 177 | Ga0207705_11339239 | 3300025909 | Bacteria | 546 |
| 178 | Ga0207684_11031966 | 3300025910 | Unclassified | 687 |
| 179 | Ga0207707_10018384 | 3300025912 | Bacteria | 6093 |
| 180 | Ga0207707_10061795 | 3300025912 | Bacteria | 3260 |
| 181 | Ga0207707_10143675 | 3300025912 | Bacteria | 2086 |
| 182 | Ga0207707_10230075 | 3300025912 | Bacteria | 1613 |
| 183 | Ga0207707_10475833 | 3300025912 | Unclassified | 1067 |
| 184 | Ga0207695_10213205 | 3300025913 | Bacteria | 1841 |
| 185 | Ga0207695_10779961 | 3300025913 | Unclassified | 836 |
| 186 | Ga0207693_11117481 | 3300025915 | Bacteria | 598 |
| 187 | Ga0207693_11429629 | 3300025915 | Unclassified | 512 |
| 188 | Ga0207663_10525687 | 3300025916 | Bacteria | 922 |
| 189 | Ga0207663_10885437 | 3300025916 | Unclassified | 713 |
| 190 | Ga0207663_11683109 | 3300025916 | Unclassified | 510 |
| 191 | Ga0207660_10079442 | 3300025917 | Bacteria | 2406 |
| 192 | Ga0207660_10232325 | 3300025917 | Unclassified | 1450 |
| 193 | Ga0207660_11094667 | 3300025917 | Bacteria | 649 |
| 194 | Ga0207657_10001104 | 3300025919 | Bacteria | 28627 |
| 195 | Ga0207657_10002919 | 3300025919 | Bacteria | 18353 |
| 196 | Ga0207657_10014969 | 3300025919 | Bacteria | 7536 |
| 197 | Ga0207657_10017609 | 3300025919 | Bacteria | 6845 |
| 198 | Ga0207657_10968257 | 3300025919 | Bacteria | 654 |
| 199 | Ga0207649_10102721 | 3300025920 | Bacteria | 1895 |
| 200 | Ga0207652_10004470 | 3300025921 | Bacteria | 11386 |
| 201 | Ga0207652_10062411 | 3300025921 | Bacteria | 3220 |
| 202 | Ga0207652_10174843 | 3300025921 | Bacteria | 1928 |
| 203 | Ga0207652_10376325 | 3300025921 | Bacteria | 1282 |
| 204 | Ga0207652_10727539 | 3300025921 | Unclassified | 884 |
| 205 | Ga0207652_11215059 | 3300025921 | Bacteria | 656 |
| 206 | Ga0207652_11478857 | 3300025921 | Unclassified | 583 |
| 207 | Ga0207646_10404079 | 3300025922 | Bacteria | 1233 |
| 208 | Ga0207646_10523944 | 3300025922 | Bacteria | 1067 |
| 209 | Ga0207646_10969086 | 3300025922 | Bacteria | 752 |
| 210 | Ga0207694_10869289 | 3300025924 | Bacteria | 762 |
| 211 | Ga0207687_10166702 | 3300025927 | Unclassified | 1695 |
| 212 | Ga0207687_10866207 | 3300025927 | Unclassified | 772 |
| 213 | Ga0207687_11205473 | 3300025927 | Bacteria | 651 |
| 214 | Ga0207700_10213771 | 3300025928 | Bacteria | 1632 |
| 215 | Ga0207700_10608692 | 3300025928 | Bacteria | 973 |
| 216 | Ga0207700_11740099 | 3300025928 | Bacteria | 549 |
| 217 | Ga0207664_10015703 | 3300025929 | Bacteria | 5505 |
| 218 | Ga0207664_10094534 | 3300025929 | Bacteria | 2457 |
| 219 | Ga0207664_10118480 | 3300025929 | Bacteria | 2212 |
| 220 | Ga0207664_10129785 | 3300025929 | Bacteria | 2120 |
| 221 | Ga0207664_10315288 | 3300025929 | Archaea | 1379 |
| 222 | Ga0207664_10438572 | 3300025929 | Bacteria | 1165 |
| 223 | Ga0207664_10990639 | 3300025929 | Bacteria | 753 |
| 224 | Ga0207644_11295996 | 3300025931 | Bacteria | 612 |
| 225 | Ga0207690_10677409 | 3300025932 | Bacteria | 847 |
| 226 | Ga0207690_11497017 | 3300025932 | Bacteria | 564 |
| 227 | Ga0207711_11105077 | 3300025941 | Bacteria | 734 |
| 228 | Ga0207661_10024364 | 3300025944 | Bacteria | 4586 |
| 229 | Ga0207661_10105571 | 3300025944 | Bacteria | 2374 |
| 230 | Ga0207661_10121159 | 3300025944 | Bacteria | 2227 |
| 231 | Ga0207661_10151018 | 3300025944 | Bacteria | 2008 |
| 232 | Ga0207661_10242465 | 3300025944 | Bacteria | 1600 |
| 233 | Ga0207661_10300026 | 3300025944 | Bacteria | 1440 |
| 234 | Ga0207661_10577904 | 3300025944 | Bacteria | 1031 |
| 235 | Ga0207679_11693600 | 3300025945 | Unclassified | 579 |
| 236 | Ga0207667_10252658 | 3300025949 | Bacteria | 1803 |
| 237 | Ga0207667_10292511 | 3300025949 | Archaea | 1664 |
| 238 | Ga0207667_10765823 | 3300025949 | Bacteria | 964 |
| 239 | Ga0207667_11092245 | 3300025949 | Unclassified | 781 |
| 240 | Ga0207667_11483119 | 3300025949 | Bacteria | 650 |
| 241 | Ga0207667_11630359 | 3300025949 | Unclassified | 613 |
| 242 | Ga0207677_10301787 | 3300026023 | Bacteria | 1323 |
| 243 | Ga0207678_10622041 | 3300026067 | Bacteria | 947 |
| 244 | Ga0207678_11366548 | 3300026067 | Bacteria | 626 |
| 245 | Ga0207702_10038773 | 3300026078 | Bacteria | 3991 |
| 246 | Ga0207702_10133650 | 3300026078 | Bacteria | 2236 |
| 247 | Ga0207702_10157865 | 3300026078 | Bacteria | 2069 |
| 248 | Ga0207702_11954415 | 3300026078 | Unclassified | 577 |
| 249 | Ga0207702_12040999 | 3300026078 | Unclassified | 564 |
| 250 | Ga0207674_10123547 | 3300026116 | Bacteria | 2554 |
| 251 | Ga0207674_10960793 | 3300026116 | Bacteria | 823 |
| 252 | Ga0207683_10704254 | 3300026121 | Bacteria | 936 |
| 253 | Ga0207698_10680292 | 3300026142 | Unclassified | 1022 |
| 254 | Ga0265337_1052546 | 3300028556 | Bacteria | 1144 |
| 255 | Ga0265337_1101504 | 3300028556 | Viruses | 783 |
| 256 | Ga0265326_10158169 | 3300028558 | Unclassified | 648 |
| 257 | Ga0265319_1061665 | 3300028563 | Bacteria | 1216 |
| 258 | Ga0265334_10014296 | 3300028573 | Bacteria | 3310 |
| 259 | Ga0265334_10295814 | 3300028573 | Bacteria | 554 |
| 260 | Ga0265318_10176095 | 3300028577 | Viruses | 783 |
| 261 | Ga0265318_10280087 | 3300028577 | Unclassified | 608 |
| 262 | Ga0265323_10264768 | 3300028653 | Unclassified | 534 |
| 263 | Ga0265322_10129724 | 3300028654 | Bacteria | 719 |
| 264 | Ga0265338_10001061 | 3300028800 | Bacteria | 45726 |
| 265 | Ga0265338_10041024 | 3300028800 | Bacteria | 4336 |
| 266 | Ga0265328_10097393 | 3300031239 | Bacteria | 1088 |
| 267 | Ga0265320_10274347 | 3300031240 | Unclassified | 747 |
| 268 | Ga0265325_10026363 | 3300031241 | Bacteria | 3148 |
| 269 | Ga0265340_10019066 | 3300031247 | Bacteria | 3533 |
| 270 | Ga0265340_10188476 | 3300031247 | Bacteria | 931 |
| 271 | Ga0265331_10045887 | 3300031250 | Unclassified | 2108 |
| 272 | Ga0265327_10009412 | 3300031251 | Bacteria | 7052 |
| 273 | Ga0265314_10438415 | 3300031711 | Bacteria | 698 |
| 274 | Ga0265342_10155564 | 3300031712 | Bacteria | 1267 |
| 275 | Ga0307405_10136991 | 3300031731 | Bacteria | 1701 |
| 276 | Ga0307412_10658301 | 3300031911 | Bacteria | 894 |
| 277 | Ga0307409_100228210 | 3300031995 | Bacteria | 1686 |
| 278 | Ga0307416_100583872 | 3300032002 | Unclassified | 1195 |
| 279 | Ga0307415_100285119 | 3300032126 | Unclassified | 1360 |
| 280 | Ga0316583_10027040 | 3300032133 | Bacteria | 2048 |
| 281 | Ga0373930_0126109 | 3300034816 | Bacteria | 627 |
| 282 | Ga0373926_0064217 | 3300035083 | Unclassified | 1341 |
| 283 | Ga0373926_0335750 | 3300035083 | Bacteria | 592 |
| 284 | Ga0373934_0198865 | 3300035086 | Unclassified | 825 |
| 285 | Ga0373934_0399495 | 3300035086 | Unclassified | 574 |
| 286 | Ga0373944_0417465 | 3300035089 | Bacteria | 519 |
| 287 | Ga0373936_0407129 | 3300035113 | Bacteria | 625 |
| 288 | Ga0373945_0087329 | 3300035116 | Bacteria | 1203 |
| 289 | Ga0373953_0427407 | 3300035117 | Unclassified | 584 |
| 290 | Ga0373956_0027981 | 3300035119 | Bacteria | 2451 |
| 291 | Ga0373956_0208880 | 3300035119 | Bacteria | 926 |
| 292 | Ga0373957_0015440 | 3300035120 | Bacteria | 2628 |
| 293 | Ga0373943_0004151 | 3300035170 | Bacteria | 6576 |
| 294 | Ga0373955_0114068 | 3300035172 | Unclassified | 1565 |
| 295 | Ga0373955_0372242 | 3300035172 | Bacteria | 866 |
| 296 | Ga0373962_0352613 | 3300035242 | Bacteria | 532 |
| 297 | Ga0373924_0065387 | 3300035410 | Bacteria | 1527 |
| 298 | Ga0373924_0169375 | 3300035410 | Unclassified | 960 |
| 299 | Ga0373935_0315059 | 3300035692 | Bacteria | 1109 |
| 300 | Ga0373927_0327335 | 3300035695 | Bacteria | 1009 |
| 301 | Ga0373933_0206893 | 3300035724 | Unclassified | 1257 |
| 302 | Ga0373933_0862788 | 3300035724 | Bacteria | 596 |
| 303 | Ga0373947_1010048 | 3300035725 | Bacteria | 567 |
| 304 | Ga0373937_0029383 | 3300036401 | Bacteria | 4978 |
| 305 | Ga0373937_0251008 | 3300036401 | Bacteria | 1668 |
| 306 | Ga0373937_1988359 | 3300036401 | Unclassified | 527 |
| 307 | Ga0373925_0272133 | 3300037068 | Bacteria | 1363 |
| 308 | Ga0395899_0039816 | 3300037312 | Bacteria | 3516 |
| 309 | Ga0395899_0130952 | 3300037312 | Bacteria | 1791 |
| 310 | Ga0395899_0213646 | 3300037312 | Bacteria | 1339 |
| 311 | Ga0395899_0989986 | 3300037312 | Bacteria | 508 |
| 312 | Ga0395900_0028277 | 3300037418 | Bacteria | 5743 |
| 313 | Ga0395900_0041052 | 3300037418 | Bacteria | 4771 |
| 314 | Ga0395900_0118573 | 3300037418 | Bacteria | 2716 |
| 315 | Ga0395900_0209036 | 3300037418 | Bacteria | 1971 |
| 316 | Ga0395900_0279582 | 3300037418 | Bacteria | 1661 |
| 317 | Ga0395900_0403402 | 3300037418 | Bacteria | 1331 |
| 318 | Ga0395900_0910925 | 3300037418 | Bacteria | 802 |
| 319 | Ga0395900_1357571 | 3300037418 | Unclassified | 624 |
| 320 | Ga0395898_0024624 | 3300037466 | Bacteria | 6070 |
| 321 | Ga0395898_0119584 | 3300037466 | Bacteria | 2524 |
| 322 | Ga0395898_0136399 | 3300037466 | Bacteria | 2349 |
| 323 | Ga0395898_0215187 | 3300037466 | Bacteria | 1833 |
| 324 | Ga0395898_0386307 | 3300037466 | Bacteria | 1335 |
| 325 | Ga0395898_0754136 | 3300037466 | Unclassified | 914 |
| 326 | Ga0395898_0807227 | 3300037466 | Bacteria | 878 |
| 327 | Ga0395898_1276464 | 3300037466 | Bacteria | 664 |
| 328 | Ga0395898_1363730 | 3300037466 | Bacteria | 637 |
| 329 | Ga0395898_1416966 | 3300037466 | Unclassified | 622 |
| 330 | Ga0395905_0042696 | 3300037471 | Bacteria | 4254 |
| 331 | Ga0395905_0102993 | 3300037471 | Bacteria | 2680 |
| 332 | Ga0395905_0181870 | 3300037471 | Bacteria | 1974 |
| 333 | Ga0395905_0232240 | 3300037471 | Bacteria | 1725 |
| 334 | Ga0395905_0543926 | 3300037471 | Unclassified | 1062 |
| 335 | Ga0395905_0991758 | 3300037471 | Unclassified | 743 |
| 336 | Ga0395905_1081152 | 3300037471 | Bacteria | 705 |
| 337 | Ga0395905_1147836 | 3300037471 | Bacteria | 680 |
| 338 | Ga0395901_0004378 | 3300038443 | Bacteria | 14246 |
| 339 | Ga0395901_0031826 | 3300038443 | Bacteria | 5439 |
| 340 | Ga0395901_0135742 | 3300038443 | Bacteria | 2586 |
| 341 | Ga0395901_0164192 | 3300038443 | Unclassified | 2332 |
| 342 | Ga0395901_0354310 | 3300038443 | Bacteria | 1514 |
| 343 | Ga0395901_0364844 | 3300038443 | Bacteria | 1488 |
| 344 | Ga0395901_0376792 | 3300038443 | Bacteria | 1461 |
| 345 | Ga0395901_0856039 | 3300038443 | Unclassified | 894 |
| 346 | Ga0395901_1049632 | 3300038443 | Unclassified | 788 |
| 347 | Ga0395901_1164636 | 3300038443 | Unclassified | 738 |
| 348 | Ga0395901_1816261 | 3300038443 | Bacteria | 558 |
| 349 | Ga0436365_0463966 | 3300039437 | Unclassified | 511 |
| 350 | Ga0436365_1583841 | 3300039437 | Bacteria | 897 |
| 351 | Ga0436365_1619546 | 3300039437 | Bacteria | 967 |
| 352 | Ga0436363_0347133 | 3300039450 | Bacteria | 807 |
| 353 | Ga0436363_0554650 | 3300039450 | Bacteria | 816 |
| 354 | Ga0451807_1951536 | 3300041486 | Bacteria | 676 |
| 355 | Ga0451853_1170030 | 3300041512 | Unclassified | 507 |
| 356 | Ga0451853_1356713 | 3300041512 | Bacteria | 2724 |
| 357 | Ga0439448_0222166 | 3300042005 | Unclassified | 664 |
| 358 | Ga0439464_0084710 | 3300042439 | Unclassified | 950 |
| 359 | Ga0466969_0001587 | 3300044656 | Bacteria | 12160 |
| 360 | Ga0466969_0123031 | 3300044656 | Bacteria | 1207 |
| 361 | Ga0466972_0162836 | 3300044658 | Unclassified | 1048 |
| 362 | Ga0466965_0082941 | 3300044683 | Bacteria | 1622 |
| 363 | Ga0466965_0429404 | 3300044683 | Bacteria | 733 |
| 364 | Ga0466965_0733491 | 3300044683 | Unclassified | 569 |
| 365 | Ga0466966_0005740 | 3300044684 | Bacteria | 8169 |
| 366 | Ga0466966_0084392 | 3300044684 | Bacteria | 1975 |
| 367 | Ga0466966_0105662 | 3300044684 | Bacteria | 1738 |
| 368 | Ga0466966_0118152 | 3300044684 | Bacteria | 1631 |
| 369 | Ga0466966_0361361 | 3300044684 | Unclassified | 872 |
| 370 | Ga0466966_0394803 | 3300044684 | Bacteria | 831 |
| 371 | Ga0466961_0119100 | 3300044693 | Bacteria | 1658 |
| 372 | Ga0466961_0133392 | 3300044693 | Bacteria | 1556 |
| 373 | Ga0466961_0788227 | 3300044693 | Unclassified | 567 |
| 374 | Ga0466961_0908292 | 3300044693 | Unclassified | 524 |
| 375 | Ga0466963_0000045 | 3300044694 | Bacteria | 40813 |
| 376 | Ga0466963_0000742 | 3300044694 | Bacteria | 16070 |
| 377 | Ga0466963_0001619 | 3300044694 | Bacteria | 12244 |
| 378 | Ga0466963_0013627 | 3300044694 | Bacteria | 4997 |
| 379 | Ga0466963_0045262 | 3300044694 | Bacteria | 2899 |
| 380 | Ga0466963_0046621 | 3300044694 | Archaea | 2858 |
| 381 | Ga0466963_0105297 | 3300044694 | Bacteria | 1933 |
| 382 | Ga0466963_0105746 | 3300044694 | Bacteria | 1929 |
| 383 | Ga0466963_0126419 | 3300044694 | Unclassified | 1763 |
| 384 | Ga0466963_0166014 | 3300044694 | Bacteria | 1538 |
| 385 | Ga0466963_0518237 | 3300044694 | Unclassified | 842 |
| 386 | Ga0466963_0927785 | 3300044694 | Bacteria | 613 |
| 387 | Ga0466963_0954305 | 3300044694 | Unclassified | 604 |
| 388 | Ga0466964_0002707 | 3300044706 | Bacteria | 6353 |
| 389 | Ga0466964_0054670 | 3300044706 | Bacteria | 1646 |
| 390 | Ga0466964_0063979 | 3300044706 | Bacteria | 1538 |
| 391 | Ga0466964_0119990 | 3300044706 | Bacteria | 1184 |
| 392 | Ga0466964_0237830 | 3300044706 | Bacteria | 892 |
| 393 | Ga0466964_0384433 | 3300044706 | Unclassified | 729 |
| 394 | Ga0466964_0529508 | 3300044706 | Unclassified | 637 |
| 395 | Ga0466971_0001256 | 3300044719 | Bacteria | 10570 |
| 396 | Ga0466971_0112310 | 3300044719 | Archaea | 1258 |
| 397 | Ga0466971_0144623 | 3300044719 | Bacteria | 1108 |
| 398 | Ga0466968_0015466 | 3300044735 | Bacteria | 3024 |
| 399 | Ga0466968_0021995 | 3300044735 | Bacteria | 2588 |
| 400 | Ga0466968_0035223 | 3300044735 | Bacteria | 2094 |
| 401 | Ga0466968_0054832 | 3300044735 | Bacteria | 1709 |
| 402 | Ga0466968_0059578 | 3300044735 | Unclassified | 1645 |
| 403 | Ga0466968_0091547 | 3300044735 | Unclassified | 1348 |
| 404 | Ga0466968_0176104 | 3300044735 | Unclassified | 993 |
| 405 | Ga0466968_0233547 | 3300044735 | Unclassified | 869 |
| 406 | Ga0466970_0005565 | 3300044765 | Bacteria | 6259 |
| 407 | Ga0466970_0439177 | 3300044765 | Bacteria | 747 |
| 408 | Ga0466957_0000686 | 3300044842 | Bacteria | 17266 |
| 409 | Ga0466957_0020963 | 3300044842 | Bacteria | 3846 |
| 410 | Ga0466957_0036309 | 3300044842 | Bacteria | 2962 |
| 411 | Ga0466957_0050455 | 3300044842 | Bacteria | 2532 |
| 412 | Ga0466957_0195919 | 3300044842 | Bacteria | 1325 |
| 413 | Ga0466957_0248609 | 3300044842 | Bacteria | 1182 |
| 414 | Ga0466957_0256395 | 3300044842 | Bacteria | 1164 |
| 415 | Ga0466957_0347423 | 3300044842 | Unclassified | 1006 |
| 416 | Ga0466957_0491755 | 3300044842 | Bacteria | 849 |
| 417 | Ga0466957_0500599 | 3300044842 | Unclassified | 842 |
| 418 | Ga0466957_1101152 | 3300044842 | Bacteria | 573 |
| 419 | Ga0466957_1113603 | 3300044842 | Unclassified | 569 |
| 420 | Ga0466957_1261760 | 3300044842 | Bacteria | 536 |
| 421 | Ga0466957_1290809 | 3300044842 | Unclassified | 530 |
| 422 | Ga0466960_0113859 | 3300044901 | Bacteria | 1409 |
| 423 | Ga0466960_0274342 | 3300044901 | Unclassified | 943 |
| 424 | Ga0466960_0605554 | 3300044901 | Unclassified | 651 |
| 425 | Ga0466960_0649037 | 3300044901 | Bacteria | 630 |
| 426 | Ga0466959_0006849 | 3300045049 | Bacteria | 7944 |
| 427 | Ga0466959_0030041 | 3300045049 | Bacteria | 4024 |
| 428 | Ga0466959_0054074 | 3300045049 | Bacteria | 2934 |
| 429 | Ga0466959_0115707 | 3300045049 | Bacteria | 1910 |
| 430 | Ga0466959_0132723 | 3300045049 | Bacteria | 1764 |
| 431 | Ga0451576_2402927 | 3300045051 | Bacteria | 539 |
| 432 | Ga0466958_0034458 | 3300045836 | Bacteria | 3020 |
| 433 | Ga0466958_0105168 | 3300045836 | Bacteria | 1758 |
| 434 | Ga0466958_0105506 | 3300045836 | Bacteria | 1756 |
| 435 | Ga0466958_0211272 | 3300045836 | Bacteria | 1236 |
| 436 | Ga0466958_0334296 | 3300045836 | Bacteria | 974 |
| 437 | Ga0466958_0340171 | 3300045836 | Bacteria | 965 |
| 438 | Ga0466967_0000248 | 3300045976 | Bacteria | 23755 |
| 439 | Ga0466967_0005994 | 3300045976 | Bacteria | 8536 |
| 440 | Ga0466967_0006248 | 3300045976 | Bacteria | 8402 |
| 441 | Ga0466967_0013790 | 3300045976 | Bacteria | 6263 |
| 442 | Ga0466967_0028996 | 3300045976 | Bacteria | 4627 |
| 443 | Ga0466967_0030595 | 3300045976 | Bacteria | 4520 |
| 444 | Ga0466967_0044659 | 3300045976 | Bacteria | 3845 |
| 445 | Ga0466967_0046221 | 3300045976 | Bacteria | 3789 |
| 446 | Ga0466967_0061777 | 3300045976 | Bacteria | 3324 |
| 447 | Ga0466967_0062850 | 3300045976 | Bacteria | 3297 |
| 448 | Ga0466967_0071542 | 3300045976 | Bacteria | 3106 |
| 449 | Ga0466967_0101004 | 3300045976 | Bacteria | 2636 |
| 450 | Ga0466967_0144883 | 3300045976 | Bacteria | 2215 |
| 451 | Ga0466967_0145790 | 3300045976 | Unclassified | 2208 |
| 452 | Ga0466967_0179385 | 3300045976 | Bacteria | 1997 |
| 453 | Ga0466967_0212070 | 3300045976 | Bacteria | 1837 |
| 454 | Ga0466967_0226284 | 3300045976 | Unclassified | 1779 |
| 455 | Ga0466967_0229292 | 3300045976 | Unclassified | 1768 |
| 456 | Ga0466967_0362321 | 3300045976 | Unclassified | 1405 |
| 457 | Ga0466967_0363280 | 3300045976 | Unclassified | 1403 |
| 458 | Ga0466967_0404704 | 3300045976 | Unclassified | 1328 |
| 459 | Ga0466967_0460910 | 3300045976 | Bacteria | 1243 |
| 460 | Ga0466967_0465633 | 3300045976 | Bacteria | 1237 |
| 461 | Ga0466967_0487336 | 3300045976 | Bacteria | 1208 |
| 462 | Ga0466967_1005901 | 3300045976 | Unclassified | 830 |
| 463 | Ga0466967_1018814 | 3300045976 | Bacteria | 824 |
| 464 | Ga0466967_1030848 | 3300045976 | Bacteria | 819 |
| 465 | Ga0466967_1167515 | 3300045976 | Bacteria | 767 |
| 466 | Ga0466967_1293313 | 3300045976 | Bacteria | 726 |
| 467 | Ga0466967_1462883 | 3300045976 | Unclassified | 680 |
| 468 | Ga0466967_2342008 | 3300045976 | Unclassified | 529 |
| 469 | Ga0495603_0710429 | 3300046455 | Unclassified | 575 |
| 470 | Ga0495629_0706054 | 3300046459 | Unclassified | 669 |
| 471 | Ga0495641_0042554 | 3300046461 | Bacteria | 2104 |
| 472 | Ga0495641_0387962 | 3300046461 | Bacteria | 633 |
| 473 | Ga0495641_0584335 | 3300046461 | Bacteria | 510 |
| 474 | Ga0495651_0149048 | 3300046462 | Bacteria | 1689 |
| 475 | Ga0495651_0663633 | 3300046462 | Bacteria | 652 |
| 476 | Ga0495653_0036514 | 3300046463 | Bacteria | 3870 |
| 477 | Ga0495653_0106063 | 3300046463 | Bacteria | 2027 |
| 478 | Ga0495653_0514552 | 3300046463 | Bacteria | 745 |
| 479 | Ga0495580_0368292 | 3300046472 | Bacteria | 972 |
| 480 | Ga0495582_0085177 | 3300046473 | Unclassified | 1758 |
| 481 | Ga0495582_0380874 | 3300046473 | Unclassified | 813 |
| 482 | Ga0495664_0052136 | 3300046477 | Bacteria | 2430 |
| 483 | Ga0495584_0085591 | 3300046491 | Bacteria | 1588 |
| 484 | Ga0495584_0108332 | 3300046491 | Bacteria | 1405 |
| 485 | Ga0495585_0601973 | 3300046492 | Unclassified | 517 |
| 486 | Ga0495594_0744507 | 3300046499 | Bacteria | 553 |
| 487 | Ga0495596_0434666 | 3300046500 | Bacteria | 512 |
| 488 | Ga0495608_0005356 | 3300046511 | Bacteria | 9167 |
| 489 | Ga0495608_0013987 | 3300046511 | Bacteria | 5567 |
| 490 | Ga0495608_0394353 | 3300046511 | Bacteria | 847 |
| 491 | Ga0495618_0578049 | 3300046514 | Bacteria | 670 |
| 492 | Ga0495630_0057166 | 3300046517 | Bacteria | 2924 |
| 493 | Ga0495630_0343203 | 3300046517 | Bacteria | 1143 |
| 494 | Ga0495631_0184283 | 3300046518 | Bacteria | 894 |
| 495 | Ga0495637_0351039 | 3300046520 | Bacteria | 517 |
| 496 | Ga0495663_0052050 | 3300046525 | Bacteria | 1270 |
| 497 | Ga0495642_0275254 | 3300046528 | Bacteria | 737 |
| 498 | Ga0495642_0374623 | 3300046528 | Bacteria | 627 |
| 499 | Ga0495652_0065292 | 3300046529 | Bacteria | 3058 |
| 500 | Ga0495652_0138153 | 3300046529 | Bacteria | 1920 |
| 501 | Ga0495652_0184854 | 3300046529 | Unclassified | 1596 |
| 502 | Ga0495665_0132690 | 3300046531 | Bacteria | 1304 |
| 503 | Ga0495587_0010553 | 3300046536 | Bacteria | 5875 |
| 504 | Ga0495587_0098320 | 3300046536 | Bacteria | 1687 |
| 505 | Ga0495667_0091540 | 3300046559 | Bacteria | 1970 |
| 506 | Ga0495667_0154383 | 3300046559 | Unclassified | 1477 |
| 507 | Ga0495656_0115562 | 3300046615 | Bacteria | 1261 |
| 508 | Ga0495656_0203783 | 3300046615 | Bacteria | 983 |
| 509 | Ga0495634_0043312 | 3300046642 | Bacteria | 3051 |
| 510 | Ga0495611_0537664 | 3300046648 | Bacteria | 530 |
| 511 | Ga0495635_0050980 | 3300046663 | Bacteria | 2853 |
| 512 | Ga0495635_0225088 | 3300046663 | Unclassified | 1268 |
| 513 | Ga0495661_0445211 | 3300046665 | Bacteria | 624 |
| 514 | Ga0495588_0753256 | 3300046674 | Bacteria | 509 |
| 515 | Ga0495657_0055341 | 3300046675 | Bacteria | 2647 |
| 516 | Ga0495657_0062744 | 3300046675 | Bacteria | 2454 |
| 517 | Ga0495657_0583008 | 3300046675 | Unclassified | 648 |
| 518 | Ga0495599_0044374 | 3300046678 | Bacteria | 2788 |
| 519 | Ga0495623_0196780 | 3300046679 | Bacteria | 1161 |
| 520 | Ga0495623_0738448 | 3300046679 | Unclassified | 502 |
| 521 | Ga0495646_0097604 | 3300046680 | Bacteria | 1688 |
| 522 | Ga0495647_0158951 | 3300046681 | Unclassified | 973 |
| 523 | Ga0495658_0275868 | 3300046683 | Bacteria | 1060 |
| 524 | Ga0495613_0105338 | 3300046689 | Unclassified | 2036 |
| 525 | Ga0495613_0667181 | 3300046689 | Bacteria | 687 |
| 526 | Ga0495624_0161193 | 3300046690 | Bacteria | 1370 |
| 527 | Ga0495624_0341355 | 3300046690 | Unclassified | 901 |
| 528 | Ga0495600_0392319 | 3300046809 | Unclassified | 865 |
| 529 | Ga0495581_0142491 | 3300047315 | Bacteria | 1399 |
| 530 | Ga0495581_0672075 | 3300047315 | Bacteria | 598 |
| 531 | Ga0495604_0039781 | 3300047317 | Bacteria | 3694 |
| 532 | Ga0495604_0310941 | 3300047317 | Bacteria | 1056 |
| 533 | Ga0495604_0612470 | 3300047317 | Unclassified | 697 |
| 534 | Ga0495674_0039263 | 3300047319 | Bacteria | 4245 |
| 535 | Ga0495674_0125666 | 3300047319 | Bacteria | 2164 |
| 536 | Ga0495674_0901888 | 3300047319 | Bacteria | 682 |
| 537 | Ga0495676_0101779 | 3300047321 | Bacteria | 2124 |
| 538 | Ga0495676_0189501 | 3300047321 | Bacteria | 1435 |
| 539 | Ga0495676_0448008 | 3300047321 | Unclassified | 852 |
| 540 | Ga0495676_0968124 | 3300047321 | Unclassified | 544 |
| 541 | Ga0495676_0995647 | 3300047321 | Bacteria | 535 |
| 542 | Ga0495680_0015306 | 3300047322 | Bacteria | 6619 |
| 543 | Ga0495680_0032766 | 3300047322 | Bacteria | 4214 |
| 544 | Ga0495675_0093843 | 3300047444 | Bacteria | 1882 |
| 545 | Ga0495684_0158496 | 3300047471 | Bacteria | 1689 |
| 546 | Ga0495684_0422982 | 3300047471 | Unclassified | 931 |
| 547 | Ga0495684_1090884 | 3300047471 | Unclassified | 501 |
| 548 | Ga0495602_1090451 | 3300048088 | Bacteria | 524 |
| 549 | Ga0496100_0002873 | 3300048903 | Bacteria | 8829 |
| 550 | Ga0496100_0888328 | 3300048903 | Unclassified | 700 |
| 551 | Ga0496100_1250105 | 3300048903 | Bacteria | 586 |
| 552 | Ga0496101_0213196 | 3300048904 | Bacteria | 1496 |
| 553 | Ga0496101_0491890 | 3300048904 | Unclassified | 969 |
| 554 | Ga0496102_0004411 | 3300048905 | Bacteria | 11886 |
| 555 | Ga0496102_0385265 | 3300048905 | Bacteria | 1319 |
| 556 | Ga0496102_0499160 | 3300048905 | Bacteria | 1139 |
| 557 | Ga0496103_0024537 | 3300048906 | Bacteria | 3641 |
| 558 | Ga0496103_0504314 | 3300048906 | Bacteria | 774 |
| 559 | Ga0496104_0138902 | 3300048907 | Bacteria | 2335 |
| 560 | Ga0496104_0339180 | 3300048907 | Unclassified | 1416 |
| 561 | Ga0496104_0940778 | 3300048907 | Unclassified | 769 |
| 562 | Ga0496105_0026253 | 3300048908 | Bacteria | 4750 |
| 563 | Ga0496105_0066005 | 3300048908 | Bacteria | 2986 |
| 564 | Ga0496105_0100296 | 3300048908 | Bacteria | 2391 |
| 565 | Ga0496105_1401699 | 3300048908 | Unclassified | 506 |
| 566 | Ga0496106_0028830 | 3300048909 | Bacteria | 4137 |
| 567 | Ga0496106_0070831 | 3300048909 | Bacteria | 2663 |
| 568 | Ga0496106_1242738 | 3300048909 | Bacteria | 580 |
| 569 | Ga0496107_0009417 | 3300048910 | Bacteria | 6777 |
| 570 | Ga0496107_0085959 | 3300048910 | Bacteria | 2295 |
| 571 | Ga0496108_0007544 | 3300048911 | Bacteria | 8817 |
| 572 | Ga0496108_0097220 | 3300048911 | Bacteria | 2509 |
| 573 | Ga0496108_0230534 | 3300048911 | Unclassified | 1610 |
| 574 | Ga0496108_0585493 | 3300048911 | Bacteria | 973 |
| 575 | Ga0496109_0044918 | 3300048912 | Bacteria | 4009 |
| 576 | Ga0496109_0047917 | 3300048912 | Bacteria | 3887 |
| 577 | Ga0496109_0053800 | 3300048912 | Bacteria | 3672 |
| 578 | Ga0496109_0124580 | 3300048912 | Bacteria | 2402 |
| 579 | Ga0496109_0336788 | 3300048912 | Bacteria | 1425 |
| 580 | Ga0496109_0598490 | 3300048912 | Bacteria | 1039 |
| 581 | Ga0496110_0399220 | 3300048913 | Unclassified | 1253 |
| 582 | Ga0496111_0153466 | 3300048914 | Bacteria | 1709 |
| 583 | Ga0496111_0340413 | 3300048914 | Unclassified | 1110 |
| 584 | Ga0496111_0647201 | 3300048914 | Bacteria | 771 |
| 585 | Ga0496112_0020070 | 3300048915 | Bacteria | 6327 |
| 586 | Ga0496112_0023014 | 3300048915 | Bacteria | 5945 |
| 587 | Ga0496112_0060683 | 3300048915 | Bacteria | 3727 |
| 588 | Ga0496112_0276705 | 3300048915 | Unclassified | 1626 |
| 589 | Ga0496112_0385125 | 3300048915 | Unclassified | 1343 |
| 590 | Ga0496112_0539462 | 3300048915 | Bacteria | 1101 |
| 591 | Ga0496112_1046476 | 3300048915 | Bacteria | 735 |
| 592 | Ga0496112_1395535 | 3300048915 | Bacteria | 615 |
| 593 | Ga0496113_1049588 | 3300048916 | Bacteria | 640 |
| 594 | Ga0496114_0008800 | 3300048917 | Bacteria | 7999 |
| 595 | Ga0496114_0130695 | 3300048917 | Bacteria | 2168 |
| 596 | Ga0496114_0136277 | 3300048917 | Archaea | 2123 |
| 597 | Ga0496114_0411493 | 3300048917 | Archaea | 1198 |
| 598 | Ga0496114_1038648 | 3300048917 | Bacteria | 703 |
| 599 | Ga0496114_1045240 | 3300048917 | Bacteria | 701 |
| 600 | Ga0496115_0000468 | 3300048918 | Bacteria | 32165 |
| 601 | Ga0496115_0003165 | 3300048918 | Bacteria | 11830 |
| 602 | Ga0496115_0448111 | 3300048918 | Bacteria | 1043 |
| 603 | Ga0501032_0794657 | 3300049569 | Bacteria | 598 |
| 604 | Ga0501034_0065603 | 3300049571 | Bacteria | 3643 |
| 605 | Ga0501037_0606206 | 3300049573 | Bacteria | 735 |
| 606 | Ga0501043_0483196 | 3300049579 | Bacteria | 927 |
| 607 | Ga0501046_0453813 | 3300049580 | Bacteria | 922 |
| 608 | Ga0501047_0020647 | 3300049581 | Bacteria | 6324 |
| 609 | Ga0501047_0030926 | 3300049581 | Bacteria | 5162 |
| 610 | Ga0501047_0089203 | 3300049581 | Bacteria | 2961 |
| 611 | Ga0501047_0114792 | 3300049581 | Bacteria | 2575 |
| 612 | Ga0501047_0251911 | 3300049581 | Bacteria | 1614 |
| 613 | Ga0501048_1191468 | 3300049582 | Unclassified | 548 |
| 614 | Ga0501067_0016225 | 3300049583 | Bacteria | 4117 |
| 615 | Ga0501067_0114053 | 3300049583 | Bacteria | 1503 |
| 616 | Ga0501067_0182860 | 3300049583 | Unclassified | 1167 |
| 617 | Ga0501068_0175729 | 3300049584 | Unclassified | 1353 |
| 618 | Ga0501068_1156162 | 3300049584 | Unclassified | 512 |
| 619 | Ga0501069_0041601 | 3300049585 | Bacteria | 2540 |
| 620 | Ga0501069_0091310 | 3300049585 | Bacteria | 1722 |
| 621 | Ga0501069_0112901 | 3300049585 | Bacteria | 1549 |
| 622 | Ga0501069_0119334 | 3300049585 | Bacteria | 1506 |
| 623 | Ga0501069_0799121 | 3300049585 | Bacteria | 572 |
| 624 | Ga0501070_0000120 | 3300049586 | Bacteria | 70354 |
| 625 | Ga0501070_0007509 | 3300049586 | Bacteria | 9263 |
| 626 | Ga0501070_0026784 | 3300049586 | Bacteria | 4835 |
| 627 | Ga0501070_0218691 | 3300049586 | Bacteria | 1562 |
| 628 | Ga0501072_0007793 | 3300049588 | Bacteria | 8135 |
| 629 | Ga0501072_0833647 | 3300049588 | Bacteria | 721 |
| 630 | Ga0501073_0022897 | 3300049589 | Bacteria | 4493 |
| 631 | Ga0501073_0025754 | 3300049589 | Bacteria | 4215 |
| 632 | Ga0501074_0014259 | 3300049590 | Bacteria | 5780 |
| 633 | Ga0501074_0017916 | 3300049590 | Bacteria | 5146 |
| 634 | Ga0501074_0369585 | 3300049590 | Bacteria | 1017 |
| 635 | Ga0501074_0475047 | 3300049590 | Bacteria | 886 |
| 636 | Ga0501074_0492177 | 3300049590 | Bacteria | 869 |
| 637 | Ga0501079_0103970 | 3300049741 | Bacteria | 2203 |
| 638 | Ga0501079_0790433 | 3300049741 | Bacteria | 747 |
| 639 | Ga0501079_1274216 | 3300049741 | Unclassified | 579 |
| 640 | Ga0501080_0011468 | 3300049742 | Bacteria | 8113 |
| 641 | Ga0501080_0118423 | 3300049742 | Bacteria | 2455 |
| 642 | Ga0501080_0125573 | 3300049742 | Bacteria | 2376 |
| 643 | Ga0501080_0192605 | 3300049742 | Bacteria | 1873 |
| 644 | Ga0501080_0244275 | 3300049742 | Bacteria | 1638 |
| 645 | Ga0501080_0363795 | 3300049742 | Bacteria | 1305 |
| 646 | Ga0501080_1657067 | 3300049742 | Bacteria | 540 |
| 647 | Ga0501083_0002282 | 3300049744 | Bacteria | 13123 |
| 648 | Ga0501083_0948207 | 3300049744 | Bacteria | 560 |
| 649 | Ga0501035_0630558 | 3300049822 | Bacteria | 871 |
| 650 | Ga0501035_1027154 | 3300049822 | Unclassified | 647 |
| 651 | Ga0501044_0247094 | 3300049823 | Bacteria | 1727 |
| 652 | Ga0501045_1353934 | 3300049824 | Unclassified | 517 |
| 653 | nmdc:mga0n895_27853_c1 | 3300050512 | Bacteria | 5369 |
| 654 | nmdc:mga0rr50_115739_c1 | 3300050513 | Bacteria | 2128 |
| 655 | nmdc:mga0rr50_214248_c1 | 3300050513 | Bacteria | 1588 |
| 656 | nmdc:mga0a205_132950_c1 | 3300050515 | Bacteria | 2388 |
| 657 | nmdc:mga0a205_728608_c1 | 3300050515 | Bacteria | 841 |
| 658 | Ga0495601_0016450 | 3300053077 | Unclassified | 4482 |
| 659 | Ga0495612_0212128 | 3300053078 | Bacteria | 856 |
| 660 | Ga0495612_0255566 | 3300053078 | Bacteria | 780 |
| 661 | Ga0500635_0305571 | 3300053080 | Bacteria | 628 |
| 662 | Ga0495595_0007111 | 3300053084 | Bacteria | 4574 |
| 663 | Ga0495595_0129934 | 3300053084 | Bacteria | 1231 |
| 664 | Ga0495619_0004914 | 3300053085 | Bacteria | 8487 |
| 665 | Ga0495619_0212704 | 3300053085 | Bacteria | 1339 |
| 666 | Ga0501084_0124032 | 3300054114 | Bacteria | 2172 |
| 667 | Ga0587106_131742 | 3300059605 | Unclassified | 540 |
| 668 | Ga0587128_134805 | 3300059630 | Bacteria | 550 |
| 669 | Ga0501082_0053269 | 3300060353 | Bacteria | 3488 |
| 670 | Ga0466962_0004936 | 3300061719 | Bacteria | 6415 |
| 671 | Ga0466962_0048060 | 3300061719 | Bacteria | 2039 |
| 672 | Ga0466962_0062341 | 3300061719 | Bacteria | 1780 |
| 673 | Ga0466962_0140435 | 3300061719 | Bacteria | 1170 |
| 674 | Ga0466962_0208401 | 3300061719 | Bacteria | 956 |
| 675 | Ga0530510_0353526 | 3300061734 | Bacteria | 1104 |
| 676 | Ga0530510_0439075 | 3300061734 | Bacteria | 986 |
| 677 | Ga0530510_0506338 | 3300061734 | Bacteria | 915 |
| 678 | Ga0530510_0660382 | 3300061734 | Unclassified | 796 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0101004 | Ga0466967_0101004_1952_2221 | 89 |
| 2 | 3300050513 | nmdc:mga0rr50_214248_c1 | nmdc:mga0rr50_214248_c1_1211_1480 | 89 |
| 3 | 3300059630 | Ga0587128_134805 | Ga0587128_134805_161_430 | 89 |
| 4 | 3300045976 | Ga0466967_0363280 | Ga0466967_0363280_482_763 | 92 |
| 5 | 3300005327 | Ga0070658_12001161 | Ga0070658_120011612 | 93 |
| 6 | 3300005435 | Ga0070714_100533785 | Ga0070714_1005337851 | 93 |
| 7 | 3300006358 | Ga0068871_100981371 | Ga0068871_1009813711 | 93 |
| 8 | 3300025909 | Ga0207705_11339239 | Ga0207705_113392391 | 93 |
| 9 | 3300028556 | Ga0265337_1052546 | Ga0265337_10525461 | 93 |
| 10 | 3300028577 | Ga0265318_10280087 | Ga0265318_102800871 | 93 |
| 11 | 3300028800 | Ga0265338_10041024 | Ga0265338_100410244 | 93 |
| 12 | 3300031240 | Ga0265320_10274347 | Ga0265320_102743471 | 93 |
| 13 | 3300044901 | Ga0466960_0113859 | Ga0466960_0113859_352_633 | 93 |
| 14 | 3300046491 | Ga0495584_0085591 | Ga0495584_0085591_259_540 | 93 |
| 15 | 3300046520 | Ga0495637_0351039 | Ga0495637_0351039_176_457 | 93 |
| 16 | 3300046528 | Ga0495642_0275254 | Ga0495642_0275254_191_472 | 93 |
| 17 | 3300046615 | Ga0495656_0115562 | Ga0495656_0115562_607_888 | 93 |
| 18 | 3300046665 | Ga0495661_0445211 | Ga0495661_0445211_214_495 | 93 |
| 19 | 3300047319 | Ga0495674_0901888 | Ga0495674_0901888_334_615 | 93 |
| 20 | 3300047321 | Ga0495676_0448008 | Ga0495676_0448008_238_519 | 93 |
| 21 | 3300047471 | Ga0495684_1090884 | Ga0495684_1090884_187_468 | 93 |
| 22 | 3300048904 | Ga0496101_0491890 | Ga0496101_0491890_548_829 | 93 |
| 23 | 3300048907 | Ga0496104_0339180 | Ga0496104_0339180_541_822 | 93 |
| 24 | 3300048915 | Ga0496112_1046476 | Ga0496112_1046476_257_538 | 93 |
| 25 | 3300005295 | Ga0065707_10821782 | Ga0065707_108217822 | 94 |
| 26 | 3300005327 | Ga0070658_10021374 | Ga0070658_100213743 | 94 |
| 27 | 3300005327 | Ga0070658_10040945 | Ga0070658_100409455 | 94 |
| 28 | 3300005327 | Ga0070658_10141706 | Ga0070658_101417063 | 94 |
| 29 | 3300005327 | Ga0070658_10783245 | Ga0070658_107832452 | 94 |
| 30 | 3300005327 | Ga0070658_10843920 | Ga0070658_108439201 | 94 |
| 31 | 3300005329 | Ga0070683_100014698 | Ga0070683_1000146982 | 94 |
| 32 | 3300005329 | Ga0070683_100020650 | Ga0070683_1000206504 | 94 |
| 33 | 3300005329 | Ga0070683_100031073 | Ga0070683_1000310736 | 94 |
| 34 | 3300005329 | Ga0070683_100291229 | Ga0070683_1002912292 | 94 |
| 35 | 3300005336 | Ga0070680_100056475 | Ga0070680_1000564754 | 94 |
| 36 | 3300005336 | Ga0070680_100269672 | Ga0070680_1002696723 | 94 |
| 37 | 3300005336 | Ga0070680_100467451 | Ga0070680_1004674512 | 94 |
| 38 | 3300005337 | Ga0070682_100387730 | Ga0070682_1003877303 | 94 |
| 39 | 3300005338 | Ga0068868_100335390 | Ga0068868_1003353902 | 94 |
| 40 | 3300005339 | Ga0070660_100017422 | Ga0070660_1000174225 | 94 |
| 41 | 3300005339 | Ga0070660_100049844 | Ga0070660_1000498443 | 94 |
| 42 | 3300005339 | Ga0070660_101321331 | Ga0070660_1013213312 | 94 |
| 43 | 3300005339 | Ga0070660_101794307 | Ga0070660_1017943071 | 94 |
| 44 | 3300005341 | Ga0070691_10274037 | Ga0070691_102740371 | 94 |
| 45 | 3300005344 | Ga0070661_100044592 | Ga0070661_1000445924 | 94 |
| 46 | 3300005366 | Ga0070659_101109324 | Ga0070659_1011093241 | 94 |
| 47 | 3300005367 | Ga0070667_101174723 | Ga0070667_1011747232 | 94 |
| 48 | 3300005434 | Ga0070709_10635926 | Ga0070709_106359262 | 94 |
| 49 | 3300005435 | Ga0070714_100020688 | Ga0070714_10002068810 | 94 |
| 50 | 3300005435 | Ga0070714_100094704 | Ga0070714_1000947044 | 94 |
| 51 | 3300005435 | Ga0070714_100138448 | Ga0070714_1001384484 | 94 |
| 52 | 3300005435 | Ga0070714_100273950 | Ga0070714_1002739501 | 94 |
| 53 | 3300005435 | Ga0070714_100528123 | Ga0070714_1005281232 | 94 |
| 54 | 3300005435 | Ga0070714_100589247 | Ga0070714_1005892471 | 94 |
| 55 | 3300005435 | Ga0070714_101516646 | Ga0070714_1015166461 | 94 |
| 56 | 3300005435 | Ga0070714_101735191 | Ga0070714_1017351911 | 94 |
| 57 | 3300005435 | Ga0070714_101858748 | Ga0070714_1018587481 | 94 |
| 58 | 3300005435 | Ga0070714_101889914 | Ga0070714_1018899142 | 94 |
| 59 | 3300005435 | Ga0070714_102513187 | Ga0070714_1025131872 | 94 |
| 60 | 3300005436 | Ga0070713_100119772 | Ga0070713_1001197723 | 94 |
| 61 | 3300005436 | Ga0070713_102365723 | Ga0070713_1023657231 | 94 |
| 62 | 3300005437 | Ga0070710_10175128 | Ga0070710_101751281 | 94 |
| 63 | 3300005437 | Ga0070710_10593691 | Ga0070710_105936912 | 94 |
| 64 | 3300005438 | Ga0070701_10829418 | Ga0070701_108294182 | 94 |
| 65 | 3300005439 | Ga0070711_100049404 | Ga0070711_1000494041 | 94 |
| 66 | 3300005439 | Ga0070711_100384353 | Ga0070711_1003843532 | 94 |
| 67 | 3300005440 | Ga0070705_100517370 | Ga0070705_1005173702 | 94 |
| 68 | 3300005445 | Ga0070708_100397865 | Ga0070708_1003978652 | 94 |
| 69 | 3300005445 | Ga0070708_100653065 | Ga0070708_1006530652 | 94 |
| 70 | 3300005455 | Ga0070663_100553450 | Ga0070663_1005534502 | 94 |
| 71 | 3300005455 | Ga0070663_101407142 | Ga0070663_1014071421 | 94 |
| 72 | 3300005456 | Ga0070678_100262227 | Ga0070678_1002622272 | 94 |
| 73 | 3300005456 | Ga0070678_100664440 | Ga0070678_1006644401 | 94 |
| 74 | 3300005458 | Ga0070681_10019900 | Ga0070681_100199001 | 94 |
| 75 | 3300005458 | Ga0070681_10161994 | Ga0070681_101619942 | 94 |
| 76 | 3300005458 | Ga0070681_10302264 | Ga0070681_103022641 | 94 |
| 77 | 3300005458 | Ga0070681_10492540 | Ga0070681_104925403 | 94 |
| 78 | 3300005459 | Ga0068867_101077209 | Ga0068867_1010772092 | 94 |
| 79 | 3300005467 | Ga0070706_100414084 | Ga0070706_1004140842 | 94 |
| 80 | 3300005468 | Ga0070707_100509886 | Ga0070707_1005098861 | 94 |
| 81 | 3300005468 | Ga0070707_100777730 | Ga0070707_1007777303 | 94 |
| 82 | 3300005468 | Ga0070707_100888074 | Ga0070707_1008880742 | 94 |
| 83 | 3300005471 | Ga0070698_101565635 | Ga0070698_1015656351 | 94 |
| 84 | 3300005518 | Ga0070699_100364724 | Ga0070699_1003647242 | 94 |
| 85 | 3300005518 | Ga0070699_101561117 | Ga0070699_1015611172 | 94 |
| 86 | 3300005530 | Ga0070679_100065073 | Ga0070679_1000650736 | 94 |
| 87 | 3300005530 | Ga0070679_100109947 | Ga0070679_1001099474 | 94 |
| 88 | 3300005530 | Ga0070679_100167364 | Ga0070679_1001673644 | 94 |
| 89 | 3300005530 | Ga0070679_100895170 | Ga0070679_1008951702 | 94 |
| 90 | 3300005530 | Ga0070679_101210101 | Ga0070679_1012101012 | 94 |
| 91 | 3300005530 | Ga0070679_101586879 | Ga0070679_1015868791 | 94 |
| 92 | 3300005535 | Ga0070684_100058628 | Ga0070684_1000586286 | 94 |
| 93 | 3300005535 | Ga0070684_100059382 | Ga0070684_1000593824 | 94 |
| 94 | 3300005535 | Ga0070684_100410114 | Ga0070684_1004101143 | 94 |
| 95 | 3300005535 | Ga0070684_101738357 | Ga0070684_1017383572 | 94 |
| 96 | 3300005536 | Ga0070697_100529133 | Ga0070697_1005291331 | 94 |
| 97 | 3300005536 | Ga0070697_101551672 | Ga0070697_1015516721 | 94 |
| 98 | 3300005539 | Ga0068853_101339029 | Ga0068853_1013390291 | 94 |
| 99 | 3300005545 | Ga0070695_100534343 | Ga0070695_1005343433 | 94 |
| 100 | 3300005545 | Ga0070695_100705813 | Ga0070695_1007058132 | 94 |
| 101 | 3300005563 | Ga0068855_100103445 | Ga0068855_1001034452 | 94 |
| 102 | 3300005563 | Ga0068855_100480351 | Ga0068855_1004803512 | 94 |
| 103 | 3300005563 | Ga0068855_102519068 | Ga0068855_1025190682 | 94 |
| 104 | 3300005564 | Ga0070664_101260651 | Ga0070664_1012606511 | 94 |
| 105 | 3300005577 | Ga0068857_100098496 | Ga0068857_1000984966 | 94 |
| 106 | 3300005614 | Ga0068856_100168136 | Ga0068856_1001681362 | 94 |
| 107 | 3300005614 | Ga0068856_101040788 | Ga0068856_1010407882 | 94 |
| 108 | 3300005614 | Ga0068856_101108220 | Ga0068856_1011082201 | 94 |
| 109 | 3300005615 | Ga0070702_100557016 | Ga0070702_1005570161 | 94 |
| 110 | 3300005616 | Ga0068852_100320733 | Ga0068852_1003207332 | 94 |
| 111 | 3300005840 | Ga0068870_10052226 | Ga0068870_100522261 | 94 |
| 112 | 3300005841 | Ga0068863_101741703 | Ga0068863_1017417032 | 94 |
| 113 | 3300005937 | Ga0081455_10020969 | Ga0081455_100209698 | 94 |
| 114 | 3300006028 | Ga0070717_10206692 | Ga0070717_102066922 | 94 |
| 115 | 3300006028 | Ga0070717_10420690 | Ga0070717_104206902 | 94 |
| 116 | 3300006028 | Ga0070717_10901160 | Ga0070717_109011602 | 94 |
| 117 | 3300006028 | Ga0070717_10989482 | Ga0070717_109894821 | 94 |
| 118 | 3300006028 | Ga0070717_11300949 | Ga0070717_113009491 | 94 |
| 119 | 3300006028 | Ga0070717_11847699 | Ga0070717_118476992 | 94 |
| 120 | 3300006028 | Ga0070717_12024794 | Ga0070717_120247942 | 94 |
| 121 | 3300006175 | Ga0070712_100013377 | Ga0070712_1000133772 | 94 |
| 122 | 3300006175 | Ga0070712_100467619 | Ga0070712_1004676192 | 94 |
| 123 | 3300006175 | Ga0070712_100939653 | Ga0070712_1009396531 | 94 |
| 124 | 3300006237 | Ga0097621_102391097 | Ga0097621_1023910971 | 94 |
| 125 | 3300006871 | Ga0075434_100256343 | Ga0075434_1002563433 | 94 |
| 126 | 3300006871 | Ga0075434_101123386 | Ga0075434_1011233862 | 94 |
| 127 | 3300006881 | Ga0068865_100498195 | Ga0068865_1004981952 | 94 |
| 128 | 3300007788 | Ga0099795_10381309 | Ga0099795_103813091 | 94 |
| 129 | 3300009093 | Ga0105240_10255691 | Ga0105240_102556913 | 94 |
| 130 | 3300009093 | Ga0105240_10488401 | Ga0105240_104884011 | 94 |
| 131 | 3300009098 | Ga0105245_10883840 | Ga0105245_108838401 | 94 |
| 132 | 3300009098 | Ga0105245_11363227 | Ga0105245_113632272 | 94 |
| 133 | 3300009098 | Ga0105245_11435914 | Ga0105245_114359142 | 94 |
| 134 | 3300009147 | Ga0114129_12987954 | Ga0114129_129879541 | 94 |
| 135 | 3300009174 | Ga0105241_11386207 | Ga0105241_113862072 | 94 |
| 136 | 3300009177 | Ga0105248_10682833 | Ga0105248_106828332 | 94 |
| 137 | 3300009551 | Ga0105238_11388797 | Ga0105238_113887972 | 94 |
| 138 | 3300013100 | Ga0157373_10182999 | Ga0157373_101829993 | 94 |
| 139 | 3300013100 | Ga0157373_10411135 | Ga0157373_104111352 | 94 |
| 140 | 3300013100 | Ga0157373_10921079 | Ga0157373_109210791 | 94 |
| 141 | 3300013102 | Ga0157371_10172416 | Ga0157371_101724162 | 94 |
| 142 | 3300013104 | Ga0157370_10032471 | Ga0157370_100324717 | 94 |
| 143 | 3300013104 | Ga0157370_10088924 | Ga0157370_100889244 | 94 |
| 144 | 3300013104 | Ga0157370_10346077 | Ga0157370_103460772 | 94 |
| 145 | 3300013104 | Ga0157370_10976749 | Ga0157370_109767492 | 94 |
| 146 | 3300013104 | Ga0157370_11142537 | Ga0157370_111425372 | 94 |
| 147 | 3300013105 | Ga0157369_10003200 | Ga0157369_1000320022 | 94 |
| 148 | 3300013105 | Ga0157369_10004869 | Ga0157369_1000486910 | 94 |
| 149 | 3300013105 | Ga0157369_10626808 | Ga0157369_106268082 | 94 |
| 150 | 3300013105 | Ga0157369_10694822 | Ga0157369_106948222 | 94 |
| 151 | 3300013105 | Ga0157369_11648417 | Ga0157369_116484172 | 94 |
| 152 | 3300013105 | Ga0157369_11823415 | Ga0157369_118234152 | 94 |
| 153 | 3300013105 | Ga0157369_12403477 | Ga0157369_124034772 | 94 |
| 154 | 3300013296 | Ga0157374_11132829 | Ga0157374_111328291 | 94 |
| 155 | 3300013296 | Ga0157374_12746538 | Ga0157374_127465381 | 94 |
| 156 | 3300013297 | Ga0157378_13046789 | Ga0157378_130467891 | 94 |
| 157 | 3300013306 | Ga0163162_13067028 | Ga0163162_130670282 | 94 |
| 158 | 3300013307 | Ga0157372_10590391 | Ga0157372_105903912 | 94 |
| 159 | 3300013307 | Ga0157372_11454430 | Ga0157372_114544302 | 94 |
| 160 | 3300013307 | Ga0157372_13460984 | Ga0157372_134609842 | 94 |
| 161 | 3300013308 | Ga0157375_11264911 | Ga0157375_112649112 | 94 |
| 162 | 3300014325 | Ga0163163_10941083 | Ga0163163_109410832 | 94 |
| 163 | 3300014497 | Ga0182008_10005314 | Ga0182008_100053149 | 94 |
| 164 | 3300014969 | Ga0157376_10140291 | Ga0157376_101402913 | 94 |
| 165 | 3300014969 | Ga0157376_10305385 | Ga0157376_103053852 | 94 |
| 166 | 3300015261 | Ga0182006_1025671 | Ga0182006_10256713 | 94 |
| 167 | 3300015262 | Ga0182007_10076073 | Ga0182007_100760732 | 94 |
| 168 | 3300015262 | Ga0182007_10427022 | Ga0182007_104270221 | 94 |
| 169 | 3300020069 | Ga0197907_10267437 | Ga0197907_102674373 | 94 |
| 170 | 3300020069 | Ga0197907_10963986 | Ga0197907_109639861 | 94 |
| 171 | 3300020069 | Ga0197907_11254682 | Ga0197907_112546822 | 94 |
| 172 | 3300020070 | Ga0206356_10174204 | Ga0206356_101742042 | 94 |
| 173 | 3300020070 | Ga0206356_10701452 | Ga0206356_107014522 | 94 |
| 174 | 3300020070 | Ga0206356_11028757 | Ga0206356_110287572 | 94 |
| 175 | 3300020070 | Ga0206356_11192081 | Ga0206356_111920812 | 94 |
| 176 | 3300020070 | Ga0206356_11883155 | Ga0206356_118831553 | 94 |
| 177 | 3300020078 | Ga0206352_10574231 | Ga0206352_105742312 | 94 |
| 178 | 3300020081 | Ga0206354_10004548 | Ga0206354_100045482 | 94 |
| 179 | 3300020081 | Ga0206354_10142278 | Ga0206354_101422788 | 94 |
| 180 | 3300020081 | Ga0206354_10301941 | Ga0206354_103019412 | 94 |
| 181 | 3300020082 | Ga0206353_10051125 | Ga0206353_100511254 | 94 |
| 182 | 3300020082 | Ga0206353_10282100 | Ga0206353_102821002 | 94 |
| 183 | 3300020082 | Ga0206353_10317063 | Ga0206353_103170631 | 94 |
| 184 | 3300020610 | Ga0154015_1261422 | Ga0154015_12614221 | 94 |
| 185 | 3300022467 | Ga0224712_10195365 | Ga0224712_101953652 | 94 |
| 186 | 3300022467 | Ga0224712_10275473 | Ga0224712_102754731 | 94 |
| 187 | 3300025898 | Ga0207692_10439431 | Ga0207692_104394312 | 94 |
| 188 | 3300025900 | Ga0207710_10488447 | Ga0207710_104884471 | 94 |
| 189 | 3300025903 | Ga0207680_11176960 | Ga0207680_111769601 | 94 |
| 190 | 3300025906 | Ga0207699_10348603 | Ga0207699_103486032 | 94 |
| 191 | 3300025908 | Ga0207643_10163680 | Ga0207643_101636802 | 94 |
| 192 | 3300025909 | Ga0207705_10129920 | Ga0207705_101299203 | 94 |
| 193 | 3300025909 | Ga0207705_10132690 | Ga0207705_101326902 | 94 |
| 194 | 3300025909 | Ga0207705_10314570 | Ga0207705_103145702 | 94 |
| 195 | 3300025909 | Ga0207705_10411764 | Ga0207705_104117642 | 94 |
| 196 | 3300025909 | Ga0207705_10509120 | Ga0207705_105091202 | 94 |
| 197 | 3300025909 | Ga0207705_11029514 | Ga0207705_110295141 | 94 |
| 198 | 3300025910 | Ga0207684_11031966 | Ga0207684_110319661 | 94 |
| 199 | 3300025912 | Ga0207707_10018384 | Ga0207707_100183845 | 94 |
| 200 | 3300025912 | Ga0207707_10061795 | Ga0207707_100617951 | 94 |
| 201 | 3300025912 | Ga0207707_10143675 | Ga0207707_101436752 | 94 |
| 202 | 3300025912 | Ga0207707_10230075 | Ga0207707_102300752 | 94 |
| 203 | 3300025912 | Ga0207707_10475833 | Ga0207707_104758332 | 94 |
| 204 | 3300025913 | Ga0207695_10213205 | Ga0207695_102132052 | 94 |
| 205 | 3300025913 | Ga0207695_10779961 | Ga0207695_107799612 | 94 |
| 206 | 3300025915 | Ga0207693_11117481 | Ga0207693_111174811 | 94 |
| 207 | 3300025915 | Ga0207693_11429629 | Ga0207693_114296292 | 94 |
| 208 | 3300025916 | Ga0207663_10525687 | Ga0207663_105256871 | 94 |
| 209 | 3300025916 | Ga0207663_10885437 | Ga0207663_108854372 | 94 |
| 210 | 3300025916 | Ga0207663_11683109 | Ga0207663_116831091 | 94 |
| 211 | 3300025917 | Ga0207660_10079442 | Ga0207660_100794424 | 94 |
| 212 | 3300025917 | Ga0207660_10232325 | Ga0207660_102323253 | 94 |
| 213 | 3300025917 | Ga0207660_11094667 | Ga0207660_110946672 | 94 |
| 214 | 3300025919 | Ga0207657_10001104 | Ga0207657_100011041 | 94 |
| 215 | 3300025919 | Ga0207657_10002919 | Ga0207657_1000291915 | 94 |
| 216 | 3300025919 | Ga0207657_10014969 | Ga0207657_100149698 | 94 |
| 217 | 3300025919 | Ga0207657_10017609 | Ga0207657_100176093 | 94 |
| 218 | 3300025919 | Ga0207657_10968257 | Ga0207657_109682572 | 94 |
| 219 | 3300025920 | Ga0207649_10102721 | Ga0207649_101027211 | 94 |
| 220 | 3300025921 | Ga0207652_10004470 | Ga0207652_100044704 | 94 |
| 221 | 3300025921 | Ga0207652_10062411 | Ga0207652_100624115 | 94 |
| 222 | 3300025921 | Ga0207652_10174843 | Ga0207652_101748433 | 94 |
| 223 | 3300025921 | Ga0207652_10376325 | Ga0207652_103763252 | 94 |
| 224 | 3300025921 | Ga0207652_10727539 | Ga0207652_107275393 | 94 |
| 225 | 3300025921 | Ga0207652_11215059 | Ga0207652_112150592 | 94 |
| 226 | 3300025921 | Ga0207652_11478857 | Ga0207652_114788572 | 94 |
| 227 | 3300025922 | Ga0207646_10404079 | Ga0207646_104040792 | 94 |
| 228 | 3300025922 | Ga0207646_10523944 | Ga0207646_105239443 | 94 |
| 229 | 3300025922 | Ga0207646_10969086 | Ga0207646_109690861 | 94 |
| 230 | 3300025924 | Ga0207694_10869289 | Ga0207694_108692892 | 94 |
| 231 | 3300025927 | Ga0207687_10166702 | Ga0207687_101667022 | 94 |
| 232 | 3300025927 | Ga0207687_10866207 | Ga0207687_108662071 | 94 |
| 233 | 3300025927 | Ga0207687_11205473 | Ga0207687_112054731 | 94 |
| 234 | 3300025928 | Ga0207700_10213771 | Ga0207700_102137712 | 94 |
| 235 | 3300025928 | Ga0207700_10608692 | Ga0207700_106086922 | 94 |
| 236 | 3300025928 | Ga0207700_11740099 | Ga0207700_117400991 | 94 |
| 237 | 3300025929 | Ga0207664_10015703 | Ga0207664_100157039 | 94 |
| 238 | 3300025929 | Ga0207664_10094534 | Ga0207664_100945342 | 94 |
| 239 | 3300025929 | Ga0207664_10118480 | Ga0207664_101184802 | 94 |
| 240 | 3300025929 | Ga0207664_10129785 | Ga0207664_101297855 | 94 |
| 241 | 3300025929 | Ga0207664_10315288 | Ga0207664_103152881 | 94 |
| 242 | 3300025929 | Ga0207664_10438572 | Ga0207664_104385723 | 94 |
| 243 | 3300025929 | Ga0207664_10990639 | Ga0207664_109906391 | 94 |
| 244 | 3300025931 | Ga0207644_11295996 | Ga0207644_112959962 | 94 |
| 245 | 3300025932 | Ga0207690_10677409 | Ga0207690_106774091 | 94 |
| 246 | 3300025932 | Ga0207690_11497017 | Ga0207690_114970171 | 94 |
| 247 | 3300025941 | Ga0207711_11105077 | Ga0207711_111050771 | 94 |
| 248 | 3300025944 | Ga0207661_10024364 | Ga0207661_100243644 | 94 |
| 249 | 3300025944 | Ga0207661_10105571 | Ga0207661_101055711 | 94 |
| 250 | 3300025944 | Ga0207661_10121159 | Ga0207661_101211591 | 94 |
| 251 | 3300025944 | Ga0207661_10151018 | Ga0207661_101510183 | 94 |
| 252 | 3300025944 | Ga0207661_10242465 | Ga0207661_102424652 | 94 |
| 253 | 3300025944 | Ga0207661_10300026 | Ga0207661_103000262 | 94 |
| 254 | 3300025944 | Ga0207661_10577904 | Ga0207661_105779043 | 94 |
| 255 | 3300025945 | Ga0207679_11693600 | Ga0207679_116936002 | 94 |
| 256 | 3300025949 | Ga0207667_10252658 | Ga0207667_102526582 | 94 |
| 257 | 3300025949 | Ga0207667_10292511 | Ga0207667_102925113 | 94 |
| 258 | 3300025949 | Ga0207667_10765823 | Ga0207667_107658233 | 94 |
| 259 | 3300025949 | Ga0207667_11092245 | Ga0207667_110922452 | 94 |
| 260 | 3300025949 | Ga0207667_11483119 | Ga0207667_114831192 | 94 |
| 261 | 3300025949 | Ga0207667_11630359 | Ga0207667_116303591 | 94 |
| 262 | 3300026023 | Ga0207677_10301787 | Ga0207677_103017872 | 94 |
| 263 | 3300026067 | Ga0207678_10622041 | Ga0207678_106220411 | 94 |
| 264 | 3300026067 | Ga0207678_11366548 | Ga0207678_113665481 | 94 |
| 265 | 3300026078 | Ga0207702_10038773 | Ga0207702_100387734 | 94 |
| 266 | 3300026078 | Ga0207702_10133650 | Ga0207702_101336504 | 94 |
| 267 | 3300026078 | Ga0207702_10157865 | Ga0207702_101578653 | 94 |
| 268 | 3300026078 | Ga0207702_11954415 | Ga0207702_119544152 | 94 |
| 269 | 3300026078 | Ga0207702_12040999 | Ga0207702_120409992 | 94 |
| 270 | 3300026116 | Ga0207674_10123547 | Ga0207674_101235472 | 94 |
| 271 | 3300026116 | Ga0207674_10960793 | Ga0207674_109607932 | 94 |
| 272 | 3300026121 | Ga0207683_10704254 | Ga0207683_107042542 | 94 |
| 273 | 3300026142 | Ga0207698_10680292 | Ga0207698_106802922 | 94 |
| 274 | 3300028556 | Ga0265337_1101504 | Ga0265337_11015042 | 94 |
| 275 | 3300028558 | Ga0265326_10158169 | Ga0265326_101581692 | 94 |
| 276 | 3300028563 | Ga0265319_1061665 | Ga0265319_10616652 | 94 |
| 277 | 3300028573 | Ga0265334_10014296 | Ga0265334_100142964 | 94 |
| 278 | 3300028573 | Ga0265334_10295814 | Ga0265334_102958141 | 94 |
| 279 | 3300028577 | Ga0265318_10176095 | Ga0265318_101760952 | 94 |
| 280 | 3300028653 | Ga0265323_10264768 | Ga0265323_102647682 | 94 |
| 281 | 3300028654 | Ga0265322_10129724 | Ga0265322_101297242 | 94 |
| 282 | 3300028800 | Ga0265338_10001061 | Ga0265338_1000106125 | 94 |
| 283 | 3300031239 | Ga0265328_10097393 | Ga0265328_100973931 | 94 |
| 284 | 3300031241 | Ga0265325_10026363 | Ga0265325_100263633 | 94 |
| 285 | 3300031247 | Ga0265340_10019066 | Ga0265340_100190662 | 94 |
| 286 | 3300031247 | Ga0265340_10188476 | Ga0265340_101884762 | 94 |
| 287 | 3300031250 | Ga0265331_10045887 | Ga0265331_100458872 | 94 |
| 288 | 3300031251 | Ga0265327_10009412 | Ga0265327_100094126 | 94 |
| 289 | 3300031711 | Ga0265314_10438415 | Ga0265314_104384151 | 94 |
| 290 | 3300031712 | Ga0265342_10155564 | Ga0265342_101555642 | 94 |
| 291 | 3300031731 | Ga0307405_10136991 | Ga0307405_101369911 | 94 |
| 292 | 3300031911 | Ga0307412_10658301 | Ga0307412_106583011 | 94 |
| 293 | 3300031995 | Ga0307409_100228210 | Ga0307409_1002282101 | 94 |
| 294 | 3300032002 | Ga0307416_100583872 | Ga0307416_1005838722 | 94 |
| 295 | 3300032126 | Ga0307415_100285119 | Ga0307415_1002851192 | 94 |
| 296 | 3300032133 | Ga0316583_10027040 | Ga0316583_100270404 | 94 |
| 297 | 3300034816 | Ga0373930_0126109 | Ga0373930_0126109_138_425 | 94 |
| 298 | 3300035083 | Ga0373926_0064217 | Ga0373926_0064217_346_630 | 94 |
| 299 | 3300035083 | Ga0373926_0335750 | Ga0373926_0335750_142_429 | 94 |
| 300 | 3300035086 | Ga0373934_0198865 | Ga0373934_0198865_521_805 | 94 |
| 301 | 3300035086 | Ga0373934_0399495 | Ga0373934_0399495_238_522 | 94 |
| 302 | 3300035089 | Ga0373944_0417465 | Ga0373944_0417465_13_297 | 94 |
| 303 | 3300035113 | Ga0373936_0407129 | Ga0373936_0407129_259_546 | 94 |
| 304 | 3300035116 | Ga0373945_0087329 | Ga0373945_0087329_819_1106 | 94 |
| 305 | 3300035117 | Ga0373953_0427407 | Ga0373953_0427407_154_438 | 94 |
| 306 | 3300035119 | Ga0373956_0027981 | Ga0373956_0027981_128_412 | 94 |
| 307 | 3300035119 | Ga0373956_0208880 | Ga0373956_0208880_421_705 | 94 |
| 308 | 3300035120 | Ga0373957_0015440 | Ga0373957_0015440_1799_2083 | 94 |
| 309 | 3300035170 | Ga0373943_0004151 | Ga0373943_0004151_5291_5575 | 94 |
| 310 | 3300035172 | Ga0373955_0114068 | Ga0373955_0114068_404_688 | 94 |
| 311 | 3300035172 | Ga0373955_0372242 | Ga0373955_0372242_189_473 | 94 |
| 312 | 3300035242 | Ga0373962_0352613 | Ga0373962_0352613_185_469 | 94 |
| 313 | 3300035410 | Ga0373924_0065387 | Ga0373924_0065387_923_1207 | 94 |
| 314 | 3300035410 | Ga0373924_0169375 | Ga0373924_0169375_408_692 | 94 |
| 315 | 3300035692 | Ga0373935_0315059 | Ga0373935_0315059_94_378 | 94 |
| 316 | 3300035695 | Ga0373927_0327335 | Ga0373927_0327335_86_370 | 94 |
| 317 | 3300035724 | Ga0373933_0206893 | Ga0373933_0206893_721_1005 | 94 |
| 318 | 3300035724 | Ga0373933_0862788 | Ga0373933_0862788_204_488 | 94 |
| 319 | 3300035725 | Ga0373947_1010048 | Ga0373947_1010048_83_367 | 94 |
| 320 | 3300036401 | Ga0373937_0029383 | Ga0373937_0029383_3433_3717 | 94 |
| 321 | 3300036401 | Ga0373937_0251008 | Ga0373937_0251008_264_548 | 94 |
| 322 | 3300036401 | Ga0373937_1988359 | Ga0373937_1988359_40_324 | 94 |
| 323 | 3300037068 | Ga0373925_0272133 | Ga0373925_0272133_1038_1322 | 94 |
| 324 | 3300037312 | Ga0395899_0039816 | Ga0395899_0039816_335_619 | 94 |
| 325 | 3300037312 | Ga0395899_0130952 | Ga0395899_0130952_1112_1396 | 94 |
| 326 | 3300037312 | Ga0395899_0213646 | Ga0395899_0213646_820_1104 | 94 |
| 327 | 3300037312 | Ga0395899_0989986 | Ga0395899_0989986_214_498 | 94 |
| 328 | 3300037418 | Ga0395900_0028277 | Ga0395900_0028277_463_747 | 94 |
| 329 | 3300037418 | Ga0395900_0041052 | Ga0395900_0041052_3553_3837 | 94 |
| 330 | 3300037418 | Ga0395900_0118573 | Ga0395900_0118573_1602_1886 | 94 |
| 331 | 3300037418 | Ga0395900_0209036 | Ga0395900_0209036_903_1187 | 94 |
| 332 | 3300037418 | Ga0395900_0279582 | Ga0395900_0279582_356_640 | 94 |
| 333 | 3300037418 | Ga0395900_0403402 | Ga0395900_0403402_750_1034 | 94 |
| 334 | 3300037418 | Ga0395900_0910925 | Ga0395900_0910925_324_608 | 94 |
| 335 | 3300037418 | Ga0395900_1357571 | Ga0395900_1357571_318_602 | 94 |
| 336 | 3300037466 | Ga0395898_0024624 | Ga0395898_0024624_2570_2854 | 94 |
| 337 | 3300037466 | Ga0395898_0119584 | Ga0395898_0119584_336_620 | 94 |
| 338 | 3300037466 | Ga0395898_0136399 | Ga0395898_0136399_1398_1682 | 94 |
| 339 | 3300037466 | Ga0395898_0215187 | Ga0395898_0215187_877_1161 | 94 |
| 340 | 3300037466 | Ga0395898_0386307 | Ga0395898_0386307_352_636 | 94 |
| 341 | 3300037466 | Ga0395898_0754136 | Ga0395898_0754136_185_469 | 94 |
| 342 | 3300037466 | Ga0395898_0807227 | Ga0395898_0807227_331_615 | 94 |
| 343 | 3300037466 | Ga0395898_1276464 | Ga0395898_1276464_260_544 | 94 |
| 344 | 3300037466 | Ga0395898_1363730 | Ga0395898_1363730_22_306 | 94 |
| 345 | 3300037466 | Ga0395898_1416966 | Ga0395898_1416966_203_487 | 94 |
| 346 | 3300037471 | Ga0395905_0042696 | Ga0395905_0042696_2883_3167 | 94 |
| 347 | 3300037471 | Ga0395905_0102993 | Ga0395905_0102993_1516_1800 | 94 |
| 348 | 3300037471 | Ga0395905_0181870 | Ga0395905_0181870_1175_1459 | 94 |
| 349 | 3300037471 | Ga0395905_0232240 | Ga0395905_0232240_391_675 | 94 |
| 350 | 3300037471 | Ga0395905_0543926 | Ga0395905_0543926_351_635 | 94 |
| 351 | 3300037471 | Ga0395905_0991758 | Ga0395905_0991758_342_626 | 94 |
| 352 | 3300037471 | Ga0395905_1081152 | Ga0395905_1081152_410_694 | 94 |
| 353 | 3300037471 | Ga0395905_1147836 | Ga0395905_1147836_48_332 | 94 |
| 354 | 3300038443 | Ga0395901_0004378 | Ga0395901_0004378_6666_6950 | 94 |
| 355 | 3300038443 | Ga0395901_0031826 | Ga0395901_0031826_4386_4670 | 94 |
| 356 | 3300038443 | Ga0395901_0135742 | Ga0395901_0135742_897_1181 | 94 |
| 357 | 3300038443 | Ga0395901_0164192 | Ga0395901_0164192_939_1223 | 94 |
| 358 | 3300038443 | Ga0395901_0354310 | Ga0395901_0354310_128_412 | 94 |
| 359 | 3300038443 | Ga0395901_0364844 | Ga0395901_0364844_868_1152 | 94 |
| 360 | 3300038443 | Ga0395901_0376792 | Ga0395901_0376792_600_884 | 94 |
| 361 | 3300038443 | Ga0395901_0856039 | Ga0395901_0856039_350_634 | 94 |
| 362 | 3300038443 | Ga0395901_1049632 | Ga0395901_1049632_50_334 | 94 |
| 363 | 3300038443 | Ga0395901_1164636 | Ga0395901_1164636_46_330 | 94 |
| 364 | 3300038443 | Ga0395901_1816261 | Ga0395901_1816261_21_305 | 94 |
| 365 | 3300039437 | Ga0436365_0463966 | Ga0436365_0463966_59_343 | 94 |
| 366 | 3300039437 | Ga0436365_1583841 | Ga0436365_1583841_370_654 | 94 |
| 367 | 3300039437 | Ga0436365_1619546 | Ga0436365_1619546_148_432 | 94 |
| 368 | 3300039450 | Ga0436363_0347133 | Ga0436363_0347133_365_649 | 94 |
| 369 | 3300039450 | Ga0436363_0554650 | Ga0436363_0554650_460_744 | 94 |
| 370 | 3300041486 | Ga0451807_1951536 | Ga0451807_1951536_321_605 | 94 |
| 371 | 3300041512 | Ga0451853_1170030 | Ga0451853_1170030_59_343 | 94 |
| 372 | 3300041512 | Ga0451853_1356713 | Ga0451853_1356713_1905_2189 | 94 |
| 373 | 3300042005 | Ga0439448_0222166 | Ga0439448_0222166_125_412 | 94 |
| 374 | 3300042439 | Ga0439464_0084710 | Ga0439464_0084710_330_617 | 94 |
| 375 | 3300044656 | Ga0466969_0001587 | Ga0466969_0001587_3579_3863 | 94 |
| 376 | 3300044656 | Ga0466969_0123031 | Ga0466969_0123031_600_884 | 94 |
| 377 | 3300044658 | Ga0466972_0162836 | Ga0466972_0162836_662_946 | 94 |
| 378 | 3300044683 | Ga0466965_0082941 | Ga0466965_0082941_295_579 | 94 |
| 379 | 3300044683 | Ga0466965_0429404 | Ga0466965_0429404_201_485 | 94 |
| 380 | 3300044683 | Ga0466965_0733491 | Ga0466965_0733491_98_382 | 94 |
| 381 | 3300044684 | Ga0466966_0005740 | Ga0466966_0005740_1503_1787 | 94 |
| 382 | 3300044684 | Ga0466966_0084392 | Ga0466966_0084392_954_1238 | 94 |
| 383 | 3300044684 | Ga0466966_0105662 | Ga0466966_0105662_601_885 | 94 |
| 384 | 3300044684 | Ga0466966_0118152 | Ga0466966_0118152_565_849 | 94 |
| 385 | 3300044684 | Ga0466966_0361361 | Ga0466966_0361361_61_345 | 94 |
| 386 | 3300044684 | Ga0466966_0394803 | Ga0466966_0394803_487_771 | 94 |
| 387 | 3300044693 | Ga0466961_0119100 | Ga0466961_0119100_1114_1398 | 94 |
| 388 | 3300044693 | Ga0466961_0133392 | Ga0466961_0133392_1076_1360 | 94 |
| 389 | 3300044693 | Ga0466961_0788227 | Ga0466961_0788227_34_318 | 94 |
| 390 | 3300044693 | Ga0466961_0908292 | Ga0466961_0908292_91_375 | 94 |
| 391 | 3300044694 | Ga0466963_0000045 | Ga0466963_0000045_24949_25233 | 94 |
| 392 | 3300044694 | Ga0466963_0000742 | Ga0466963_0000742_7701_7985 | 94 |
| 393 | 3300044694 | Ga0466963_0001619 | Ga0466963_0001619_5994_6278 | 94 |
| 394 | 3300044694 | Ga0466963_0013627 | Ga0466963_0013627_3043_3327 | 94 |
| 395 | 3300044694 | Ga0466963_0045262 | Ga0466963_0045262_1903_2187 | 94 |
| 396 | 3300044694 | Ga0466963_0046621 | Ga0466963_0046621_1243_1527 | 94 |
| 397 | 3300044694 | Ga0466963_0105297 | Ga0466963_0105297_1501_1785 | 94 |
| 398 | 3300044694 | Ga0466963_0105746 | Ga0466963_0105746_1042_1326 | 94 |
| 399 | 3300044694 | Ga0466963_0126419 | Ga0466963_0126419_84_368 | 94 |
| 400 | 3300044694 | Ga0466963_0166014 | Ga0466963_0166014_114_398 | 94 |
| 401 | 3300044694 | Ga0466963_0518237 | Ga0466963_0518237_254_538 | 94 |
| 402 | 3300044694 | Ga0466963_0927785 | Ga0466963_0927785_37_324 | 94 |
| 403 | 3300044694 | Ga0466963_0954305 | Ga0466963_0954305_248_532 | 94 |
| 404 | 3300044706 | Ga0466964_0002707 | Ga0466964_0002707_764_1048 | 94 |
| 405 | 3300044706 | Ga0466964_0054670 | Ga0466964_0054670_859_1143 | 94 |
| 406 | 3300044706 | Ga0466964_0063979 | Ga0466964_0063979_976_1260 | 94 |
| 407 | 3300044706 | Ga0466964_0119990 | Ga0466964_0119990_736_1020 | 94 |
| 408 | 3300044706 | Ga0466964_0237830 | Ga0466964_0237830_538_822 | 94 |
| 409 | 3300044706 | Ga0466964_0384433 | Ga0466964_0384433_168_452 | 94 |
| 410 | 3300044706 | Ga0466964_0529508 | Ga0466964_0529508_335_619 | 94 |
| 411 | 3300044719 | Ga0466971_0001256 | Ga0466971_0001256_8856_9140 | 94 |
| 412 | 3300044719 | Ga0466971_0112310 | Ga0466971_0112310_228_512 | 94 |
| 413 | 3300044719 | Ga0466971_0144623 | Ga0466971_0144623_452_736 | 94 |
| 414 | 3300044735 | Ga0466968_0015466 | Ga0466968_0015466_272_556 | 94 |
| 415 | 3300044735 | Ga0466968_0021995 | Ga0466968_0021995_1800_2084 | 94 |
| 416 | 3300044735 | Ga0466968_0035223 | Ga0466968_0035223_1195_1479 | 94 |
| 417 | 3300044735 | Ga0466968_0054832 | Ga0466968_0054832_737_1021 | 94 |
| 418 | 3300044735 | Ga0466968_0059578 | Ga0466968_0059578_1271_1555 | 94 |
| 419 | 3300044735 | Ga0466968_0091547 | Ga0466968_0091547_795_1079 | 94 |
| 420 | 3300044735 | Ga0466968_0176104 | Ga0466968_0176104_691_975 | 94 |
| 421 | 3300044735 | Ga0466968_0233547 | Ga0466968_0233547_111_395 | 94 |
| 422 | 3300044765 | Ga0466970_0005565 | Ga0466970_0005565_479_763 | 94 |
| 423 | 3300044765 | Ga0466970_0439177 | Ga0466970_0439177_146_430 | 94 |
| 424 | 3300044842 | Ga0466957_0000686 | Ga0466957_0000686_10467_10751 | 94 |
| 425 | 3300044842 | Ga0466957_0020963 | Ga0466957_0020963_995_1279 | 94 |
| 426 | 3300044842 | Ga0466957_0036309 | Ga0466957_0036309_407_691 | 94 |
| 427 | 3300044842 | Ga0466957_0050455 | Ga0466957_0050455_1512_1796 | 94 |
| 428 | 3300044842 | Ga0466957_0195919 | Ga0466957_0195919_316_621 | 94 |
| 429 | 3300044842 | Ga0466957_0248609 | Ga0466957_0248609_721_1005 | 94 |
| 430 | 3300044842 | Ga0466957_0256395 | Ga0466957_0256395_202_486 | 94 |
| 431 | 3300044842 | Ga0466957_0347423 | Ga0466957_0347423_295_579 | 94 |
| 432 | 3300044842 | Ga0466957_0491755 | Ga0466957_0491755_306_590 | 94 |
| 433 | 3300044842 | Ga0466957_0500599 | Ga0466957_0500599_272_556 | 94 |
| 434 | 3300044842 | Ga0466957_1101152 | Ga0466957_1101152_159_443 | 94 |
| 435 | 3300044842 | Ga0466957_1113603 | Ga0466957_1113603_74_358 | 94 |
| 436 | 3300044842 | Ga0466957_1261760 | Ga0466957_1261760_16_300 | 94 |
| 437 | 3300044842 | Ga0466957_1290809 | Ga0466957_1290809_62_346 | 94 |
| 438 | 3300044901 | Ga0466960_0274342 | Ga0466960_0274342_406_690 | 94 |
| 439 | 3300044901 | Ga0466960_0605554 | Ga0466960_0605554_112_396 | 94 |
| 440 | 3300044901 | Ga0466960_0649037 | Ga0466960_0649037_196_480 | 94 |
| 441 | 3300045049 | Ga0466959_0006849 | Ga0466959_0006849_4711_4995 | 94 |
| 442 | 3300045049 | Ga0466959_0030041 | Ga0466959_0030041_650_934 | 94 |
| 443 | 3300045049 | Ga0466959_0054074 | Ga0466959_0054074_953_1237 | 94 |
| 444 | 3300045049 | Ga0466959_0115707 | Ga0466959_0115707_309_593 | 94 |
| 445 | 3300045049 | Ga0466959_0132723 | Ga0466959_0132723_391_675 | 94 |
| 446 | 3300045051 | Ga0451576_2402927 | Ga0451576_2402927_122_406 | 94 |
| 447 | 3300045836 | Ga0466958_0034458 | Ga0466958_0034458_1365_1667 | 94 |
| 448 | 3300045836 | Ga0466958_0105168 | Ga0466958_0105168_335_619 | 94 |
| 449 | 3300045836 | Ga0466958_0105506 | Ga0466958_0105506_269_553 | 94 |
| 450 | 3300045836 | Ga0466958_0211272 | Ga0466958_0211272_487_771 | 94 |
| 451 | 3300045836 | Ga0466958_0334296 | Ga0466958_0334296_323_607 | 94 |
| 452 | 3300045836 | Ga0466958_0340171 | Ga0466958_0340171_535_819 | 94 |
| 453 | 3300045976 | Ga0466967_0000248 | Ga0466967_0000248_14784_15068 | 94 |
| 454 | 3300045976 | Ga0466967_0005994 | Ga0466967_0005994_637_921 | 94 |
| 455 | 3300045976 | Ga0466967_0006248 | Ga0466967_0006248_7213_7497 | 94 |
| 456 | 3300045976 | Ga0466967_0013790 | Ga0466967_0013790_471_755 | 94 |
| 457 | 3300045976 | Ga0466967_0028996 | Ga0466967_0028996_625_909 | 94 |
| 458 | 3300045976 | Ga0466967_0030595 | Ga0466967_0030595_1028_1333 | 94 |
| 459 | 3300045976 | Ga0466967_0044659 | Ga0466967_0044659_3250_3534 | 94 |
| 460 | 3300045976 | Ga0466967_0046221 | Ga0466967_0046221_2829_3113 | 94 |
| 461 | 3300045976 | Ga0466967_0061777 | Ga0466967_0061777_2515_2799 | 94 |
| 462 | 3300045976 | Ga0466967_0062850 | Ga0466967_0062850_1476_1760 | 94 |
| 463 | 3300045976 | Ga0466967_0071542 | Ga0466967_0071542_1797_2081 | 94 |
| 464 | 3300045976 | Ga0466967_0144883 | Ga0466967_0144883_698_982 | 94 |
| 465 | 3300045976 | Ga0466967_0145790 | Ga0466967_0145790_1567_1851 | 94 |
| 466 | 3300045976 | Ga0466967_0179385 | Ga0466967_0179385_944_1228 | 94 |
| 467 | 3300045976 | Ga0466967_0212070 | Ga0466967_0212070_206_490 | 94 |
| 468 | 3300045976 | Ga0466967_0226284 | Ga0466967_0226284_20_304 | 94 |
| 469 | 3300045976 | Ga0466967_0229292 | Ga0466967_0229292_1459_1746 | 94 |
| 470 | 3300045976 | Ga0466967_0362321 | Ga0466967_0362321_1025_1309 | 94 |
| 471 | 3300045976 | Ga0466967_0404704 | Ga0466967_0404704_460_744 | 94 |
| 472 | 3300045976 | Ga0466967_0460910 | Ga0466967_0460910_701_985 | 94 |
| 473 | 3300045976 | Ga0466967_0465633 | Ga0466967_0465633_197_481 | 94 |
| 474 | 3300045976 | Ga0466967_0487336 | Ga0466967_0487336_767_1051 | 94 |
| 475 | 3300045976 | Ga0466967_1005901 | Ga0466967_1005901_418_702 | 94 |
| 476 | 3300045976 | Ga0466967_1018814 | Ga0466967_1018814_447_731 | 94 |
| 477 | 3300045976 | Ga0466967_1030848 | Ga0466967_1030848_182_466 | 94 |
| 478 | 3300045976 | Ga0466967_1167515 | Ga0466967_1167515_103_387 | 94 |
| 479 | 3300045976 | Ga0466967_1293313 | Ga0466967_1293313_405_689 | 94 |
| 480 | 3300045976 | Ga0466967_1462883 | Ga0466967_1462883_60_344 | 94 |
| 481 | 3300045976 | Ga0466967_2342008 | Ga0466967_2342008_193_477 | 94 |
| 482 | 3300046455 | Ga0495603_0710429 | Ga0495603_0710429_73_357 | 94 |
| 483 | 3300046459 | Ga0495629_0706054 | Ga0495629_0706054_233_517 | 94 |
| 484 | 3300046461 | Ga0495641_0042554 | Ga0495641_0042554_1074_1358 | 94 |
| 485 | 3300046461 | Ga0495641_0387962 | Ga0495641_0387962_21_305 | 94 |
| 486 | 3300046461 | Ga0495641_0584335 | Ga0495641_0584335_182_466 | 94 |
| 487 | 3300046462 | Ga0495651_0149048 | Ga0495651_0149048_1369_1653 | 94 |
| 488 | 3300046462 | Ga0495651_0663633 | Ga0495651_0663633_251_535 | 94 |
| 489 | 3300046463 | Ga0495653_0036514 | Ga0495653_0036514_338_622 | 94 |
| 490 | 3300046463 | Ga0495653_0106063 | Ga0495653_0106063_39_323 | 94 |
| 491 | 3300046463 | Ga0495653_0514552 | Ga0495653_0514552_307_591 | 94 |
| 492 | 3300046472 | Ga0495580_0368292 | Ga0495580_0368292_84_368 | 94 |
| 493 | 3300046473 | Ga0495582_0085177 | Ga0495582_0085177_676_960 | 94 |
| 494 | 3300046473 | Ga0495582_0380874 | Ga0495582_0380874_448_732 | 94 |
| 495 | 3300046477 | Ga0495664_0052136 | Ga0495664_0052136_53_337 | 94 |
| 496 | 3300046491 | Ga0495584_0108332 | Ga0495584_0108332_564_851 | 94 |
| 497 | 3300046492 | Ga0495585_0601973 | Ga0495585_0601973_184_471 | 94 |
| 498 | 3300046499 | Ga0495594_0744507 | Ga0495594_0744507_212_496 | 94 |
| 499 | 3300046500 | Ga0495596_0434666 | Ga0495596_0434666_63_350 | 94 |
| 500 | 3300046511 | Ga0495608_0005356 | Ga0495608_0005356_6366_6650 | 94 |
| 501 | 3300046511 | Ga0495608_0013987 | Ga0495608_0013987_3979_4263 | 94 |
| 502 | 3300046511 | Ga0495608_0394353 | Ga0495608_0394353_268_552 | 94 |
| 503 | 3300046514 | Ga0495618_0578049 | Ga0495618_0578049_29_313 | 94 |
| 504 | 3300046517 | Ga0495630_0057166 | Ga0495630_0057166_1678_1962 | 94 |
| 505 | 3300046517 | Ga0495630_0343203 | Ga0495630_0343203_412_699 | 94 |
| 506 | 3300046518 | Ga0495631_0184283 | Ga0495631_0184283_597_884 | 94 |
| 507 | 3300046525 | Ga0495663_0052050 | Ga0495663_0052050_110_397 | 94 |
| 508 | 3300046528 | Ga0495642_0374623 | Ga0495642_0374623_273_560 | 94 |
| 509 | 3300046529 | Ga0495652_0065292 | Ga0495652_0065292_687_971 | 94 |
| 510 | 3300046529 | Ga0495652_0138153 | Ga0495652_0138153_1424_1708 | 94 |
| 511 | 3300046529 | Ga0495652_0184854 | Ga0495652_0184854_837_1121 | 94 |
| 512 | 3300046531 | Ga0495665_0132690 | Ga0495665_0132690_809_1096 | 94 |
| 513 | 3300046536 | Ga0495587_0010553 | Ga0495587_0010553_2460_2744 | 94 |
| 514 | 3300046536 | Ga0495587_0098320 | Ga0495587_0098320_528_812 | 94 |
| 515 | 3300046559 | Ga0495667_0091540 | Ga0495667_0091540_1044_1328 | 94 |
| 516 | 3300046559 | Ga0495667_0154383 | Ga0495667_0154383_624_908 | 94 |
| 517 | 3300046615 | Ga0495656_0203783 | Ga0495656_0203783_541_828 | 94 |
| 518 | 3300046642 | Ga0495634_0043312 | Ga0495634_0043312_2569_2853 | 94 |
| 519 | 3300046648 | Ga0495611_0537664 | Ga0495611_0537664_184_471 | 94 |
| 520 | 3300046663 | Ga0495635_0050980 | Ga0495635_0050980_2349_2633 | 94 |
| 521 | 3300046663 | Ga0495635_0225088 | Ga0495635_0225088_672_956 | 94 |
| 522 | 3300046674 | Ga0495588_0753256 | Ga0495588_0753256_177_464 | 94 |
| 523 | 3300046675 | Ga0495657_0055341 | Ga0495657_0055341_1719_2003 | 94 |
| 524 | 3300046675 | Ga0495657_0062744 | Ga0495657_0062744_2108_2392 | 94 |
| 525 | 3300046675 | Ga0495657_0583008 | Ga0495657_0583008_172_456 | 94 |
| 526 | 3300046678 | Ga0495599_0044374 | Ga0495599_0044374_1640_1924 | 94 |
| 527 | 3300046679 | Ga0495623_0196780 | Ga0495623_0196780_849_1133 | 94 |
| 528 | 3300046679 | Ga0495623_0738448 | Ga0495623_0738448_137_421 | 94 |
| 529 | 3300046680 | Ga0495646_0097604 | Ga0495646_0097604_1276_1560 | 94 |
| 530 | 3300046681 | Ga0495647_0158951 | Ga0495647_0158951_182_466 | 94 |
| 531 | 3300046683 | Ga0495658_0275868 | Ga0495658_0275868_532_816 | 94 |
| 532 | 3300046689 | Ga0495613_0105338 | Ga0495613_0105338_15_299 | 94 |
| 533 | 3300046689 | Ga0495613_0667181 | Ga0495613_0667181_342_626 | 94 |
| 534 | 3300046690 | Ga0495624_0161193 | Ga0495624_0161193_830_1114 | 94 |
| 535 | 3300046690 | Ga0495624_0341355 | Ga0495624_0341355_272_556 | 94 |
| 536 | 3300046809 | Ga0495600_0392319 | Ga0495600_0392319_527_811 | 94 |
| 537 | 3300047315 | Ga0495581_0142491 | Ga0495581_0142491_227_511 | 94 |
| 538 | 3300047315 | Ga0495581_0672075 | Ga0495581_0672075_292_576 | 94 |
| 539 | 3300047317 | Ga0495604_0039781 | Ga0495604_0039781_2584_2868 | 94 |
| 540 | 3300047317 | Ga0495604_0310941 | Ga0495604_0310941_204_488 | 94 |
| 541 | 3300047317 | Ga0495604_0612470 | Ga0495604_0612470_220_504 | 94 |
| 542 | 3300047319 | Ga0495674_0039263 | Ga0495674_0039263_1095_1379 | 94 |
| 543 | 3300047319 | Ga0495674_0125666 | Ga0495674_0125666_1233_1517 | 94 |
| 544 | 3300047321 | Ga0495676_0101779 | Ga0495676_0101779_574_861 | 94 |
| 545 | 3300047321 | Ga0495676_0189501 | Ga0495676_0189501_853_1137 | 94 |
| 546 | 3300047321 | Ga0495676_0968124 | Ga0495676_0968124_146_430 | 94 |
| 547 | 3300047321 | Ga0495676_0995647 | Ga0495676_0995647_16_303 | 94 |
| 548 | 3300047322 | Ga0495680_0015306 | Ga0495680_0015306_2606_2890 | 94 |
| 549 | 3300047322 | Ga0495680_0032766 | Ga0495680_0032766_1852_2136 | 94 |
| 550 | 3300047444 | Ga0495675_0093843 | Ga0495675_0093843_283_567 | 94 |
| 551 | 3300047471 | Ga0495684_0158496 | Ga0495684_0158496_489_773 | 94 |
| 552 | 3300047471 | Ga0495684_0422982 | Ga0495684_0422982_595_879 | 94 |
| 553 | 3300048088 | Ga0495602_1090451 | Ga0495602_1090451_33_317 | 94 |
| 554 | 3300048903 | Ga0496100_0002873 | Ga0496100_0002873_2136_2420 | 94 |
| 555 | 3300048903 | Ga0496100_0888328 | Ga0496100_0888328_126_410 | 94 |
| 556 | 3300048903 | Ga0496100_1250105 | Ga0496100_1250105_74_358 | 94 |
| 557 | 3300048904 | Ga0496101_0213196 | Ga0496101_0213196_638_922 | 94 |
| 558 | 3300048905 | Ga0496102_0004411 | Ga0496102_0004411_11026_11310 | 94 |
| 559 | 3300048905 | Ga0496102_0385265 | Ga0496102_0385265_656_940 | 94 |
| 560 | 3300048905 | Ga0496102_0499160 | Ga0496102_0499160_620_904 | 94 |
| 561 | 3300048906 | Ga0496103_0024537 | Ga0496103_0024537_3190_3474 | 94 |
| 562 | 3300048906 | Ga0496103_0504314 | Ga0496103_0504314_424_708 | 94 |
| 563 | 3300048907 | Ga0496104_0138902 | Ga0496104_0138902_1794_2078 | 94 |
| 564 | 3300048907 | Ga0496104_0940778 | Ga0496104_0940778_299_583 | 94 |
| 565 | 3300048908 | Ga0496105_0026253 | Ga0496105_0026253_2859_3143 | 94 |
| 566 | 3300048908 | Ga0496105_0066005 | Ga0496105_0066005_622_906 | 94 |
| 567 | 3300048908 | Ga0496105_0100296 | Ga0496105_0100296_1464_1748 | 94 |
| 568 | 3300048908 | Ga0496105_1401699 | Ga0496105_1401699_110_394 | 94 |
| 569 | 3300048909 | Ga0496106_0028830 | Ga0496106_0028830_2961_3245 | 94 |
| 570 | 3300048909 | Ga0496106_0070831 | Ga0496106_0070831_2150_2434 | 94 |
| 571 | 3300048909 | Ga0496106_1242738 | Ga0496106_1242738_198_482 | 94 |
| 572 | 3300048910 | Ga0496107_0009417 | Ga0496107_0009417_5836_6120 | 94 |
| 573 | 3300048910 | Ga0496107_0085959 | Ga0496107_0085959_1113_1397 | 94 |
| 574 | 3300048911 | Ga0496108_0007544 | Ga0496108_0007544_6410_6694 | 94 |
| 575 | 3300048911 | Ga0496108_0097220 | Ga0496108_0097220_1627_1911 | 94 |
| 576 | 3300048911 | Ga0496108_0230534 | Ga0496108_0230534_1094_1378 | 94 |
| 577 | 3300048911 | Ga0496108_0585493 | Ga0496108_0585493_297_581 | 94 |
| 578 | 3300048912 | Ga0496109_0044918 | Ga0496109_0044918_2484_2768 | 94 |
| 579 | 3300048912 | Ga0496109_0047917 | Ga0496109_0047917_968_1252 | 94 |
| 580 | 3300048912 | Ga0496109_0053800 | Ga0496109_0053800_3297_3581 | 94 |
| 581 | 3300048912 | Ga0496109_0124580 | Ga0496109_0124580_139_423 | 94 |
| 582 | 3300048912 | Ga0496109_0336788 | Ga0496109_0336788_825_1109 | 94 |
| 583 | 3300048912 | Ga0496109_0598490 | Ga0496109_0598490_27_314 | 94 |
| 584 | 3300048913 | Ga0496110_0399220 | Ga0496110_0399220_861_1145 | 94 |
| 585 | 3300048914 | Ga0496111_0153466 | Ga0496111_0153466_370_654 | 94 |
| 586 | 3300048914 | Ga0496111_0340413 | Ga0496111_0340413_139_423 | 94 |
| 587 | 3300048914 | Ga0496111_0647201 | Ga0496111_0647201_77_361 | 94 |
| 588 | 3300048915 | Ga0496112_0020070 | Ga0496112_0020070_5611_5895 | 94 |
| 589 | 3300048915 | Ga0496112_0023014 | Ga0496112_0023014_5313_5597 | 94 |
| 590 | 3300048915 | Ga0496112_0060683 | Ga0496112_0060683_1551_1835 | 94 |
| 591 | 3300048915 | Ga0496112_0276705 | Ga0496112_0276705_938_1222 | 94 |
| 592 | 3300048915 | Ga0496112_0385125 | Ga0496112_0385125_193_477 | 94 |
| 593 | 3300048915 | Ga0496112_0539462 | Ga0496112_0539462_257_541 | 94 |
| 594 | 3300048915 | Ga0496112_1395535 | Ga0496112_1395535_109_393 | 94 |
| 595 | 3300048916 | Ga0496113_1049588 | Ga0496113_1049588_303_587 | 94 |
| 596 | 3300048917 | Ga0496114_0008800 | Ga0496114_0008800_7090_7374 | 94 |
| 597 | 3300048917 | Ga0496114_0130695 | Ga0496114_0130695_1300_1584 | 94 |
| 598 | 3300048917 | Ga0496114_0136277 | Ga0496114_0136277_909_1196 | 94 |
| 599 | 3300048917 | Ga0496114_0411493 | Ga0496114_0411493_549_836 | 94 |
| 600 | 3300048917 | Ga0496114_1038648 | Ga0496114_1038648_320_604 | 94 |
| 601 | 3300048917 | Ga0496114_1045240 | Ga0496114_1045240_300_584 | 94 |
| 602 | 3300048918 | Ga0496115_0000468 | Ga0496115_0000468_2622_2906 | 94 |
| 603 | 3300048918 | Ga0496115_0003165 | Ga0496115_0003165_4952_5236 | 94 |
| 604 | 3300048918 | Ga0496115_0448111 | Ga0496115_0448111_276_560 | 94 |
| 605 | 3300049569 | Ga0501032_0794657 | Ga0501032_0794657_43_327 | 94 |
| 606 | 3300049571 | Ga0501034_0065603 | Ga0501034_0065603_1006_1290 | 94 |
| 607 | 3300049573 | Ga0501037_0606206 | Ga0501037_0606206_200_484 | 94 |
| 608 | 3300049579 | Ga0501043_0483196 | Ga0501043_0483196_83_367 | 94 |
| 609 | 3300049580 | Ga0501046_0453813 | Ga0501046_0453813_524_808 | 94 |
| 610 | 3300049581 | Ga0501047_0020647 | Ga0501047_0020647_3770_4057 | 94 |
| 611 | 3300049581 | Ga0501047_0030926 | Ga0501047_0030926_1316_1603 | 94 |
| 612 | 3300049581 | Ga0501047_0089203 | Ga0501047_0089203_717_1001 | 94 |
| 613 | 3300049581 | Ga0501047_0114792 | Ga0501047_0114792_1907_2191 | 94 |
| 614 | 3300049581 | Ga0501047_0251911 | Ga0501047_0251911_1116_1400 | 94 |
| 615 | 3300049582 | Ga0501048_1191468 | Ga0501048_1191468_124_408 | 94 |
| 616 | 3300049583 | Ga0501067_0016225 | Ga0501067_0016225_2816_3100 | 94 |
| 617 | 3300049583 | Ga0501067_0114053 | Ga0501067_0114053_736_1020 | 94 |
| 618 | 3300049583 | Ga0501067_0182860 | Ga0501067_0182860_158_442 | 94 |
| 619 | 3300049584 | Ga0501068_0175729 | Ga0501068_0175729_1053_1337 | 94 |
| 620 | 3300049584 | Ga0501068_1156162 | Ga0501068_1156162_92_379 | 94 |
| 621 | 3300049585 | Ga0501069_0041601 | Ga0501069_0041601_698_982 | 94 |
| 622 | 3300049585 | Ga0501069_0091310 | Ga0501069_0091310_54_338 | 94 |
| 623 | 3300049585 | Ga0501069_0112901 | Ga0501069_0112901_1083_1367 | 94 |
| 624 | 3300049585 | Ga0501069_0119334 | Ga0501069_0119334_374_658 | 94 |
| 625 | 3300049585 | Ga0501069_0799121 | Ga0501069_0799121_241_525 | 94 |
| 626 | 3300049586 | Ga0501070_0000120 | Ga0501070_0000120_25424_25708 | 94 |
| 627 | 3300049586 | Ga0501070_0007509 | Ga0501070_0007509_4872_5156 | 94 |
| 628 | 3300049586 | Ga0501070_0026784 | Ga0501070_0026784_1037_1321 | 94 |
| 629 | 3300049586 | Ga0501070_0218691 | Ga0501070_0218691_725_1009 | 94 |
| 630 | 3300049588 | Ga0501072_0007793 | Ga0501072_0007793_6491_6775 | 94 |
| 631 | 3300049588 | Ga0501072_0833647 | Ga0501072_0833647_31_315 | 94 |
| 632 | 3300049589 | Ga0501073_0022897 | Ga0501073_0022897_52_336 | 94 |
| 633 | 3300049589 | Ga0501073_0025754 | Ga0501073_0025754_2616_2900 | 94 |
| 634 | 3300049590 | Ga0501074_0014259 | Ga0501074_0014259_1036_1320 | 94 |
| 635 | 3300049590 | Ga0501074_0017916 | Ga0501074_0017916_841_1125 | 94 |
| 636 | 3300049590 | Ga0501074_0369585 | Ga0501074_0369585_375_659 | 94 |
| 637 | 3300049590 | Ga0501074_0475047 | Ga0501074_0475047_21_305 | 94 |
| 638 | 3300049590 | Ga0501074_0492177 | Ga0501074_0492177_127_411 | 94 |
| 639 | 3300049741 | Ga0501079_0103970 | Ga0501079_0103970_1383_1667 | 94 |
| 640 | 3300049741 | Ga0501079_0790433 | Ga0501079_0790433_50_334 | 94 |
| 641 | 3300049741 | Ga0501079_1274216 | Ga0501079_1274216_83_370 | 94 |
| 642 | 3300049742 | Ga0501080_0011468 | Ga0501080_0011468_1387_1671 | 94 |
| 643 | 3300049742 | Ga0501080_0118423 | Ga0501080_0118423_1034_1318 | 94 |
| 644 | 3300049742 | Ga0501080_0125573 | Ga0501080_0125573_643_927 | 94 |
| 645 | 3300049742 | Ga0501080_0192605 | Ga0501080_0192605_814_1101 | 94 |
| 646 | 3300049742 | Ga0501080_0244275 | Ga0501080_0244275_1143_1427 | 94 |
| 647 | 3300049742 | Ga0501080_0363795 | Ga0501080_0363795_12_299 | 94 |
| 648 | 3300049742 | Ga0501080_1657067 | Ga0501080_1657067_108_392 | 94 |
| 649 | 3300049744 | Ga0501083_0002282 | Ga0501083_0002282_10953_11237 | 94 |
| 650 | 3300049744 | Ga0501083_0948207 | Ga0501083_0948207_186_470 | 94 |
| 651 | 3300049822 | Ga0501035_0630558 | Ga0501035_0630558_45_329 | 94 |
| 652 | 3300049822 | Ga0501035_1027154 | Ga0501035_1027154_223_507 | 94 |
| 653 | 3300049823 | Ga0501044_0247094 | Ga0501044_0247094_1426_1710 | 94 |
| 654 | 3300049824 | Ga0501045_1353934 | Ga0501045_1353934_21_305 | 94 |
| 655 | 3300050512 | nmdc:mga0n895_27853_c1 | nmdc:mga0n895_27853_c1_350_634 | 94 |
| 656 | 3300050513 | nmdc:mga0rr50_115739_c1 | nmdc:mga0rr50_115739_c1_686_970 | 94 |
| 657 | 3300050515 | nmdc:mga0a205_132950_c1 | nmdc:mga0a205_132950_c1_918_1202 | 94 |
| 658 | 3300050515 | nmdc:mga0a205_728608_c1 | nmdc:mga0a205_728608_c1_542_829 | 94 |
| 659 | 3300053077 | Ga0495601_0016450 | Ga0495601_0016450_2738_3022 | 94 |
| 660 | 3300053078 | Ga0495612_0212128 | Ga0495612_0212128_523_807 | 94 |
| 661 | 3300053078 | Ga0495612_0255566 | Ga0495612_0255566_12_296 | 94 |
| 662 | 3300053080 | Ga0500635_0305571 | Ga0500635_0305571_257_541 | 94 |
| 663 | 3300053084 | Ga0495595_0007111 | Ga0495595_0007111_245_529 | 94 |
| 664 | 3300053084 | Ga0495595_0129934 | Ga0495595_0129934_781_1065 | 94 |
| 665 | 3300053085 | Ga0495619_0004914 | Ga0495619_0004914_1517_1801 | 94 |
| 666 | 3300053085 | Ga0495619_0212704 | Ga0495619_0212704_412_696 | 94 |
| 667 | 3300054114 | Ga0501084_0124032 | Ga0501084_0124032_1603_1887 | 94 |
| 668 | 3300059605 | Ga0587106_131742 | Ga0587106_131742_186_470 | 94 |
| 669 | 3300060353 | Ga0501082_0053269 | Ga0501082_0053269_1565_1849 | 94 |
| 670 | 3300061719 | Ga0466962_0004936 | Ga0466962_0004936_5120_5404 | 94 |
| 671 | 3300061719 | Ga0466962_0048060 | Ga0466962_0048060_1744_2028 | 94 |
| 672 | 3300061719 | Ga0466962_0062341 | Ga0466962_0062341_733_1017 | 94 |
| 673 | 3300061719 | Ga0466962_0140435 | Ga0466962_0140435_104_388 | 94 |
| 674 | 3300061719 | Ga0466962_0208401 | Ga0466962_0208401_198_503 | 94 |
| 675 | 3300061734 | Ga0530510_0353526 | Ga0530510_0353526_155_439 | 94 |
| 676 | 3300061734 | Ga0530510_0439075 | Ga0530510_0439075_653_937 | 94 |
| 677 | 3300061734 | Ga0530510_0506338 | Ga0530510_0506338_555_839 | 94 |
| 678 | 3300061734 | Ga0530510_0660382 | Ga0530510_0660382_438_722 | 94 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pcq-assembly1.cif.gz_B | crystal structure of mtbaldr (rv2779c) | 0.8048 | 2 | 85 |
| 2cfx-assembly1.cif.gz_C | structure of b.subtilis lrpc | 0.8008 | 2 | 85 |
| 2vc1-assembly1.cif.gz_B | feast or famine regulatory protein (rv3291c)from m. tuberculosis complexed with l-methionine | 0.7957 | 1 | 85 |
| 2w29-assembly1.cif.gz_B | gly102thr mutant of rv3291c | 0.7839 | 1 | 85 |
| 2w25-assembly1.cif.gz_B | crystal structure of glu104ala mutant | 0.7833 | 2 | 85 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2cfxA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.7902 | 2 | 85 | 3.30.70.920 |
| af_P71888_58_138_3.30.70.920 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.7763 | 2 | 83 | 3.30.70.920 |
| 2cg4B02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.7551 | 2 | 83 | 3.30.70.920 |
| 2w24A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.7531 | 1 | 83 | 3.30.70.920 |
| 4pcqD02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.7436 | 2 | 83 | 3.30.70.920 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5IBJ4-F1-model_v4 | GYD domain-containing protein | 0.9995 | 1 | 85 |
|
| AF-A0A7V9I4J8-F1-model_v4 | GYD domain-containing protein | 0.9992 | 1 | 94 |
|
| AF-A0A1F8NY32-F1-model_v4 | GYD domain superfamily | 0.9968 | 1 | 93 |
|
| AF-A0A7C2R6K4-F1-model_v4 | GYD domain-containing protein | 0.9947 | 1 | 93 |
|
| AF-A0A3B9VPI1-F1-model_v4 | GYD domain superfamily | 0.9944 | 7 | 93 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar