F474660
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 678 | 318 | 669 | 287 |
Family's Representative Sequence
| Representative Sequence | 3300031903|Ga0307407_10274055|Ga0307407_102740552 |
| Length | 319 |
| Sequence | VALAADRTGPPDPRSGGPPPWLSRGAAPDAPTQPGRKLASWLHRHAGVRLAALLSAPMAWLVVAYLGSLAVLLVSSLWTVNSFTGTLIREPTLDNFRTILTEPVYRNVVLRSIGVAAAVTVIDAAIALPMALFMAKVASPRARHWLVIAILTPLWASYLVKAYAWRVMLANGGPIDWLLGGDGHGPGYGLTATVIVLSYLWLPYMILPVFTGLDRLPDSLLEASADLGARAGTTFRTVVVPMVMPSLVAGSIFTFSLSLGDYITVQIVGGRSQLIGNLVYANIGAANNLPFAAALATIPVAIMVGYLLAVRRTGALDQL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 2 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 3 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 4 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 5 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 6 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 7 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 8 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 9 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 182 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 187 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 199 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 209 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 212 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 213 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 214 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 215 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 216 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 217 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 218 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 219 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 220 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 294 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 295 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 297 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 298 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 299 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 309 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 313 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 314 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 317 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 318 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.67 |
| Metatranscriptomes | 0 |
| Isolates | 1.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.23 |
| Nodule | 0 |
| Rhizoplane | 11.95 |
| Rhizosphere | 78.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1002434 | 3300000549 | Bacteria | 2589 |
| 2 | JGI24751J29686_10004243 | 3300002459 | Bacteria | 2908 |
| 3 | Ga0070658_10065628 | 3300005327 | Bacteria | 2963 |
| 4 | Ga0070676_10021068 | 3300005328 | Bacteria | 3647 |
| 5 | Ga0070676_10036389 | 3300005328 | Bacteria | 2836 |
| 6 | Ga0070683_100064097 | 3300005329 | Bacteria | 3420 |
| 7 | Ga0070683_100164202 | 3300005329 | Bacteria | 2107 |
| 8 | Ga0070683_100429970 | 3300005329 | Bacteria | 1260 |
| 9 | Ga0070690_100005532 | 3300005330 | Bacteria | 7106 |
| 10 | Ga0070670_100019163 | 3300005331 | Bacteria | 5868 |
| 11 | Ga0068869_100018671 | 3300005334 | Bacteria | 4724 |
| 12 | Ga0070666_10013334 | 3300005335 | Bacteria | 5211 |
| 13 | Ga0070680_100063795 | 3300005336 | Bacteria | 3018 |
| 14 | Ga0070682_100057933 | 3300005337 | Bacteria | 2442 |
| 15 | Ga0068868_100003930 | 3300005338 | Bacteria | 10383 |
| 16 | Ga0068868_100007923 | 3300005338 | Bacteria | 7588 |
| 17 | Ga0068868_100051739 | 3300005338 | Bacteria | 3232 |
| 18 | Ga0068868_100096907 | 3300005338 | Bacteria | 2383 |
| 19 | Ga0068868_100106629 | 3300005338 | Bacteria | 2273 |
| 20 | Ga0068868_100197183 | 3300005338 | Bacteria | 1677 |
| 21 | Ga0068868_100338476 | 3300005338 | Bacteria | 1286 |
| 22 | Ga0070660_100051368 | 3300005339 | Bacteria | 3175 |
| 23 | Ga0070689_100018679 | 3300005340 | Bacteria | 5112 |
| 24 | Ga0070689_100036289 | 3300005340 | Bacteria | 3770 |
| 25 | Ga0070689_100339580 | 3300005340 | Bacteria | 1258 |
| 26 | Ga0070691_10001538 | 3300005341 | Bacteria | 9931 |
| 27 | Ga0070691_10021319 | 3300005341 | Bacteria | 2998 |
| 28 | Ga0070687_100071630 | 3300005343 | Bacteria | 1863 |
| 29 | Ga0070692_10006877 | 3300005345 | Bacteria | 4970 |
| 30 | Ga0070692_10100436 | 3300005345 | Bacteria | 1585 |
| 31 | Ga0070668_100003460 | 3300005347 | Bacteria | 11657 |
| 32 | Ga0070668_100182781 | 3300005347 | Bacteria | 1714 |
| 33 | Ga0070668_100228552 | 3300005347 | Bacteria | 1537 |
| 34 | Ga0070675_100316758 | 3300005354 | Bacteria | 1377 |
| 35 | Ga0070671_100037911 | 3300005355 | Bacteria | 3999 |
| 36 | Ga0070671_100051390 | 3300005355 | Bacteria | 3428 |
| 37 | Ga0070674_100086744 | 3300005356 | Bacteria | 2249 |
| 38 | Ga0070674_100123075 | 3300005356 | Bacteria | 1923 |
| 39 | Ga0070674_100274906 | 3300005356 | Bacteria | 1333 |
| 40 | Ga0070673_100105013 | 3300005364 | Bacteria | 2333 |
| 41 | Ga0070673_100368787 | 3300005364 | Bacteria | 1278 |
| 42 | Ga0070688_100225661 | 3300005365 | Bacteria | 1322 |
| 43 | Ga0070688_100479097 | 3300005365 | Bacteria | 935 |
| 44 | Ga0070659_100033853 | 3300005366 | Bacteria | 3972 |
| 45 | Ga0070659_100062698 | 3300005366 | Bacteria | 2939 |
| 46 | Ga0070667_100490145 | 3300005367 | Bacteria | 1126 |
| 47 | Ga0070714_100025924 | 3300005435 | Bacteria | 4842 |
| 48 | Ga0070713_100003753 | 3300005436 | Bacteria | 10050 |
| 49 | Ga0070701_10016722 | 3300005438 | Bacteria | 3417 |
| 50 | Ga0070705_100021187 | 3300005440 | Bacteria | 3453 |
| 51 | Ga0070705_100119167 | 3300005440 | Bacteria | 1701 |
| 52 | Ga0070705_100123500 | 3300005440 | Bacteria | 1676 |
| 53 | Ga0070700_100168072 | 3300005441 | Bacteria | 1516 |
| 54 | Ga0070694_100248624 | 3300005444 | Bacteria | 1344 |
| 55 | Ga0070663_100002020 | 3300005455 | Bacteria | 11335 |
| 56 | Ga0070663_100010278 | 3300005455 | Bacteria | 5830 |
| 57 | Ga0070678_100022800 | 3300005456 | Bacteria | 4158 |
| 58 | Ga0070678_100316281 | 3300005456 | Bacteria | 1332 |
| 59 | Ga0070662_100007677 | 3300005457 | Bacteria | 6998 |
| 60 | Ga0070662_100136432 | 3300005457 | Bacteria | 1897 |
| 61 | Ga0070681_10035257 | 3300005458 | Bacteria | 5026 |
| 62 | Ga0068867_100001167 | 3300005459 | Bacteria | 17965 |
| 63 | Ga0070685_10117074 | 3300005466 | Bacteria | 1650 |
| 64 | Ga0070706_100156215 | 3300005467 | Bacteria | 2129 |
| 65 | Ga0070707_100070989 | 3300005468 | Bacteria | 3354 |
| 66 | Ga0070698_100001085 | 3300005471 | Bacteria | 29891 |
| 67 | Ga0070698_100019165 | 3300005471 | Bacteria | 7192 |
| 68 | Ga0070698_100252529 | 3300005471 | Bacteria | 1696 |
| 69 | Ga0070699_100203607 | 3300005518 | Bacteria | 1760 |
| 70 | Ga0070684_100021842 | 3300005535 | Bacteria | 5332 |
| 71 | Ga0070684_100026608 | 3300005535 | Bacteria | 4874 |
| 72 | Ga0070684_100557422 | 3300005535 | Bacteria | 1064 |
| 73 | Ga0070697_100190224 | 3300005536 | Bacteria | 1742 |
| 74 | Ga0068853_100252251 | 3300005539 | Bacteria | 1619 |
| 75 | Ga0070686_100010954 | 3300005544 | Bacteria | 5133 |
| 76 | Ga0070686_100034332 | 3300005544 | Bacteria | 3125 |
| 77 | Ga0070695_100082640 | 3300005545 | Bacteria | 2127 |
| 78 | Ga0070696_100012733 | 3300005546 | Bacteria | 5648 |
| 79 | Ga0070696_100103945 | 3300005546 | Bacteria | 2039 |
| 80 | Ga0070696_100154679 | 3300005546 | Bacteria | 1686 |
| 81 | Ga0070665_100134065 | 3300005548 | Bacteria | 2478 |
| 82 | Ga0070665_100476023 | 3300005548 | Bacteria | 1259 |
| 83 | Ga0070704_100041860 | 3300005549 | Bacteria | 3165 |
| 84 | Ga0070704_100219556 | 3300005549 | Bacteria | 1545 |
| 85 | Ga0068855_100046262 | 3300005563 | Bacteria | 5145 |
| 86 | Ga0068855_100229606 | 3300005563 | Bacteria | 2079 |
| 87 | Ga0068855_100422517 | 3300005563 | Bacteria | 1458 |
| 88 | Ga0068855_100426121 | 3300005563 | Bacteria | 1451 |
| 89 | Ga0070664_100037100 | 3300005564 | Bacteria | 4095 |
| 90 | Ga0068857_100288327 | 3300005577 | Bacteria | 1511 |
| 91 | Ga0068854_100033288 | 3300005578 | Bacteria | 3592 |
| 92 | Ga0068854_100109920 | 3300005578 | Bacteria | 2078 |
| 93 | Ga0068854_100242942 | 3300005578 | Bacteria | 1435 |
| 94 | Ga0068856_100079472 | 3300005614 | Bacteria | 3252 |
| 95 | Ga0068856_100195529 | 3300005614 | Bacteria | 2036 |
| 96 | Ga0070702_100100048 | 3300005615 | Bacteria | 1776 |
| 97 | Ga0068852_100030291 | 3300005616 | Bacteria | 4453 |
| 98 | Ga0068852_100039008 | 3300005616 | Bacteria | 3996 |
| 99 | Ga0068864_100082387 | 3300005618 | Bacteria | 2823 |
| 100 | Ga0068864_100194781 | 3300005618 | Bacteria | 1859 |
| 101 | Ga0068864_100314251 | 3300005618 | Bacteria | 1470 |
| 102 | Ga0068866_10021563 | 3300005718 | Bacteria | 2970 |
| 103 | Ga0068861_100067244 | 3300005719 | Bacteria | 2765 |
| 104 | Ga0068861_100123814 | 3300005719 | Bacteria | 2089 |
| 105 | Ga0068861_100147802 | 3300005719 | Bacteria | 1925 |
| 106 | Ga0068851_10019739 | 3300005834 | Bacteria | 3258 |
| 107 | Ga0068870_10035440 | 3300005840 | Bacteria | 2560 |
| 108 | Ga0068863_100009789 | 3300005841 | Bacteria | 9344 |
| 109 | Ga0068863_100018636 | 3300005841 | Bacteria | 6641 |
| 110 | Ga0068863_100041764 | 3300005841 | Bacteria | 4360 |
| 111 | Ga0068863_100267334 | 3300005841 | Bacteria | 1654 |
| 112 | Ga0068863_100514077 | 3300005841 | Bacteria | 1180 |
| 113 | Ga0068858_100073576 | 3300005842 | Bacteria | 3172 |
| 114 | Ga0068858_100212087 | 3300005842 | Bacteria | 1833 |
| 115 | Ga0068860_100026646 | 3300005843 | Bacteria | 5573 |
| 116 | Ga0068860_100030588 | 3300005843 | Bacteria | 5178 |
| 117 | Ga0068860_100053843 | 3300005843 | Bacteria | 3825 |
| 118 | Ga0068862_100063231 | 3300005844 | Bacteria | 3185 |
| 119 | Ga0081455_10003611 | 3300005937 | Bacteria | 17731 |
| 120 | Ga0081455_10025145 | 3300005937 | Bacteria | 5501 |
| 121 | Ga0081455_10038418 | 3300005937 | Bacteria | 4240 |
| 122 | Ga0081538_10075614 | 3300005981 | Bacteria | 1826 |
| 123 | Ga0081540_1012872 | 3300005983 | Bacteria | 5471 |
| 124 | Ga0081540_1016724 | 3300005983 | Bacteria | 4573 |
| 125 | Ga0081540_1063298 | 3300005983 | Bacteria | 1751 |
| 126 | Ga0081539_10001405 | 3300005985 | Bacteria | 41451 |
| 127 | Ga0081539_10009012 | 3300005985 | Bacteria | 8478 |
| 128 | Ga0081539_10011886 | 3300005985 | Bacteria | 6801 |
| 129 | Ga0070717_10044621 | 3300006028 | Bacteria | 3621 |
| 130 | Ga0075365_10003573 | 3300006038 | Bacteria | 8041 |
| 131 | Ga0075365_10050839 | 3300006038 | Bacteria | 2735 |
| 132 | Ga0075365_10117490 | 3300006038 | Bacteria | 1832 |
| 133 | Ga0075365_10120784 | 3300006038 | Bacteria | 1807 |
| 134 | Ga0075365_10150907 | 3300006038 | Bacteria | 1616 |
| 135 | Ga0075363_100001228 | 3300006048 | Bacteria | 9491 |
| 136 | Ga0075363_100111591 | 3300006048 | Bacteria | 1520 |
| 137 | Ga0075364_10007483 | 3300006051 | Bacteria | 6489 |
| 138 | Ga0075364_10100229 | 3300006051 | Bacteria | 1928 |
| 139 | Ga0075364_10129013 | 3300006051 | Bacteria | 1696 |
| 140 | Ga0075364_10337751 | 3300006051 | Bacteria | 1026 |
| 141 | Ga0075432_10030525 | 3300006058 | Bacteria | 1862 |
| 142 | Ga0075362_10005215 | 3300006177 | Bacteria | 4738 |
| 143 | Ga0075362_10059067 | 3300006177 | Bacteria | 1731 |
| 144 | Ga0075362_10116848 | 3300006177 | Bacteria | 1260 |
| 145 | Ga0075367_10025230 | 3300006178 | Bacteria | 3360 |
| 146 | Ga0075367_10051347 | 3300006178 | Bacteria | 2437 |
| 147 | Ga0075367_10213671 | 3300006178 | Bacteria | 1206 |
| 148 | Ga0075366_10058694 | 3300006195 | Bacteria | 2286 |
| 149 | Ga0075370_10034045 | 3300006353 | Bacteria | 2855 |
| 150 | Ga0075370_10077574 | 3300006353 | Bacteria | 1906 |
| 151 | Ga0075370_10109066 | 3300006353 | Bacteria | 1606 |
| 152 | Ga0068871_100114290 | 3300006358 | Bacteria | 2274 |
| 153 | Ga0068871_100114414 | 3300006358 | Bacteria | 2273 |
| 154 | Ga0068871_100128346 | 3300006358 | Bacteria | 2148 |
| 155 | Ga0075428_100052542 | 3300006844 | Bacteria | 4465 |
| 156 | Ga0075428_100080554 | 3300006844 | Bacteria | 3553 |
| 157 | Ga0075430_100247716 | 3300006846 | Bacteria | 1476 |
| 158 | Ga0075431_100000676 | 3300006847 | Bacteria | 29173 |
| 159 | Ga0075431_100033118 | 3300006847 | Bacteria | 5326 |
| 160 | Ga0075431_100125811 | 3300006847 | Bacteria | 2644 |
| 161 | Ga0075431_100287615 | 3300006847 | Bacteria | 1663 |
| 162 | Ga0075433_10070532 | 3300006852 | Bacteria | 3071 |
| 163 | Ga0075434_100001921 | 3300006871 | Bacteria | 18017 |
| 164 | Ga0075434_100049120 | 3300006871 | Bacteria | 4188 |
| 165 | Ga0075429_100002702 | 3300006880 | Bacteria | 14953 |
| 166 | Ga0075429_100286346 | 3300006880 | Bacteria | 1443 |
| 167 | Ga0068865_100053131 | 3300006881 | Bacteria | 2811 |
| 168 | Ga0068865_100076556 | 3300006881 | Bacteria | 2388 |
| 169 | Ga0075436_100000663 | 3300006914 | Bacteria | 22664 |
| 170 | Ga0075435_100002027 | 3300007076 | Bacteria | 13255 |
| 171 | Ga0105240_10526148 | 3300009093 | Bacteria | 1311 |
| 172 | Ga0111539_10022261 | 3300009094 | Bacteria | 7790 |
| 173 | Ga0111539_10103122 | 3300009094 | Bacteria | 3348 |
| 174 | Ga0111539_10168091 | 3300009094 | Bacteria | 2563 |
| 175 | Ga0105245_10017702 | 3300009098 | Bacteria | 6220 |
| 176 | Ga0105245_10221768 | 3300009098 | Bacteria | 1825 |
| 177 | Ga0105245_10285659 | 3300009098 | Bacteria | 1614 |
| 178 | Ga0114129_10170060 | 3300009147 | Bacteria | 2972 |
| 179 | Ga0114129_10227875 | 3300009147 | Bacteria | 2511 |
| 180 | Ga0105243_10010116 | 3300009148 | Bacteria | 7177 |
| 181 | Ga0105243_10085613 | 3300009148 | Bacteria | 2584 |
| 182 | Ga0105243_10164247 | 3300009148 | Bacteria | 1917 |
| 183 | Ga0105243_10212016 | 3300009148 | Bacteria | 1706 |
| 184 | Ga0105243_10266094 | 3300009148 | Bacteria | 1537 |
| 185 | Ga0105243_10517557 | 3300009148 | Bacteria | 1134 |
| 186 | Ga0105241_10028260 | 3300009174 | Bacteria | 4179 |
| 187 | Ga0105242_10059867 | 3300009176 | Bacteria | 3126 |
| 188 | Ga0105242_10127408 | 3300009176 | Bacteria | 2193 |
| 189 | Ga0105248_10025546 | 3300009177 | Bacteria | 6567 |
| 190 | Ga0105248_10031432 | 3300009177 | Bacteria | 5934 |
| 191 | Ga0105248_10116774 | 3300009177 | Bacteria | 3009 |
| 192 | Ga0105248_10154291 | 3300009177 | Bacteria | 2591 |
| 193 | Ga0105248_10195647 | 3300009177 | Bacteria | 2278 |
| 194 | Ga0105237_10054318 | 3300009545 | Bacteria | 4014 |
| 195 | Ga0105237_10436164 | 3300009545 | Bacteria | 1316 |
| 196 | Ga0105237_10768228 | 3300009545 | Bacteria | 970 |
| 197 | Ga0105238_10056206 | 3300009551 | Bacteria | 3949 |
| 198 | Ga0105238_10181967 | 3300009551 | Bacteria | 2079 |
| 199 | Ga0105238_10228852 | 3300009551 | Bacteria | 1836 |
| 200 | Ga0105249_10071356 | 3300009553 | Bacteria | 3208 |
| 201 | Ga0105249_10102728 | 3300009553 | Bacteria | 2691 |
| 202 | Ga0105249_10192783 | 3300009553 | Bacteria | 1990 |
| 203 | Ga0105249_10252993 | 3300009553 | Bacteria | 1747 |
| 204 | Ga0105249_10367840 | 3300009553 | Unclassified | 1461 |
| 205 | Ga0105239_10032152 | 3300010375 | Bacteria | 5767 |
| 206 | Ga0105239_10092943 | 3300010375 | Bacteria | 3330 |
| 207 | Ga0105239_10171522 | 3300010375 | Bacteria | 2426 |
| 208 | Ga0105239_10459591 | 3300010375 | Bacteria | 1445 |
| 209 | Ga0105246_10008187 | 3300011119 | Bacteria | 6419 |
| 210 | Ga0157371_10176500 | 3300013102 | Bacteria | 1527 |
| 211 | Ga0157370_10031765 | 3300013104 | Bacteria | 5162 |
| 212 | Ga0157369_10075291 | 3300013105 | Bacteria | 3620 |
| 213 | Ga0157374_10010504 | 3300013296 | Bacteria | 7967 |
| 214 | Ga0157374_10279034 | 3300013296 | Bacteria | 1649 |
| 215 | Ga0157378_10007665 | 3300013297 | Bacteria | 9422 |
| 216 | Ga0163162_10008544 | 3300013306 | Bacteria | 9984 |
| 217 | Ga0163162_10074333 | 3300013306 | Bacteria | 3457 |
| 218 | Ga0163162_10718608 | 3300013306 | Bacteria | 1120 |
| 219 | Ga0157372_10058270 | 3300013307 | Bacteria | 4317 |
| 220 | Ga0157372_10145615 | 3300013307 | Bacteria | 2732 |
| 221 | Ga0157372_10332913 | 3300013307 | Bacteria | 1768 |
| 222 | Ga0157375_10017673 | 3300013308 | Bacteria | 6444 |
| 223 | Ga0157375_10185620 | 3300013308 | Bacteria | 2233 |
| 224 | Ga0157375_10210860 | 3300013308 | Bacteria | 2100 |
| 225 | Ga0157375_10464673 | 3300013308 | Bacteria | 1431 |
| 226 | Ga0157375_10792477 | 3300013308 | Bacteria | 1097 |
| 227 | Ga0163163_10060007 | 3300014325 | Bacteria | 3765 |
| 228 | Ga0163163_10065583 | 3300014325 | Bacteria | 3605 |
| 229 | Ga0163163_10174065 | 3300014325 | Bacteria | 2199 |
| 230 | Ga0157380_10119787 | 3300014326 | Bacteria | 2227 |
| 231 | Ga0157380_10247065 | 3300014326 | Bacteria | 1613 |
| 232 | Ga0182008_10039488 | 3300014497 | Bacteria | 2358 |
| 233 | Ga0157377_10005400 | 3300014745 | Bacteria | 6005 |
| 234 | Ga0157377_10009619 | 3300014745 | Bacteria | 4753 |
| 235 | Ga0157379_10056354 | 3300014968 | Bacteria | 3512 |
| 236 | Ga0157379_10114027 | 3300014968 | Bacteria | 2429 |
| 237 | Ga0157379_10240244 | 3300014968 | Bacteria | 1643 |
| 238 | Ga0157379_10297725 | 3300014968 | Bacteria | 1470 |
| 239 | Ga0157379_10452663 | 3300014968 | Bacteria | 1185 |
| 240 | Ga0157376_10237808 | 3300014969 | Bacteria | 1695 |
| 241 | Ga0157376_10438211 | 3300014969 | Bacteria | 1272 |
| 242 | Ga0163161_10044339 | 3300017792 | Bacteria | 3203 |
| 243 | Ga0207656_10004547 | 3300025321 | Bacteria | 4854 |
| 244 | Ga0207688_10005360 | 3300025901 | Bacteria | 6963 |
| 245 | Ga0207688_10018631 | 3300025901 | Bacteria | 3776 |
| 246 | Ga0207680_10206000 | 3300025903 | Bacteria | 1343 |
| 247 | Ga0207699_10066241 | 3300025906 | Bacteria | 2192 |
| 248 | Ga0207645_10029478 | 3300025907 | Bacteria | 3537 |
| 249 | Ga0207645_10042479 | 3300025907 | Bacteria | 2909 |
| 250 | Ga0207645_10111585 | 3300025907 | Bacteria | 1770 |
| 251 | Ga0207643_10000117 | 3300025908 | Bacteria | 54338 |
| 252 | Ga0207705_10019086 | 3300025909 | Bacteria | 4904 |
| 253 | Ga0207654_10014770 | 3300025911 | Bacteria | 4040 |
| 254 | Ga0207707_10213441 | 3300025912 | Bacteria | 1681 |
| 255 | Ga0207695_10137665 | 3300025913 | Bacteria | 2393 |
| 256 | Ga0207693_10033341 | 3300025915 | Bacteria | 4063 |
| 257 | Ga0207660_10243717 | 3300025917 | Bacteria | 1417 |
| 258 | Ga0207662_10052216 | 3300025918 | Bacteria | 2432 |
| 259 | Ga0207657_10030915 | 3300025919 | Bacteria | 4854 |
| 260 | Ga0207652_10048958 | 3300025921 | Bacteria | 3615 |
| 261 | Ga0207694_10146703 | 3300025924 | Bacteria | 1899 |
| 262 | Ga0207650_10000493 | 3300025925 | Bacteria | 32882 |
| 263 | Ga0207659_10023592 | 3300025926 | Bacteria | 4108 |
| 264 | Ga0207659_10041269 | 3300025926 | Bacteria | 3231 |
| 265 | Ga0207659_10103230 | 3300025926 | Bacteria | 2154 |
| 266 | Ga0207687_10018266 | 3300025927 | Bacteria | 4626 |
| 267 | Ga0207687_10048371 | 3300025927 | Bacteria | 2952 |
| 268 | Ga0207687_10048752 | 3300025927 | Bacteria | 2943 |
| 269 | Ga0207700_10024192 | 3300025928 | Bacteria | 4199 |
| 270 | Ga0207700_10279956 | 3300025928 | Bacteria | 1434 |
| 271 | Ga0207664_10221539 | 3300025929 | Bacteria | 1641 |
| 272 | Ga0207644_10024057 | 3300025931 | Bacteria | 4177 |
| 273 | Ga0207644_10030397 | 3300025931 | Bacteria | 3756 |
| 274 | Ga0207690_10029835 | 3300025932 | Bacteria | 3472 |
| 275 | Ga0207690_10239279 | 3300025932 | Bacteria | 1397 |
| 276 | Ga0207706_10003126 | 3300025933 | Bacteria | 15895 |
| 277 | Ga0207706_10009698 | 3300025933 | Bacteria | 8836 |
| 278 | Ga0207706_10072389 | 3300025933 | Bacteria | 3032 |
| 279 | Ga0207706_10137202 | 3300025933 | Bacteria | 2152 |
| 280 | Ga0207706_10287047 | 3300025933 | Bacteria | 1435 |
| 281 | Ga0207686_10077183 | 3300025934 | Bacteria | 2162 |
| 282 | Ga0207709_10009069 | 3300025935 | Bacteria | 5485 |
| 283 | Ga0207709_10063853 | 3300025935 | Bacteria | 2309 |
| 284 | Ga0207709_10067848 | 3300025935 | Bacteria | 2252 |
| 285 | Ga0207709_10143913 | 3300025935 | Bacteria | 1642 |
| 286 | Ga0207709_10299897 | 3300025935 | Bacteria | 1194 |
| 287 | Ga0207670_10019642 | 3300025936 | Bacteria | 4132 |
| 288 | Ga0207669_10016656 | 3300025937 | Bacteria | 3742 |
| 289 | Ga0207665_10025133 | 3300025939 | Bacteria | 3929 |
| 290 | Ga0207691_10032484 | 3300025940 | Bacteria | 4865 |
| 291 | Ga0207711_10112825 | 3300025941 | Bacteria | 2420 |
| 292 | Ga0207711_10197339 | 3300025941 | Bacteria | 1836 |
| 293 | Ga0207689_10009422 | 3300025942 | Bacteria | 8432 |
| 294 | Ga0207689_10193688 | 3300025942 | Bacteria | 1677 |
| 295 | Ga0207661_10021598 | 3300025944 | Bacteria | 4825 |
| 296 | Ga0207661_10518664 | 3300025944 | Bacteria | 1090 |
| 297 | Ga0207679_10002230 | 3300025945 | Bacteria | 11971 |
| 298 | Ga0207679_10008645 | 3300025945 | Bacteria | 6491 |
| 299 | Ga0207667_10082423 | 3300025949 | Bacteria | 3332 |
| 300 | Ga0207667_10375243 | 3300025949 | Bacteria | 1449 |
| 301 | Ga0207667_10506536 | 3300025949 | Bacteria | 1224 |
| 302 | Ga0207712_10081619 | 3300025961 | Bacteria | 2355 |
| 303 | Ga0207712_10134629 | 3300025961 | Bacteria | 1888 |
| 304 | Ga0207712_10241055 | 3300025961 | Unclassified | 1456 |
| 305 | Ga0207668_10001892 | 3300025972 | Bacteria | 12254 |
| 306 | Ga0207668_10046396 | 3300025972 | Bacteria | 2969 |
| 307 | Ga0207668_10071674 | 3300025972 | Bacteria | 2476 |
| 308 | Ga0207668_10191064 | 3300025972 | Bacteria | 1623 |
| 309 | Ga0207668_10251689 | 3300025972 | Bacteria | 1435 |
| 310 | Ga0207640_10101431 | 3300025981 | Bacteria | 2019 |
| 311 | Ga0207640_10179125 | 3300025981 | Bacteria | 1587 |
| 312 | Ga0207658_10164721 | 3300025986 | Bacteria | 1820 |
| 313 | Ga0207677_10005764 | 3300026023 | Bacteria | 6740 |
| 314 | Ga0207677_10072877 | 3300026023 | Bacteria | 2430 |
| 315 | Ga0207677_10145613 | 3300026023 | Bacteria | 1820 |
| 316 | Ga0207677_10253965 | 3300026023 | Bacteria | 1429 |
| 317 | Ga0207703_10087530 | 3300026035 | Bacteria | 2612 |
| 318 | Ga0207703_10120589 | 3300026035 | Bacteria | 2251 |
| 319 | Ga0207678_10000391 | 3300026067 | Bacteria | 39957 |
| 320 | Ga0207678_10209134 | 3300026067 | Bacteria | 1669 |
| 321 | Ga0207708_10017312 | 3300026075 | Bacteria | 5425 |
| 322 | Ga0207708_10021321 | 3300026075 | Bacteria | 4885 |
| 323 | Ga0207708_10047309 | 3300026075 | Bacteria | 3275 |
| 324 | Ga0207708_10096740 | 3300026075 | Bacteria | 2282 |
| 325 | Ga0207708_10151342 | 3300026075 | Bacteria | 1827 |
| 326 | Ga0207708_10205977 | 3300026075 | Bacteria | 1571 |
| 327 | Ga0207702_10002078 | 3300026078 | Bacteria | 19339 |
| 328 | Ga0207702_10084488 | 3300026078 | Bacteria | 2764 |
| 329 | Ga0207702_10115268 | 3300026078 | Bacteria | 2396 |
| 330 | Ga0207702_10419071 | 3300026078 | Bacteria | 1294 |
| 331 | Ga0207702_10618807 | 3300026078 | Bacteria | 1063 |
| 332 | Ga0207641_10011671 | 3300026088 | Bacteria | 7214 |
| 333 | Ga0207641_10017730 | 3300026088 | Bacteria | 5832 |
| 334 | Ga0207641_10029839 | 3300026088 | Bacteria | 4511 |
| 335 | Ga0207648_10002699 | 3300026089 | Bacteria | 18877 |
| 336 | Ga0207648_10034388 | 3300026089 | Bacteria | 4468 |
| 337 | Ga0207648_10060948 | 3300026089 | Bacteria | 3290 |
| 338 | Ga0207676_10001839 | 3300026095 | Bacteria | 15547 |
| 339 | Ga0207676_10076495 | 3300026095 | Bacteria | 2705 |
| 340 | Ga0207676_10080092 | 3300026095 | Bacteria | 2650 |
| 341 | Ga0207676_10361718 | 3300026095 | Bacteria | 1345 |
| 342 | Ga0207674_10030133 | 3300026116 | Bacteria | 5708 |
| 343 | Ga0207674_10055380 | 3300026116 | Bacteria | 4032 |
| 344 | Ga0207674_10356367 | 3300026116 | Bacteria | 1414 |
| 345 | Ga0207675_100000686 | 3300026118 | Bacteria | 33362 |
| 346 | Ga0207675_100061350 | 3300026118 | Bacteria | 3510 |
| 347 | Ga0207675_100066810 | 3300026118 | Bacteria | 3361 |
| 348 | Ga0207675_100110177 | 3300026118 | Bacteria | 2598 |
| 349 | Ga0207675_100258016 | 3300026118 | Bacteria | 1688 |
| 350 | Ga0207683_10044178 | 3300026121 | Bacteria | 3895 |
| 351 | Ga0207698_10048649 | 3300026142 | Bacteria | 3221 |
| 352 | Ga0207698_10133262 | 3300026142 | Bacteria | 2127 |
| 353 | Ga0207698_10212024 | 3300026142 | Bacteria | 1743 |
| 354 | Ga0209813_10042107 | 3300027866 | Bacteria | 1395 |
| 355 | Ga0207428_10022628 | 3300027907 | Bacteria | 5301 |
| 356 | Ga0268266_10124063 | 3300028379 | Bacteria | 2302 |
| 357 | Ga0268266_10255450 | 3300028379 | Bacteria | 1622 |
| 358 | Ga0268266_10374409 | 3300028379 | Bacteria | 1342 |
| 359 | Ga0268265_10015214 | 3300028380 | Bacteria | 5260 |
| 360 | Ga0268265_10233863 | 3300028380 | Bacteria | 1617 |
| 361 | Ga0268264_10030952 | 3300028381 | Bacteria | 4388 |
| 362 | Ga0268264_10138905 | 3300028381 | Bacteria | 2164 |
| 363 | Ga0307515_10126220 | 3300028794 | Bacteria | 2856 |
| 364 | Ga0307511_10001274 | 3300030521 | Bacteria | 26705 |
| 365 | Ga0307513_10025522 | 3300031456 | Bacteria | 6842 |
| 366 | Ga0307509_10019348 | 3300031507 | Bacteria | 7768 |
| 367 | Ga0307408_100059051 | 3300031548 | Bacteria | 2791 |
| 368 | Ga0307508_10001935 | 3300031616 | Bacteria | 22718 |
| 369 | Ga0316576_10307938 | 3300031727 | Bacteria | 1183 |
| 370 | Ga0307413_10191722 | 3300031824 | Bacteria | 1468 |
| 371 | Ga0307413_10283746 | 3300031824 | Bacteria | 1247 |
| 372 | Ga0307518_10000241 | 3300031838 | Bacteria | 41161 |
| 373 | Ga0307410_10056268 | 3300031852 | Bacteria | 2674 |
| 374 | Ga0326468_10000083 | 3300031889 | Bacteria | 8124 |
| 375 | Ga0307406_10039433 | 3300031901 | Bacteria | 2930 |
| 376 | Ga0307406_10123415 | 3300031901 | Bacteria | 1805 |
| 377 | Ga0307406_10191399 | 3300031901 | Bacteria | 1498 |
| 378 | Ga0307406_10217854 | 3300031901 | Bacteria | 1417 |
| 379 | Ga0307406_10218021 | 3300031901 | Bacteria | 1416 |
| 380 | Ga0307407_10026838 | 3300031903 | Bacteria | 3056 |
| 381 | Ga0307407_10042103 | 3300031903 | Bacteria | 2558 |
| 382 | Ga0307407_10079625 | 3300031903 | Bacteria | 1977 |
| 383 | Ga0307407_10274055 | 3300031903 | Bacteria | 1166 |
| 384 | Ga0307409_100001479 | 3300031995 | Bacteria | 11588 |
| 385 | Ga0307409_100047500 | 3300031995 | Bacteria | 3259 |
| 386 | Ga0307416_100010065 | 3300032002 | Bacteria | 6227 |
| 387 | Ga0307416_100029855 | 3300032002 | Bacteria | 4081 |
| 388 | Ga0307416_100076442 | 3300032002 | Bacteria | 2806 |
| 389 | Ga0307416_100250724 | 3300032002 | Bacteria | 1723 |
| 390 | Ga0307416_100427702 | 3300032002 | Bacteria | 1370 |
| 391 | Ga0307416_100436073 | 3300032002 | Bacteria | 1359 |
| 392 | Ga0307411_10280456 | 3300032005 | Bacteria | 1326 |
| 393 | Ga0307415_100000049 | 3300032126 | Bacteria | 51581 |
| 394 | Ga0307415_100057980 | 3300032126 | Bacteria | 2664 |
| 395 | Ga0307415_100076829 | 3300032126 | Bacteria | 2369 |
| 396 | Ga0307507_10056762 | 3300033179 | Bacteria | 3696 |
| 397 | Ga0316574_0094024 | 3300035398 | Bacteria | 1914 |
| 398 | Ga0373931_0181162 | 3300035691 | Bacteria | 1248 |
| 399 | Ga0373935_0018731 | 3300035692 | Bacteria | 4217 |
| 400 | Ga0373935_0166156 | 3300035692 | Bacteria | 1507 |
| 401 | Ga0373947_0168992 | 3300035725 | Bacteria | 1418 |
| 402 | Ga0395899_0007240 | 3300037312 | Bacteria | 8589 |
| 403 | Ga0395899_0017405 | 3300037312 | Bacteria | 5475 |
| 404 | Ga0395899_0030723 | 3300037312 | Bacteria | 4039 |
| 405 | Ga0395900_0022618 | 3300037418 | Bacteria | 6433 |
| 406 | Ga0395900_0144622 | 3300037418 | Bacteria | 2432 |
| 407 | Ga0395900_0196035 | 3300037418 | Bacteria | 2046 |
| 408 | Ga0395900_0209837 | 3300037418 | Bacteria | 1967 |
| 409 | Ga0395898_0014756 | 3300037466 | Bacteria | 8020 |
| 410 | Ga0395898_0163142 | 3300037466 | Bacteria | 2131 |
| 411 | Ga0395898_0827038 | 3300037466 | Bacteria | 866 |
| 412 | Ga0395905_0046823 | 3300037471 | Bacteria | 4055 |
| 413 | Ga0395905_0312292 | 3300037471 | Bacteria | 1460 |
| 414 | Ga0395901_0026456 | 3300038443 | Bacteria | 5956 |
| 415 | Ga0395901_0271572 | 3300038443 | Bacteria | 1763 |
| 416 | Ga0439463_011559 | 3300042016 | Bacteria | 2167 |
| 417 | Ga0439463_033195 | 3300042016 | Bacteria | 1305 |
| 418 | Ga0450902_003876 | 3300042137 | Bacteria | 2209 |
| 419 | Ga0451577_0002607 | 3300042876 | Bacteria | 21201 |
| 420 | Ga0466969_0040154 | 3300044656 | Bacteria | 2345 |
| 421 | Ga0466972_0096218 | 3300044658 | Bacteria | 1402 |
| 422 | Ga0453683_0122589 | 3300044673 | Bacteria | 1637 |
| 423 | Ga0466965_0013666 | 3300044683 | Bacteria | 3833 |
| 424 | Ga0466966_0001252 | 3300044684 | Bacteria | 16267 |
| 425 | Ga0466961_0018128 | 3300044693 | Bacteria | 4527 |
| 426 | Ga0466961_0052418 | 3300044693 | Bacteria | 2603 |
| 427 | Ga0466963_0016775 | 3300044694 | Bacteria | 4558 |
| 428 | Ga0466963_0028854 | 3300044694 | Bacteria | 3566 |
| 429 | Ga0466963_0208105 | 3300044694 | Bacteria | 1369 |
| 430 | Ga0466964_0002836 | 3300044706 | Bacteria | 6246 |
| 431 | Ga0453684_0003257 | 3300044712 | Bacteria | 37095 |
| 432 | Ga0466970_0008269 | 3300044765 | Bacteria | 5230 |
| 433 | Ga0466970_0083549 | 3300044765 | Bacteria | 1728 |
| 434 | Ga0466970_0095488 | 3300044765 | Bacteria | 1616 |
| 435 | Ga0466970_0258849 | 3300044765 | Bacteria | 976 |
| 436 | Ga0466957_0029745 | 3300044842 | Bacteria | 3258 |
| 437 | Ga0466960_0004512 | 3300044901 | Bacteria | 5453 |
| 438 | Ga0466960_0009790 | 3300044901 | Bacteria | 3963 |
| 439 | Ga0466960_0015885 | 3300044901 | Bacteria | 3254 |
| 440 | Ga0466960_0273099 | 3300044901 | Bacteria | 945 |
| 441 | Ga0466960_0325747 | 3300044901 | Bacteria | 871 |
| 442 | Ga0466959_0002606 | 3300045049 | Bacteria | 11578 |
| 443 | Ga0451576_0039926 | 3300045051 | Bacteria | 4968 |
| 444 | Ga0466958_0122084 | 3300045836 | Bacteria | 1631 |
| 445 | Ga0466967_0017731 | 3300045976 | Bacteria | 5664 |
| 446 | Ga0466967_0096872 | 3300045976 | Bacteria | 2692 |
| 447 | Ga0466967_0482288 | 3300045976 | Bacteria | 1215 |
| 448 | Ga0495638_0105041 | 3300046460 | Bacteria | 1684 |
| 449 | Ga0495582_0033736 | 3300046473 | Bacteria | 2815 |
| 450 | Ga0495605_0079009 | 3300046474 | Bacteria | 1541 |
| 451 | Ga0495584_0045248 | 3300046491 | Bacteria | 2220 |
| 452 | Ga0495585_0039507 | 3300046492 | Bacteria | 2652 |
| 453 | Ga0495594_0014519 | 3300046499 | Bacteria | 4129 |
| 454 | Ga0495596_0068695 | 3300046500 | Bacteria | 1377 |
| 455 | Ga0495607_0070044 | 3300046501 | Bacteria | 1961 |
| 456 | Ga0495616_0121646 | 3300046513 | Bacteria | 1204 |
| 457 | Ga0495616_0135421 | 3300046513 | Bacteria | 1126 |
| 458 | Ga0495630_0094582 | 3300046517 | Bacteria | 2259 |
| 459 | Ga0495637_0028030 | 3300046520 | Bacteria | 2517 |
| 460 | Ga0495663_0015948 | 3300046525 | Bacteria | 2122 |
| 461 | Ga0495598_0089171 | 3300046537 | Bacteria | 1003 |
| 462 | Ga0495621_0057250 | 3300046539 | Bacteria | 1407 |
| 463 | Ga0495633_0075409 | 3300046558 | Bacteria | 1571 |
| 464 | Ga0495656_0005188 | 3300046615 | Bacteria | 4492 |
| 465 | Ga0495656_0021113 | 3300046615 | Bacteria | 2532 |
| 466 | Ga0495611_0018526 | 3300046648 | Bacteria | 2986 |
| 467 | Ga0495661_0063313 | 3300046665 | Bacteria | 2187 |
| 468 | Ga0495670_0044141 | 3300046691 | Bacteria | 2225 |
| 469 | Ga0495671_0094168 | 3300046692 | Bacteria | 1466 |
| 470 | Ga0495589_0060452 | 3300046794 | Bacteria | 1861 |
| 471 | Ga0495589_0082299 | 3300046794 | Bacteria | 1565 |
| 472 | Ga0495581_0168235 | 3300047315 | Bacteria | 1282 |
| 473 | Ga0495636_0029986 | 3300047318 | Bacteria | 2222 |
| 474 | Ga0495672_0004033 | 3300047320 | Bacteria | 12274 |
| 475 | Ga0495685_056398 | 3300047447 | Bacteria | 1328 |
| 476 | Ga0496100_0003941 | 3300048903 | Bacteria | 7803 |
| 477 | Ga0496100_0043703 | 3300048903 | Bacteria | 2867 |
| 478 | Ga0496100_0086907 | 3300048903 | Bacteria | 2125 |
| 479 | Ga0496100_0302111 | 3300048903 | Bacteria | 1198 |
| 480 | Ga0496100_0370141 | 3300048903 | Bacteria | 1086 |
| 481 | Ga0496101_0021327 | 3300048904 | Bacteria | 4451 |
| 482 | Ga0496101_0024796 | 3300048904 | Bacteria | 4156 |
| 483 | Ga0496101_0138707 | 3300048904 | Bacteria | 1852 |
| 484 | Ga0496102_0004051 | 3300048905 | Bacteria | 12422 |
| 485 | Ga0496102_0041815 | 3300048905 | Bacteria | 4152 |
| 486 | Ga0496102_0045548 | 3300048905 | Bacteria | 3983 |
| 487 | Ga0496102_0083069 | 3300048905 | Bacteria | 2955 |
| 488 | Ga0496102_0255359 | 3300048905 | Bacteria | 1653 |
| 489 | Ga0496102_0395761 | 3300048905 | Unclassified | 1299 |
| 490 | Ga0496102_0406138 | 3300048905 | Bacteria | 1280 |
| 491 | Ga0496104_0003502 | 3300048907 | Bacteria | 13540 |
| 492 | Ga0496104_0031749 | 3300048907 | Bacteria | 4913 |
| 493 | Ga0496104_0170589 | 3300048907 | Bacteria | 2086 |
| 494 | Ga0496104_0242324 | 3300048907 | Bacteria | 1715 |
| 495 | Ga0496104_0301932 | 3300048907 | Bacteria | 1513 |
| 496 | Ga0496105_0003442 | 3300048908 | Bacteria | 11724 |
| 497 | Ga0496105_0005173 | 3300048908 | Bacteria | 9892 |
| 498 | Ga0496105_0025991 | 3300048908 | Bacteria | 4771 |
| 499 | Ga0496105_0078002 | 3300048908 | Bacteria | 2735 |
| 500 | Ga0496105_0310370 | 3300048908 | Bacteria | 1266 |
| 501 | Ga0496106_0001302 | 3300048909 | Bacteria | 18735 |
| 502 | Ga0496106_0006553 | 3300048909 | Bacteria | 8623 |
| 503 | Ga0496106_0009225 | 3300048909 | Bacteria | 7288 |
| 504 | Ga0496106_0097240 | 3300048909 | Bacteria | 2279 |
| 505 | Ga0496107_0005994 | 3300048910 | Bacteria | 8332 |
| 506 | Ga0496107_0013612 | 3300048910 | Bacteria | 5686 |
| 507 | Ga0496107_0036116 | 3300048910 | Bacteria | 3544 |
| 508 | Ga0496107_0079858 | 3300048910 | Bacteria | 2385 |
| 509 | Ga0496107_0156697 | 3300048910 | Bacteria | 1686 |
| 510 | Ga0496108_0000343 | 3300048911 | Bacteria | 39300 |
| 511 | Ga0496108_0000996 | 3300048911 | Bacteria | 22097 |
| 512 | Ga0496108_0001459 | 3300048911 | Bacteria | 18696 |
| 513 | Ga0496108_0004061 | 3300048911 | Bacteria | 11743 |
| 514 | Ga0496108_0040566 | 3300048911 | Bacteria | 3881 |
| 515 | Ga0496108_0536443 | 3300048911 | Bacteria | 1021 |
| 516 | Ga0496109_0008631 | 3300048912 | Bacteria | 8674 |
| 517 | Ga0496109_0017442 | 3300048912 | Bacteria | 6294 |
| 518 | Ga0496109_0022341 | 3300048912 | Bacteria | 5602 |
| 519 | Ga0496109_0075581 | 3300048912 | Bacteria | 3097 |
| 520 | Ga0496109_0090052 | 3300048912 | Bacteria | 2837 |
| 521 | Ga0496109_0147818 | 3300048912 | Bacteria | 2199 |
| 522 | Ga0496109_0151843 | 3300048912 | Bacteria | 2168 |
| 523 | Ga0496109_0304077 | 3300048912 | Unclassified | 1504 |
| 524 | Ga0496109_0350217 | 3300048912 | Bacteria | 1395 |
| 525 | Ga0496110_0012203 | 3300048913 | Bacteria | 7059 |
| 526 | Ga0496110_0043863 | 3300048913 | Bacteria | 3904 |
| 527 | Ga0496110_0476106 | 3300048913 | Bacteria | 1137 |
| 528 | Ga0496111_0002132 | 3300048914 | Bacteria | 11826 |
| 529 | Ga0496111_0005798 | 3300048914 | Bacteria | 7966 |
| 530 | Ga0496111_0014423 | 3300048914 | Bacteria | 5397 |
| 531 | Ga0496111_0042423 | 3300048914 | Bacteria | 3266 |
| 532 | Ga0496111_0083852 | 3300048914 | Bacteria | 2329 |
| 533 | Ga0496111_0106471 | 3300048914 | Bacteria | 2064 |
| 534 | Ga0496111_0172904 | 3300048914 | Bacteria | 1605 |
| 535 | Ga0496112_0000886 | 3300048915 | Bacteria | 21512 |
| 536 | Ga0496112_0023403 | 3300048915 | Bacteria | 5903 |
| 537 | Ga0496112_0033527 | 3300048915 | Bacteria | 4993 |
| 538 | Ga0496112_0113005 | 3300048915 | Bacteria | 2686 |
| 539 | Ga0496112_0237615 | 3300048915 | Bacteria | 1775 |
| 540 | Ga0496112_0560969 | 3300048915 | Bacteria | 1075 |
| 541 | Ga0496113_0001514 | 3300048916 | Bacteria | 13025 |
| 542 | Ga0496113_0012183 | 3300048916 | Bacteria | 5772 |
| 543 | Ga0496113_0028509 | 3300048916 | Bacteria | 4016 |
| 544 | Ga0496113_0030191 | 3300048916 | Bacteria | 3921 |
| 545 | Ga0496113_0240011 | 3300048916 | Unclassified | 1446 |
| 546 | Ga0496113_0386753 | 3300048916 | Bacteria | 1123 |
| 547 | Ga0496114_0007060 | 3300048917 | Bacteria | 8861 |
| 548 | Ga0496114_0011372 | 3300048917 | Bacteria | 7109 |
| 549 | Ga0496114_0019559 | 3300048917 | Bacteria | 5487 |
| 550 | Ga0496114_0028469 | 3300048917 | Bacteria | 4586 |
| 551 | Ga0496114_0040332 | 3300048917 | Bacteria | 3865 |
| 552 | Ga0496114_0095624 | 3300048917 | Bacteria | 2528 |
| 553 | Ga0496114_0150743 | 3300048917 | Bacteria | 2017 |
| 554 | Ga0496114_0177344 | 3300048917 | Bacteria | 1860 |
| 555 | Ga0496114_0350062 | 3300048917 | Bacteria | 1306 |
| 556 | Ga0496115_0123310 | 3300048918 | Bacteria | 2133 |
| 557 | Ga0501032_0193512 | 3300049569 | Bacteria | 1329 |
| 558 | Ga0501034_0006228 | 3300049571 | Bacteria | 12842 |
| 559 | Ga0501036_0007464 | 3300049572 | Bacteria | 8912 |
| 560 | Ga0501036_0205127 | 3300049572 | Bacteria | 1657 |
| 561 | Ga0501037_0005067 | 3300049573 | Bacteria | 9586 |
| 562 | Ga0501038_0012940 | 3300049574 | Bacteria | 7611 |
| 563 | Ga0501038_0081095 | 3300049574 | Bacteria | 2734 |
| 564 | Ga0501039_0030912 | 3300049575 | Bacteria | 4129 |
| 565 | Ga0501039_0067700 | 3300049575 | Bacteria | 2773 |
| 566 | Ga0501039_0113531 | 3300049575 | Bacteria | 2119 |
| 567 | Ga0501040_0034607 | 3300049576 | Bacteria | 3422 |
| 568 | Ga0501040_0043681 | 3300049576 | Bacteria | 3056 |
| 569 | Ga0501041_0064861 | 3300049577 | Bacteria | 2237 |
| 570 | Ga0501042_0005357 | 3300049578 | Bacteria | 8251 |
| 571 | Ga0501042_0126635 | 3300049578 | Bacteria | 1839 |
| 572 | Ga0501043_0008609 | 3300049579 | Bacteria | 8041 |
| 573 | Ga0501046_0037033 | 3300049580 | Bacteria | 3922 |
| 574 | Ga0501047_0007043 | 3300049581 | Bacteria | 10556 |
| 575 | Ga0501048_0000973 | 3300049582 | Bacteria | 21220 |
| 576 | Ga0501048_0007742 | 3300049582 | Bacteria | 8143 |
| 577 | Ga0501067_0002098 | 3300049583 | Bacteria | 10978 |
| 578 | Ga0501067_0027021 | 3300049583 | Bacteria | 3179 |
| 579 | Ga0501069_0000952 | 3300049585 | Bacteria | 13786 |
| 580 | Ga0501069_0050230 | 3300049585 | Bacteria | 2319 |
| 581 | Ga0501070_0000730 | 3300049586 | Bacteria | 30031 |
| 582 | Ga0501070_0051044 | 3300049586 | Bacteria | 3433 |
| 583 | Ga0501070_0128324 | 3300049586 | Bacteria | 2096 |
| 584 | Ga0501070_0160242 | 3300049586 | Bacteria | 1855 |
| 585 | Ga0501070_0324077 | 3300049586 | Bacteria | 1253 |
| 586 | Ga0501071_0043166 | 3300049587 | Bacteria | 3232 |
| 587 | Ga0501071_0234859 | 3300049587 | Bacteria | 1382 |
| 588 | Ga0501072_0134239 | 3300049588 | Bacteria | 1973 |
| 589 | Ga0501072_0169203 | 3300049588 | Bacteria | 1744 |
| 590 | Ga0501073_0011797 | 3300049589 | Bacteria | 6379 |
| 591 | Ga0501073_0240117 | 3300049589 | Bacteria | 1251 |
| 592 | Ga0501074_0000620 | 3300049590 | Bacteria | 22112 |
| 593 | Ga0501074_0044051 | 3300049590 | Bacteria | 3231 |
| 594 | Ga0501074_0138667 | 3300049590 | Bacteria | 1740 |
| 595 | Ga0501074_0213348 | 3300049590 | Bacteria | 1375 |
| 596 | Ga0501074_0271837 | 3300049590 | Bacteria | 1205 |
| 597 | Ga0501075_0017442 | 3300049591 | Bacteria | 5187 |
| 598 | Ga0501075_0133287 | 3300049591 | Bacteria | 1893 |
| 599 | Ga0501076_0014733 | 3300049592 | Bacteria | 5894 |
| 600 | Ga0501076_0041834 | 3300049592 | Bacteria | 3607 |
| 601 | Ga0501076_0169418 | 3300049592 | Bacteria | 1780 |
| 602 | Ga0501077_0046778 | 3300049593 | Bacteria | 2749 |
| 603 | Ga0501077_0070313 | 3300049593 | Bacteria | 2218 |
| 604 | Ga0501077_0310412 | 3300049593 | Bacteria | 1005 |
| 605 | Ga0501079_0151215 | 3300049741 | Bacteria | 1810 |
| 606 | Ga0501035_0030660 | 3300049822 | Bacteria | 4902 |
| 607 | Ga0501045_0066622 | 3300049824 | Bacteria | 2644 |
| 608 | Ga0501045_0335782 | 3300049824 | Bacteria | 1125 |
| 609 | nmdc:mga03683_111319_c1 | 3300050489 | Bacteria | 1211 |
| 610 | nmdc:mga03683_149090_c1 | 3300050489 | Bacteria | 1055 |
| 611 | nmdc:mga03n38_16734_c1 | 3300050490 | Bacteria | 2859 |
| 612 | nmdc:mga00v17_136514_c1 | 3300050491 | Bacteria | 1571 |
| 613 | nmdc:mga00v17_137894_c1 | 3300050491 | Bacteria | 1563 |
| 614 | nmdc:mga00v17_26837_c1 | 3300050491 | Bacteria | 3359 |
| 615 | nmdc:mga00v17_40173_c1 | 3300050491 | Bacteria | 2806 |
| 616 | nmdc:mga00v17_55728_c1 | 3300050491 | Bacteria | 2415 |
| 617 | nmdc:mga0yw44_138019_c1 | 3300050492 | Bacteria | 1583 |
| 618 | nmdc:mga0yw44_29693_c1 | 3300050492 | Bacteria | 3159 |
| 619 | nmdc:mga0yw44_3355_c1 | 3300050492 | Bacteria | 7098 |
| 620 | nmdc:mga0yw44_479452_c1 | 3300050492 | Bacteria | 844 |
| 621 | nmdc:mga0yw44_7135_c1 | 3300050492 | Bacteria | 5472 |
| 622 | nmdc:mga0yw44_77146_c1 | 3300050492 | Bacteria | 2081 |
| 623 | nmdc:mga0yw44_92733_c1 | 3300050492 | Bacteria | 1912 |
| 624 | nmdc:mga0k408_189958_c1 | 3300050493 | Bacteria | 1225 |
| 625 | nmdc:mga06z11_135356_c1 | 3300050494 | Bacteria | 1388 |
| 626 | nmdc:mga06z11_54334_c1 | 3300050494 | Bacteria | 2064 |
| 627 | nmdc:mga06z11_85314_c1 | 3300050494 | Bacteria | 1703 |
| 628 | nmdc:mga06z11_91144_c1 | 3300050494 | Bacteria | 1655 |
| 629 | nmdc:mga07m45_16382_c1 | 3300050496 | Bacteria | 3969 |
| 630 | nmdc:mga07m45_18953_c1 | 3300050496 | Bacteria | 3724 |
| 631 | nmdc:mga07m45_82522_c1 | 3300050496 | Bacteria | 1836 |
| 632 | nmdc:mga05p37_126130_c1 | 3300050507 | Bacteria | 3143 |
| 633 | nmdc:mga05p37_294352_c1 | 3300050507 | Bacteria | 1931 |
| 634 | nmdc:mga05p37_36027_c1 | 3300050507 | Bacteria | 6071 |
| 635 | nmdc:mga05p37_520953_c1 | 3300050507 | Bacteria | 1360 |
| 636 | nmdc:mga09592_102883_c1 | 3300050508 | Bacteria | 2447 |
| 637 | nmdc:mga09592_11966_c1 | 3300050508 | Bacteria | 7058 |
| 638 | nmdc:mga0qj67_26341_c1 | 3300050509 | Bacteria | 4501 |
| 639 | nmdc:mga0qj67_341163_c1 | 3300050509 | Bacteria | 1212 |
| 640 | nmdc:mga06r32_4332_c1 | 3300050510 | Bacteria | 12706 |
| 641 | nmdc:mga06r32_556321_c1 | 3300050510 | Bacteria | 1121 |
| 642 | nmdc:mga06r32_574960_c1 | 3300050510 | Bacteria | 1099 |
| 643 | nmdc:mga06r32_727691_c1 | 3300050510 | Bacteria | 956 |
| 644 | nmdc:mga06r32_907_c1 | 3300050510 | Bacteria | 26417 |
| 645 | nmdc:mga08y16_19899_c1 | 3300050511 | Bacteria | 7080 |
| 646 | nmdc:mga08y16_65779_c1 | 3300050511 | Bacteria | 3784 |
| 647 | nmdc:mga08y16_76756_c1 | 3300050511 | Bacteria | 3483 |
| 648 | nmdc:mga0n895_10411_c1 | 3300050512 | Bacteria | 8212 |
| 649 | nmdc:mga0n895_47538_c1 | 3300050512 | Bacteria | 4195 |
| 650 | nmdc:mga08x19_135541_c1 | 3300050514 | Bacteria | 1659 |
| 651 | nmdc:mga08x19_261359_c1 | 3300050514 | Bacteria | 1197 |
| 652 | nmdc:mga0a205_31401_c1 | 3300050515 | Bacteria | 5088 |
| 653 | nmdc:mga0a205_58720_c1 | 3300050515 | Bacteria | 3716 |
| 654 | nmdc:mga0sz30_6672_c1 | 3300050516 | Bacteria | 4300 |
| 655 | Ga0495655_0003785 | 3300053083 | Bacteria | 2530 |
| 656 | Ga0495619_0008871 | 3300053085 | Bacteria | 6356 |
| 657 | Ga0500644_0000090 | 3300053088 | Bacteria | 56710 |
| 658 | Ga0500556_0106594 | 3300053104 | Bacteria | 1084 |
| 659 | Ga0500616_0014387 | 3300053153 | Bacteria | 4547 |
| 660 | Ga0501084_0026872 | 3300054114 | Bacteria | 4808 |
| 661 | Ga0501084_0090625 | 3300054114 | Bacteria | 2567 |
| 662 | Ga0501082_0025248 | 3300060353 | Bacteria | 5120 |
| 663 | Ga0466962_0009384 | 3300061719 | Bacteria | 4690 |
| 664 | Ga0530510_0043046 | 3300061734 | Bacteria | 3261 |
| 665 | Ga0530510_0048500 | 3300061734 | Bacteria | 3070 |
| 666 | Ga0530510_0064905 | 3300061734 | Bacteria | 2645 |
| 667 | Ga0530510_0206564 | 3300061734 | Bacteria | 1459 |
| 668 | Ga0530510_0297615 | 3300061734 | Bacteria | 1207 |
| 669 | Ga0530510_0468966 | 3300061734 | Bacteria | 953 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009177 | Ga0105248_10154291 | Ga0105248_101542913 | 235 |
| 2 | 3300014325 | Ga0163163_10174065 | Ga0163163_101740652 | 235 |
| 3 | 3300014968 | Ga0157379_10114027 | Ga0157379_101140273 | 235 |
| 4 | 3300048908 | Ga0496105_0025991 | Ga0496105_0025991_2781_3575 | 235 |
| 5 | 3300048911 | Ga0496108_0004061 | Ga0496108_0004061_8010_8804 | 235 |
| 6 | 3300048912 | Ga0496109_0008631 | Ga0496109_0008631_6008_6802 | 235 |
| 7 | 3300048914 | Ga0496111_0005798 | Ga0496111_0005798_1957_2751 | 235 |
| 8 | 3300048915 | Ga0496112_0237615 | Ga0496112_0237615_434_1228 | 235 |
| 9 | 3300048916 | Ga0496113_0028509 | Ga0496113_0028509_2958_3752 | 235 |
| 10 | 3300049576 | Ga0501040_0043681 | Ga0501040_0043681_80_877 | 239 |
| 11 | 3300061734 | Ga0530510_0297615 | Ga0530510_0297615_249_1163 | 239 |
| 12 | 3300025926 | Ga0207659_10103230 | Ga0207659_101032302 | 245 |
| 13 | 3300031903 | Ga0307407_10079625 | Ga0307407_100796252 | 248 |
| 14 | 3300049586 | Ga0501070_0000730 | Ga0501070_0000730_28341_29264 | 251 |
| 15 | 3300009094 | Ga0111539_10168091 | Ga0111539_101680912 | 252 |
| 16 | 3300031824 | Ga0307413_10191722 | Ga0307413_101917221 | 252 |
| 17 | 3300044694 | Ga0466963_0208105 | Ga0466963_0208105_434_1351 | 252 |
| 18 | 3300061734 | Ga0530510_0048500 | Ga0530510_0048500_1999_2937 | 252 |
| 19 | 3300045976 | Ga0466967_0096872 | Ga0466967_0096872_1208_2065 | 253 |
| 20 | 3300048915 | Ga0496112_0113005 | Ga0496112_0113005_18_902 | 253 |
| 21 | 3300005330 | Ga0070690_100005532 | Ga0070690_1000055322 | 254 |
| 22 | 3300005338 | Ga0068868_100338476 | Ga0068868_1003384761 | 254 |
| 23 | 3300005340 | Ga0070689_100036289 | Ga0070689_1000362894 | 254 |
| 24 | 3300005340 | Ga0070689_100339580 | Ga0070689_1003395802 | 254 |
| 25 | 3300005356 | Ga0070674_100086744 | Ga0070674_1000867443 | 254 |
| 26 | 3300005365 | Ga0070688_100479097 | Ga0070688_1004790971 | 254 |
| 27 | 3300005367 | Ga0070667_100490145 | Ga0070667_1004901451 | 254 |
| 28 | 3300005459 | Ga0068867_100001167 | Ga0068867_1000011674 | 254 |
| 29 | 3300005544 | Ga0070686_100010954 | Ga0070686_1000109543 | 254 |
| 30 | 3300005719 | Ga0068861_100067244 | Ga0068861_1000672442 | 254 |
| 31 | 3300005841 | Ga0068863_100041764 | Ga0068863_1000417644 | 254 |
| 32 | 3300005842 | Ga0068858_100212087 | Ga0068858_1002120872 | 254 |
| 33 | 3300005844 | Ga0068862_100063231 | Ga0068862_1000632312 | 254 |
| 34 | 3300006881 | Ga0068865_100076556 | Ga0068865_1000765562 | 254 |
| 35 | 3300009098 | Ga0105245_10221768 | Ga0105245_102217682 | 254 |
| 36 | 3300009148 | Ga0105243_10010116 | Ga0105243_100101163 | 254 |
| 37 | 3300009177 | Ga0105248_10031432 | Ga0105248_100314322 | 254 |
| 38 | 3300009553 | Ga0105249_10102728 | Ga0105249_101027282 | 254 |
| 39 | 3300013297 | Ga0157378_10007665 | Ga0157378_100076654 | 254 |
| 40 | 3300013308 | Ga0157375_10792477 | Ga0157375_107924772 | 254 |
| 41 | 3300014968 | Ga0157379_10056354 | Ga0157379_100563543 | 254 |
| 42 | 3300014969 | Ga0157376_10237808 | Ga0157376_102378082 | 254 |
| 43 | 3300025907 | Ga0207645_10111585 | Ga0207645_101115852 | 254 |
| 44 | 3300025927 | Ga0207687_10048752 | Ga0207687_100487523 | 254 |
| 45 | 3300025935 | Ga0207709_10009069 | Ga0207709_100090692 | 254 |
| 46 | 3300025936 | Ga0207670_10019642 | Ga0207670_100196424 | 254 |
| 47 | 3300025937 | Ga0207669_10016656 | Ga0207669_100166562 | 254 |
| 48 | 3300025941 | Ga0207711_10112825 | Ga0207711_101128252 | 254 |
| 49 | 3300025986 | Ga0207658_10164721 | Ga0207658_101647212 | 254 |
| 50 | 3300026023 | Ga0207677_10253965 | Ga0207677_102539652 | 254 |
| 51 | 3300026075 | Ga0207708_10021321 | Ga0207708_100213214 | 254 |
| 52 | 3300026088 | Ga0207641_10029839 | Ga0207641_100298395 | 254 |
| 53 | 3300026089 | Ga0207648_10002699 | Ga0207648_1000269916 | 254 |
| 54 | 3300026116 | Ga0207674_10055380 | Ga0207674_100553802 | 254 |
| 55 | 3300026118 | Ga0207675_100066810 | Ga0207675_1000668103 | 254 |
| 56 | 3300032126 | Ga0307415_100057980 | Ga0307415_1000579803 | 254 |
| 57 | 3300048903 | Ga0496100_0086907 | Ga0496100_0086907_555_1322 | 254 |
| 58 | 3300048905 | Ga0496102_0255359 | Ga0496102_0255359_772_1539 | 254 |
| 59 | 3300048907 | Ga0496104_0031749 | Ga0496104_0031749_2983_3750 | 254 |
| 60 | 3300048908 | Ga0496105_0005173 | Ga0496105_0005173_2807_3574 | 254 |
| 61 | 3300048909 | Ga0496106_0006553 | Ga0496106_0006553_6414_7181 | 254 |
| 62 | 3300048910 | Ga0496107_0036116 | Ga0496107_0036116_648_1415 | 254 |
| 63 | 3300048914 | Ga0496111_0083852 | Ga0496111_0083852_45_812 | 254 |
| 64 | 3300048917 | Ga0496114_0011372 | Ga0496114_0011372_19_786 | 254 |
| 65 | 3300050510 | nmdc:mga06r32_727691_c1 | nmdc:mga06r32_727691_c1_49_909 | 254 |
| 66 | 3300005329 | Ga0070683_100164202 | Ga0070683_1001642023 | 255 |
| 67 | 3300005471 | Ga0070698_100019165 | Ga0070698_1000191652 | 255 |
| 68 | 3300005563 | Ga0068855_100422517 | Ga0068855_1004225172 | 255 |
| 69 | 3300005841 | Ga0068863_100009789 | Ga0068863_1000097892 | 255 |
| 70 | 3300009177 | Ga0105248_10116774 | Ga0105248_101167744 | 255 |
| 71 | 3300014325 | Ga0163163_10060007 | Ga0163163_100600073 | 255 |
| 72 | 3300025906 | Ga0207699_10066241 | Ga0207699_100662412 | 255 |
| 73 | 3300025928 | Ga0207700_10279956 | Ga0207700_102799562 | 255 |
| 74 | 3300025939 | Ga0207665_10025133 | Ga0207665_100251333 | 255 |
| 75 | 3300025941 | Ga0207711_10197339 | Ga0207711_101973392 | 255 |
| 76 | 3300026088 | Ga0207641_10017730 | Ga0207641_100177305 | 255 |
| 77 | 3300026095 | Ga0207676_10080092 | Ga0207676_100800923 | 255 |
| 78 | 3300026095 | Ga0207676_10361718 | Ga0207676_103617182 | 255 |
| 79 | 3300028379 | Ga0268266_10124063 | Ga0268266_101240632 | 255 |
| 80 | 3300028381 | Ga0268264_10138905 | Ga0268264_101389052 | 255 |
| 81 | 3300037312 | Ga0395899_0030723 | Ga0395899_0030723_3134_3901 | 255 |
| 82 | 3300048915 | Ga0496112_0023403 | Ga0496112_0023403_197_1105 | 255 |
| 83 | 3300005616 | Ga0068852_100039008 | Ga0068852_1000390082 | 256 |
| 84 | 3300009551 | Ga0105238_10056206 | Ga0105238_100562063 | 256 |
| 85 | 3300025924 | Ga0207694_10146703 | Ga0207694_101467032 | 256 |
| 86 | 3300025972 | Ga0207668_10251689 | Ga0207668_102516892 | 256 |
| 87 | 3300026142 | Ga0207698_10212024 | Ga0207698_102120241 | 256 |
| 88 | 3300037312 | Ga0395899_0017405 | Ga0395899_0017405_2495_3409 | 256 |
| 89 | 3300049577 | Ga0501041_0064861 | Ga0501041_0064861_458_1420 | 256 |
| 90 | 3300049590 | Ga0501074_0213348 | Ga0501074_0213348_493_1359 | 256 |
| 91 | 3300049591 | Ga0501075_0133287 | Ga0501075_0133287_431_1393 | 256 |
| 92 | 3300049824 | Ga0501045_0066622 | Ga0501045_0066622_1124_2086 | 256 |
| 93 | 3300061734 | Ga0530510_0064905 | Ga0530510_0064905_1035_1997 | 256 |
| 94 | 3300010375 | Ga0105239_10092943 | Ga0105239_100929433 | 258 |
| 95 | 3300037466 | Ga0395898_0827038 | Ga0395898_0827038_78_854 | 258 |
| 96 | 3300046474 | Ga0495605_0079009 | Ga0495605_0079009_338_1234 | 258 |
| 97 | 3300046492 | Ga0495585_0039507 | Ga0495585_0039507_1259_2155 | 258 |
| 98 | 3300046500 | Ga0495596_0068695 | Ga0495596_0068695_445_1341 | 258 |
| 99 | 3300046513 | Ga0495616_0135421 | Ga0495616_0135421_213_1109 | 258 |
| 100 | 3300046520 | Ga0495637_0028030 | Ga0495637_0028030_1336_2232 | 258 |
| 101 | 3300046525 | Ga0495663_0015948 | Ga0495663_0015948_286_1182 | 258 |
| 102 | 3300046558 | Ga0495633_0075409 | Ga0495633_0075409_286_1182 | 258 |
| 103 | 3300046615 | Ga0495656_0021113 | Ga0495656_0021113_589_1485 | 258 |
| 104 | 3300046648 | Ga0495611_0018526 | Ga0495611_0018526_1265_2161 | 258 |
| 105 | 3300046665 | Ga0495661_0063313 | Ga0495661_0063313_627_1523 | 258 |
| 106 | 3300046691 | Ga0495670_0044141 | Ga0495670_0044141_610_1506 | 258 |
| 107 | 3300046692 | Ga0495671_0094168 | Ga0495671_0094168_481_1377 | 258 |
| 108 | 3300046794 | Ga0495589_0082299 | Ga0495589_0082299_199_1095 | 258 |
| 109 | 3300047447 | Ga0495685_056398 | Ga0495685_056398_41_937 | 258 |
| 110 | 3300049586 | Ga0501070_0051044 | Ga0501070_0051044_2019_2795 | 258 |
| 111 | 3300006847 | Ga0075431_100125811 | Ga0075431_1001258113 | 259 |
| 112 | 3300028379 | Ga0268266_10374409 | Ga0268266_103744092 | 259 |
| 113 | 3300047320 | Ga0495672_0004033 | Ga0495672_0004033_9670_10533 | 259 |
| 114 | iso_pu_bacteria | 2643221615 | 2644089777 | 259 |
| 115 | iso_pu_bacteria | 2643221657 | 2644319622 | 259 |
| 116 | 3300005338 | Ga0068868_100051739 | Ga0068868_1000517393 | 260 |
| 117 | 3300005338 | Ga0068868_100197183 | Ga0068868_1001971832 | 261 |
| 118 | 3300005981 | Ga0081538_10075614 | Ga0081538_100756142 | 261 |
| 119 | 3300005983 | Ga0081540_1016724 | Ga0081540_10167244 | 261 |
| 120 | 3300009176 | Ga0105242_10059867 | Ga0105242_100598672 | 261 |
| 121 | 3300009177 | Ga0105248_10195647 | Ga0105248_101956472 | 261 |
| 122 | 3300009551 | Ga0105238_10228852 | Ga0105238_102288521 | 261 |
| 123 | 3300013308 | Ga0157375_10210860 | Ga0157375_102108602 | 261 |
| 124 | 3300014325 | Ga0163163_10065583 | Ga0163163_100655832 | 261 |
| 125 | 3300026023 | Ga0207677_10145613 | Ga0207677_101456132 | 261 |
| 126 | 3300026067 | Ga0207678_10209134 | Ga0207678_102091342 | 261 |
| 127 | 3300031507 | Ga0307509_10019348 | Ga0307509_100193482 | 261 |
| 128 | 3300048905 | Ga0496102_0083069 | Ga0496102_0083069_1856_2722 | 261 |
| 129 | 3300048908 | Ga0496105_0078002 | Ga0496105_0078002_658_1524 | 261 |
| 130 | 3300048910 | Ga0496107_0079858 | Ga0496107_0079858_986_1852 | 261 |
| 131 | 3300048911 | Ga0496108_0040566 | Ga0496108_0040566_2062_2928 | 261 |
| 132 | 3300048912 | Ga0496109_0151843 | Ga0496109_0151843_1082_1948 | 261 |
| 133 | 3300048913 | Ga0496110_0043863 | Ga0496110_0043863_1734_2600 | 261 |
| 134 | 3300048914 | Ga0496111_0014423 | Ga0496111_0014423_2966_3832 | 261 |
| 135 | 3300048915 | Ga0496112_0033527 | Ga0496112_0033527_1798_2664 | 261 |
| 136 | 3300048916 | Ga0496113_0012183 | Ga0496113_0012183_660_1526 | 261 |
| 137 | 3300030521 | Ga0307511_10001274 | Ga0307511_1000127420 | 262 |
| 138 | 3300031616 | Ga0307508_10001935 | Ga0307508_100019358 | 262 |
| 139 | 3300035692 | Ga0373935_0166156 | Ga0373935_0166156_43_837 | 262 |
| 140 | 3300042016 | Ga0439463_033195 | Ga0439463_033195_459_1250 | 262 |
| 141 | 3300044765 | Ga0466970_0258849 | Ga0466970_0258849_59_847 | 262 |
| 142 | 3300046517 | Ga0495630_0094582 | Ga0495630_0094582_1334_2128 | 262 |
| 143 | 3300048915 | Ga0496112_0560969 | Ga0496112_0560969_48_839 | 262 |
| 144 | 3300005444 | Ga0070694_100248624 | Ga0070694_1002486242 | 263 |
| 145 | 3300005618 | Ga0068864_100314251 | Ga0068864_1003142512 | 263 |
| 146 | 3300005937 | Ga0081455_10038418 | Ga0081455_100384182 | 263 |
| 147 | 3300006051 | Ga0075364_10337751 | Ga0075364_103377511 | 263 |
| 148 | 3300006177 | Ga0075362_10059067 | Ga0075362_100590672 | 263 |
| 149 | 3300006177 | Ga0075362_10116848 | Ga0075362_101168482 | 263 |
| 150 | 3300006178 | Ga0075367_10025230 | Ga0075367_100252302 | 263 |
| 151 | 3300006178 | Ga0075367_10213671 | Ga0075367_102136712 | 263 |
| 152 | 3300006353 | Ga0075370_10109066 | Ga0075370_101090662 | 263 |
| 153 | 3300028380 | Ga0268265_10233863 | Ga0268265_102338632 | 263 |
| 154 | 3300031903 | Ga0307407_10042103 | Ga0307407_100421032 | 263 |
| 155 | 3300032002 | Ga0307416_100010065 | Ga0307416_1000100652 | 263 |
| 156 | 3300037418 | Ga0395900_0209837 | Ga0395900_0209837_572_1363 | 263 |
| 157 | 3300044765 | Ga0466970_0095488 | Ga0466970_0095488_600_1391 | 263 |
| 158 | 3300044901 | Ga0466960_0273099 | Ga0466960_0273099_14_808 | 263 |
| 159 | 3300045976 | Ga0466967_0482288 | Ga0466967_0482288_14_805 | 263 |
| 160 | 3300048917 | Ga0496114_0040332 | Ga0496114_0040332_779_1570 | 263 |
| 161 | 3300049575 | Ga0501039_0067700 | Ga0501039_0067700_294_1085 | 263 |
| 162 | 3300049586 | Ga0501070_0324077 | Ga0501070_0324077_84_875 | 263 |
| 163 | 3300049589 | Ga0501073_0240117 | Ga0501073_0240117_208_999 | 263 |
| 164 | 3300049590 | Ga0501074_0138667 | Ga0501074_0138667_626_1417 | 263 |
| 165 | 3300050489 | nmdc:mga03683_111319_c1 | nmdc:mga03683_111319_c1_378_1169 | 263 |
| 166 | 3300050490 | nmdc:mga03n38_16734_c1 | nmdc:mga03n38_16734_c1_1868_2659 | 263 |
| 167 | 3300050491 | nmdc:mga00v17_136514_c1 | nmdc:mga00v17_136514_c1_716_1507 | 263 |
| 168 | 3300050491 | nmdc:mga00v17_137894_c1 | nmdc:mga00v17_137894_c1_231_1022 | 263 |
| 169 | 3300050491 | nmdc:mga00v17_26837_c1 | nmdc:mga00v17_26837_c1_2274_3065 | 263 |
| 170 | 3300050491 | nmdc:mga00v17_55728_c1 | nmdc:mga00v17_55728_c1_1482_2273 | 263 |
| 171 | 3300050492 | nmdc:mga0yw44_138019_c1 | nmdc:mga0yw44_138019_c1_464_1255 | 263 |
| 172 | 3300050492 | nmdc:mga0yw44_29693_c1 | nmdc:mga0yw44_29693_c1_1712_2503 | 263 |
| 173 | 3300050492 | nmdc:mga0yw44_479452_c1 | nmdc:mga0yw44_479452_c1_31_822 | 263 |
| 174 | 3300050492 | nmdc:mga0yw44_77146_c1 | nmdc:mga0yw44_77146_c1_941_1732 | 263 |
| 175 | 3300050492 | nmdc:mga0yw44_92733_c1 | nmdc:mga0yw44_92733_c1_716_1507 | 263 |
| 176 | 3300050494 | nmdc:mga06z11_135356_c1 | nmdc:mga06z11_135356_c1_425_1216 | 263 |
| 177 | 3300050494 | nmdc:mga06z11_85314_c1 | nmdc:mga06z11_85314_c1_733_1524 | 263 |
| 178 | 3300050494 | nmdc:mga06z11_91144_c1 | nmdc:mga06z11_91144_c1_714_1505 | 263 |
| 179 | 3300050496 | nmdc:mga07m45_16382_c1 | nmdc:mga07m45_16382_c1_2742_3533 | 263 |
| 180 | 3300050496 | nmdc:mga07m45_18953_c1 | nmdc:mga07m45_18953_c1_2585_3376 | 263 |
| 181 | 3300053083 | Ga0495655_0003785 | Ga0495655_0003785_309_1100 | 263 |
| 182 | 3300053088 | Ga0500644_0000090 | Ga0500644_0000090_26476_27267 | 263 |
| 183 | 3300053104 | Ga0500556_0106594 | Ga0500556_0106594_209_1030 | 263 |
| 184 | 3300054114 | Ga0501084_0090625 | Ga0501084_0090625_1058_1849 | 263 |
| 185 | 3300031901 | Ga0307406_10191399 | Ga0307406_101913992 | 264 |
| 186 | 3300032002 | Ga0307416_100436073 | Ga0307416_1004360732 | 264 |
| 187 | 3300032126 | Ga0307415_100076829 | Ga0307415_1000768292 | 264 |
| 188 | 3300049575 | Ga0501039_0030912 | Ga0501039_0030912_3145_4107 | 264 |
| 189 | 3300049587 | Ga0501071_0043166 | Ga0501071_0043166_1966_2862 | 264 |
| 190 | 3300049587 | Ga0501071_0234859 | Ga0501071_0234859_46_1008 | 264 |
| 191 | 3300049590 | Ga0501074_0271837 | Ga0501074_0271837_118_1014 | 264 |
| 192 | 3300049592 | Ga0501076_0041834 | Ga0501076_0041834_1519_2415 | 264 |
| 193 | 3300049593 | Ga0501077_0310412 | Ga0501077_0310412_43_909 | 264 |
| 194 | 3300049741 | Ga0501079_0151215 | Ga0501079_0151215_203_1099 | 264 |
| 195 | 3300061734 | Ga0530510_0468966 | Ga0530510_0468966_16_909 | 264 |
| 196 | 3300009148 | Ga0105243_10212016 | Ga0105243_102120162 | 265 |
| 197 | 3300014326 | Ga0157380_10119787 | Ga0157380_101197872 | 265 |
| 198 | 3300025942 | Ga0207689_10193688 | Ga0207689_101936881 | 265 |
| 199 | 3300046460 | Ga0495638_0105041 | Ga0495638_0105041_697_1605 | 265 |
| 200 | 3300050489 | nmdc:mga03683_149090_c1 | nmdc:mga03683_149090_c1_49_849 | 265 |
| 201 | 3300050491 | nmdc:mga00v17_40173_c1 | nmdc:mga00v17_40173_c1_737_1537 | 265 |
| 202 | 3300050492 | nmdc:mga0yw44_7135_c1 | nmdc:mga0yw44_7135_c1_1842_2642 | 265 |
| 203 | 3300050493 | nmdc:mga0k408_189958_c1 | nmdc:mga0k408_189958_c1_52_852 | 265 |
| 204 | 3300050494 | nmdc:mga06z11_54334_c1 | nmdc:mga06z11_54334_c1_299_1099 | 265 |
| 205 | 3300053153 | Ga0500616_0014387 | Ga0500616_0014387_344_1252 | 265 |
| 206 | 3300005329 | Ga0070683_100429970 | Ga0070683_1004299701 | 266 |
| 207 | 3300028794 | Ga0307515_10126220 | Ga0307515_101262203 | 266 |
| 208 | 3300049569 | Ga0501032_0193512 | Ga0501032_0193512_400_1293 | 266 |
| 209 | 3300049572 | Ga0501036_0205127 | Ga0501036_0205127_94_987 | 266 |
| 210 | 3300049574 | Ga0501038_0081095 | Ga0501038_0081095_1413_2306 | 266 |
| 211 | 3300049576 | Ga0501040_0034607 | Ga0501040_0034607_168_1061 | 266 |
| 212 | 3300049578 | Ga0501042_0126635 | Ga0501042_0126635_89_982 | 266 |
| 213 | 3300049580 | Ga0501046_0037033 | Ga0501046_0037033_2945_3838 | 266 |
| 214 | 3300049582 | Ga0501048_0007742 | Ga0501048_0007742_5489_6382 | 266 |
| 215 | 3300049586 | Ga0501070_0128324 | Ga0501070_0128324_1132_2025 | 266 |
| 216 | 3300049588 | Ga0501072_0134239 | Ga0501072_0134239_173_1066 | 266 |
| 217 | 3300049590 | Ga0501074_0044051 | Ga0501074_0044051_1027_1920 | 266 |
| 218 | 3300049591 | Ga0501075_0017442 | Ga0501075_0017442_2224_3117 | 266 |
| 219 | 3300049592 | Ga0501076_0014733 | Ga0501076_0014733_2965_3858 | 266 |
| 220 | 3300049593 | Ga0501077_0046778 | Ga0501077_0046778_437_1330 | 266 |
| 221 | 3300049822 | Ga0501035_0030660 | Ga0501035_0030660_1958_2851 | 266 |
| 222 | 3300054114 | Ga0501084_0026872 | Ga0501084_0026872_1940_2833 | 266 |
| 223 | 3300060353 | Ga0501082_0025248 | Ga0501082_0025248_1494_2387 | 266 |
| 224 | 3300061734 | Ga0530510_0206564 | Ga0530510_0206564_288_1181 | 266 |
| 225 | 3300005341 | Ga0070691_10021319 | Ga0070691_100213193 | 267 |
| 226 | 3300005563 | Ga0068855_100046262 | Ga0068855_1000462623 | 267 |
| 227 | 3300005937 | Ga0081455_10025145 | Ga0081455_100251455 | 267 |
| 228 | 3300009176 | Ga0105242_10127408 | Ga0105242_101274082 | 267 |
| 229 | 3300013102 | Ga0157371_10176500 | Ga0157371_101765002 | 267 |
| 230 | 3300013307 | Ga0157372_10058270 | Ga0157372_100582703 | 267 |
| 231 | 3300025933 | Ga0207706_10072389 | Ga0207706_100723893 | 267 |
| 232 | 3300025949 | Ga0207667_10082423 | Ga0207667_100824232 | 267 |
| 233 | 3300042016 | Ga0439463_011559 | Ga0439463_011559_932_1810 | 267 |
| 234 | 3300031727 | Ga0316576_10307938 | Ga0316576_103079382 | 269 |
| 235 | 3300033179 | Ga0307507_10056762 | Ga0307507_100567622 | 269 |
| 236 | 3300035398 | Ga0316574_0094024 | Ga0316574_0094024_60_869 | 269 |
| 237 | 3300042876 | Ga0451577_0002607 | Ga0451577_0002607_8110_9039 | 269 |
| 238 | 3300044712 | Ga0453684_0003257 | Ga0453684_0003257_1145_2074 | 269 |
| 239 | 3300037418 | Ga0395900_0196035 | Ga0395900_0196035_31_843 | 270 |
| 240 | 3300031903 | Ga0307407_10026838 | Ga0307407_100268382 | 271 |
| 241 | 3300031995 | Ga0307409_100047500 | Ga0307409_1000475003 | 271 |
| 242 | 3300032002 | Ga0307416_100029855 | Ga0307416_1000298553 | 271 |
| 243 | 3300049583 | Ga0501067_0027021 | Ga0501067_0027021_2291_3106 | 271 |
| 244 | 3300049585 | Ga0501069_0050230 | Ga0501069_0050230_1309_2124 | 271 |
| 245 | 3300049588 | Ga0501072_0169203 | Ga0501072_0169203_178_993 | 271 |
| 246 | 3300049592 | Ga0501076_0169418 | Ga0501076_0169418_857_1672 | 271 |
| 247 | 3300005983 | Ga0081540_1012872 | Ga0081540_10128723 | 273 |
| 248 | 3300044683 | Ga0466965_0013666 | Ga0466965_0013666_1151_1999 | 273 |
| 249 | 3300044901 | Ga0466960_0015885 | Ga0466960_0015885_1411_2259 | 273 |
| 250 | 3300046473 | Ga0495582_0033736 | Ga0495582_0033736_852_1673 | 273 |
| 251 | 3300009147 | Ga0114129_10170060 | Ga0114129_101700603 | 274 |
| 252 | 3300050507 | nmdc:mga05p37_126130_c1 | nmdc:mga05p37_126130_c1_406_1320 | 274 |
| 253 | 3300005327 | Ga0070658_10065628 | Ga0070658_100656283 | 276 |
| 254 | 3300005338 | Ga0068868_100106629 | Ga0068868_1001066293 | 276 |
| 255 | 3300005339 | Ga0070660_100051368 | Ga0070660_1000513682 | 276 |
| 256 | 3300005455 | Ga0070663_100002020 | Ga0070663_1000020204 | 276 |
| 257 | 3300005563 | Ga0068855_100229606 | Ga0068855_1002296062 | 276 |
| 258 | 3300005719 | Ga0068861_100123814 | Ga0068861_1001238142 | 276 |
| 259 | 3300005843 | Ga0068860_100053843 | Ga0068860_1000538433 | 276 |
| 260 | 3300009553 | Ga0105249_10071356 | Ga0105249_100713562 | 276 |
| 261 | 3300013308 | Ga0157375_10464673 | Ga0157375_104646732 | 276 |
| 262 | 3300025919 | Ga0207657_10030915 | Ga0207657_100309153 | 276 |
| 263 | 3300025932 | Ga0207690_10239279 | Ga0207690_102392792 | 276 |
| 264 | 3300025949 | Ga0207667_10506536 | Ga0207667_105065362 | 276 |
| 265 | 3300026067 | Ga0207678_10000391 | Ga0207678_1000039120 | 276 |
| 266 | 3300026118 | Ga0207675_100061350 | Ga0207675_1000613504 | 276 |
| 267 | 3300028381 | Ga0268264_10030952 | Ga0268264_100309523 | 276 |
| 268 | 3300044658 | Ga0466972_0096218 | Ga0466972_0096218_199_1038 | 276 |
| 269 | 3300005578 | Ga0068854_100242942 | Ga0068854_1002429422 | 277 |
| 270 | 3300005618 | Ga0068864_100194781 | Ga0068864_1001947812 | 277 |
| 271 | 3300006038 | Ga0075365_10003573 | Ga0075365_100035733 | 277 |
| 272 | 3300006051 | Ga0075364_10007483 | Ga0075364_100074833 | 277 |
| 273 | 3300006177 | Ga0075362_10005215 | Ga0075362_100052153 | 277 |
| 274 | 3300006178 | Ga0075367_10051347 | Ga0075367_100513473 | 277 |
| 275 | 3300006195 | Ga0075366_10058694 | Ga0075366_100586943 | 277 |
| 276 | 3300006353 | Ga0075370_10077574 | Ga0075370_100775742 | 277 |
| 277 | 3300006358 | Ga0068871_100114290 | Ga0068871_1001142902 | 277 |
| 278 | 3300014968 | Ga0157379_10452663 | Ga0157379_104526632 | 277 |
| 279 | 3300026035 | Ga0207703_10087530 | Ga0207703_100875302 | 277 |
| 280 | 3300026078 | Ga0207702_10618807 | Ga0207702_106188071 | 277 |
| 281 | 3300027866 | Ga0209813_10042107 | Ga0209813_100421072 | 277 |
| 282 | 3300048911 | Ga0496108_0000343 | Ga0496108_0000343_22777_23616 | 277 |
| 283 | 3300048912 | Ga0496109_0350217 | Ga0496109_0350217_275_1159 | 277 |
| 284 | 3300048917 | Ga0496114_0019559 | Ga0496114_0019559_1465_2355 | 277 |
| 285 | 3300048917 | Ga0496114_0177344 | Ga0496114_0177344_232_1116 | 277 |
| 286 | 3300050516 | nmdc:mga0sz30_6672_c1 | nmdc:mga0sz30_6672_c1_2835_3710 | 277 |
| 287 | 3300005356 | Ga0070674_100123075 | Ga0070674_1001230752 | 278 |
| 288 | 3300005841 | Ga0068863_100514077 | Ga0068863_1005140772 | 278 |
| 289 | 3300006358 | Ga0068871_100114414 | Ga0068871_1001144142 | 278 |
| 290 | 3300009553 | Ga0105249_10192783 | Ga0105249_101927832 | 278 |
| 291 | 3300013308 | Ga0157375_10017673 | Ga0157375_100176736 | 278 |
| 292 | 3300017792 | Ga0163161_10044339 | Ga0163161_100443392 | 278 |
| 293 | 3300025935 | Ga0207709_10063853 | Ga0207709_100638532 | 278 |
| 294 | 3300025972 | Ga0207668_10191064 | Ga0207668_101910642 | 278 |
| 295 | 3300031901 | Ga0307406_10123415 | Ga0307406_101234152 | 279 |
| 296 | iso_pu_bacteria | 2751185782 | 2753268881 | 279 |
| 297 | 3300005355 | Ga0070671_100037911 | Ga0070671_1000379112 | 280 |
| 298 | 3300005440 | Ga0070705_100021187 | Ga0070705_1000211873 | 280 |
| 299 | 3300005440 | Ga0070705_100119167 | Ga0070705_1001191672 | 280 |
| 300 | 3300005467 | Ga0070706_100156215 | Ga0070706_1001562152 | 280 |
| 301 | 3300005468 | Ga0070707_100070989 | Ga0070707_1000709892 | 280 |
| 302 | 3300005471 | Ga0070698_100001085 | Ga0070698_10000108516 | 280 |
| 303 | 3300005471 | Ga0070698_100252529 | Ga0070698_1002525292 | 280 |
| 304 | 3300005518 | Ga0070699_100203607 | Ga0070699_1002036071 | 280 |
| 305 | 3300005536 | Ga0070697_100190224 | Ga0070697_1001902242 | 280 |
| 306 | 3300005545 | Ga0070695_100082640 | Ga0070695_1000826402 | 280 |
| 307 | 3300005546 | Ga0070696_100012733 | Ga0070696_1000127336 | 280 |
| 308 | 3300005546 | Ga0070696_100103945 | Ga0070696_1001039452 | 280 |
| 309 | 3300005578 | Ga0068854_100109920 | Ga0068854_1001099202 | 280 |
| 310 | 3300005614 | Ga0068856_100195529 | Ga0068856_1001955292 | 280 |
| 311 | 3300006048 | Ga0075363_100111591 | Ga0075363_1001115912 | 280 |
| 312 | 3300006051 | Ga0075364_10129013 | Ga0075364_101290132 | 280 |
| 313 | 3300006846 | Ga0075430_100247716 | Ga0075430_1002477161 | 280 |
| 314 | 3300006847 | Ga0075431_100000676 | Ga0075431_10000067612 | 280 |
| 315 | 3300006871 | Ga0075434_100049120 | Ga0075434_1000491202 | 280 |
| 316 | 3300009148 | Ga0105243_10266094 | Ga0105243_102660942 | 280 |
| 317 | 3300009553 | Ga0105249_10367840 | Ga0105249_103678402 | 280 |
| 318 | 3300010375 | Ga0105239_10171522 | Ga0105239_101715221 | 280 |
| 319 | 3300014968 | Ga0157379_10240244 | Ga0157379_102402441 | 280 |
| 320 | 3300014969 | Ga0157376_10438211 | Ga0157376_104382111 | 280 |
| 321 | 3300025917 | Ga0207660_10243717 | Ga0207660_102437172 | 280 |
| 322 | 3300025931 | Ga0207644_10030397 | Ga0207644_100303972 | 280 |
| 323 | 3300025933 | Ga0207706_10137202 | Ga0207706_101372022 | 280 |
| 324 | 3300025935 | Ga0207709_10299897 | Ga0207709_102998972 | 280 |
| 325 | 3300025961 | Ga0207712_10241055 | Ga0207712_102410552 | 280 |
| 326 | 3300025981 | Ga0207640_10101431 | Ga0207640_101014312 | 280 |
| 327 | 3300026078 | Ga0207702_10084488 | Ga0207702_100844883 | 280 |
| 328 | 3300037312 | Ga0395899_0007240 | Ga0395899_0007240_5410_6306 | 280 |
| 329 | 3300037418 | Ga0395900_0022618 | Ga0395900_0022618_534_1430 | 280 |
| 330 | 3300037418 | Ga0395900_0144622 | Ga0395900_0144622_654_1562 | 280 |
| 331 | 3300037466 | Ga0395898_0014756 | Ga0395898_0014756_6513_7421 | 280 |
| 332 | 3300037466 | Ga0395898_0163142 | Ga0395898_0163142_1183_2079 | 280 |
| 333 | 3300037471 | Ga0395905_0046823 | Ga0395905_0046823_14_922 | 280 |
| 334 | 3300037471 | Ga0395905_0312292 | Ga0395905_0312292_512_1408 | 280 |
| 335 | 3300038443 | Ga0395901_0026456 | Ga0395901_0026456_57_953 | 280 |
| 336 | 3300038443 | Ga0395901_0271572 | Ga0395901_0271572_395_1303 | 280 |
| 337 | 3300044673 | Ga0453683_0122589 | Ga0453683_0122589_66_962 | 280 |
| 338 | 3300044901 | Ga0466960_0004512 | Ga0466960_0004512_3811_4653 | 280 |
| 339 | 3300045051 | Ga0451576_0039926 | Ga0451576_0039926_2975_3871 | 280 |
| 340 | 3300046537 | Ga0495598_0089171 | Ga0495598_0089171_71_967 | 280 |
| 341 | 3300048903 | Ga0496100_0043703 | Ga0496100_0043703_984_1880 | 280 |
| 342 | 3300048904 | Ga0496101_0024796 | Ga0496101_0024796_628_1524 | 280 |
| 343 | 3300048905 | Ga0496102_0041815 | Ga0496102_0041815_1664_2560 | 280 |
| 344 | 3300048905 | Ga0496102_0395761 | Ga0496102_0395761_208_1062 | 280 |
| 345 | 3300048907 | Ga0496104_0003502 | Ga0496104_0003502_7219_8115 | 280 |
| 346 | 3300048907 | Ga0496104_0301932 | Ga0496104_0301932_192_1046 | 280 |
| 347 | 3300048908 | Ga0496105_0003442 | Ga0496105_0003442_10100_10996 | 280 |
| 348 | 3300048908 | Ga0496105_0310370 | Ga0496105_0310370_203_1057 | 280 |
| 349 | 3300048909 | Ga0496106_0009225 | Ga0496106_0009225_2524_3420 | 280 |
| 350 | 3300048910 | Ga0496107_0005994 | Ga0496107_0005994_5328_6224 | 280 |
| 351 | 3300048911 | Ga0496108_0000996 | Ga0496108_0000996_4538_5434 | 280 |
| 352 | 3300048911 | Ga0496108_0536443 | Ga0496108_0536443_141_995 | 280 |
| 353 | 3300048912 | Ga0496109_0022341 | Ga0496109_0022341_3866_4762 | 280 |
| 354 | 3300048912 | Ga0496109_0075581 | Ga0496109_0075581_1950_2804 | 280 |
| 355 | 3300048912 | Ga0496109_0304077 | Ga0496109_0304077_614_1468 | 280 |
| 356 | 3300048913 | Ga0496110_0012203 | Ga0496110_0012203_3866_4762 | 280 |
| 357 | 3300048914 | Ga0496111_0002132 | Ga0496111_0002132_6608_7504 | 280 |
| 358 | 3300048914 | Ga0496111_0172904 | Ga0496111_0172904_381_1235 | 280 |
| 359 | 3300048915 | Ga0496112_0000886 | Ga0496112_0000886_10434_11330 | 280 |
| 360 | 3300048916 | Ga0496113_0001514 | Ga0496113_0001514_7592_8488 | 280 |
| 361 | 3300048916 | Ga0496113_0240011 | Ga0496113_0240011_222_1076 | 280 |
| 362 | 3300048916 | Ga0496113_0386753 | Ga0496113_0386753_210_1064 | 280 |
| 363 | 3300048917 | Ga0496114_0150743 | Ga0496114_0150743_188_1084 | 280 |
| 364 | 3300048917 | Ga0496114_0350062 | Ga0496114_0350062_202_1056 | 280 |
| 365 | 3300049583 | Ga0501067_0002098 | Ga0501067_0002098_5400_6296 | 280 |
| 366 | 3300049585 | Ga0501069_0000952 | Ga0501069_0000952_2836_3732 | 280 |
| 367 | 3300049586 | Ga0501070_0160242 | Ga0501070_0160242_297_1193 | 280 |
| 368 | 3300050509 | nmdc:mga0qj67_341163_c1 | nmdc:mga0qj67_341163_c1_176_1102 | 280 |
| 369 | 3300050510 | nmdc:mga06r32_4332_c1 | nmdc:mga06r32_4332_c1_7713_8639 | 280 |
| 370 | 3300050512 | nmdc:mga0n895_47538_c1 | nmdc:mga0n895_47538_c1_202_1098 | 280 |
| 371 | 3300050514 | nmdc:mga08x19_135541_c1 | nmdc:mga08x19_135541_c1_287_1183 | 280 |
| 372 | 3300061734 | Ga0530510_0043046 | Ga0530510_0043046_942_1838 | 280 |
| 373 | 3300005328 | Ga0070676_10021068 | Ga0070676_100210683 | 281 |
| 374 | 3300005329 | Ga0070683_100064097 | Ga0070683_1000640972 | 281 |
| 375 | 3300005338 | Ga0068868_100003930 | Ga0068868_1000039305 | 281 |
| 376 | 3300005343 | Ga0070687_100071630 | Ga0070687_1000716302 | 281 |
| 377 | 3300005345 | Ga0070692_10100436 | Ga0070692_101004362 | 281 |
| 378 | 3300005347 | Ga0070668_100003460 | Ga0070668_10000346012 | 281 |
| 379 | 3300005347 | Ga0070668_100228552 | Ga0070668_1002285522 | 281 |
| 380 | 3300005364 | Ga0070673_100368787 | Ga0070673_1003687872 | 281 |
| 381 | 3300005366 | Ga0070659_100033853 | Ga0070659_1000338533 | 281 |
| 382 | 3300005456 | Ga0070678_100316281 | Ga0070678_1003162812 | 281 |
| 383 | 3300005457 | Ga0070662_100007677 | Ga0070662_1000076777 | 281 |
| 384 | 3300005535 | Ga0070684_100021842 | Ga0070684_1000218424 | 281 |
| 385 | 3300005535 | Ga0070684_100026608 | Ga0070684_1000266087 | 281 |
| 386 | 3300005548 | Ga0070665_100476023 | Ga0070665_1004760232 | 281 |
| 387 | 3300005564 | Ga0070664_100037100 | Ga0070664_1000371003 | 281 |
| 388 | 3300005577 | Ga0068857_100288327 | Ga0068857_1002883272 | 281 |
| 389 | 3300005616 | Ga0068852_100030291 | Ga0068852_1000302914 | 281 |
| 390 | 3300005618 | Ga0068864_100082387 | Ga0068864_1000823872 | 281 |
| 391 | 3300005719 | Ga0068861_100147802 | Ga0068861_1001478022 | 281 |
| 392 | 3300005842 | Ga0068858_100073576 | Ga0068858_1000735762 | 281 |
| 393 | 3300005843 | Ga0068860_100030588 | Ga0068860_1000305882 | 281 |
| 394 | 3300005985 | Ga0081539_10011886 | Ga0081539_100118869 | 281 |
| 395 | 3300006844 | Ga0075428_100052542 | Ga0075428_1000525424 | 281 |
| 396 | 3300009094 | Ga0111539_10022261 | Ga0111539_100222614 | 281 |
| 397 | 3300009098 | Ga0105245_10017702 | Ga0105245_100177027 | 281 |
| 398 | 3300009147 | Ga0114129_10227875 | Ga0114129_102278752 | 281 |
| 399 | 3300009545 | Ga0105237_10436164 | Ga0105237_104361642 | 281 |
| 400 | 3300009545 | Ga0105237_10768228 | Ga0105237_107682281 | 281 |
| 401 | 3300010375 | Ga0105239_10032152 | Ga0105239_100321525 | 281 |
| 402 | 3300013306 | Ga0163162_10718608 | Ga0163162_107186082 | 281 |
| 403 | 3300014326 | Ga0157380_10247065 | Ga0157380_102470652 | 281 |
| 404 | 3300014745 | Ga0157377_10009619 | Ga0157377_100096194 | 281 |
| 405 | 3300025907 | Ga0207645_10042479 | Ga0207645_100424792 | 281 |
| 406 | 3300025918 | Ga0207662_10052216 | Ga0207662_100522163 | 281 |
| 407 | 3300025926 | Ga0207659_10041269 | Ga0207659_100412692 | 281 |
| 408 | 3300025927 | Ga0207687_10018266 | Ga0207687_100182664 | 281 |
| 409 | 3300025932 | Ga0207690_10029835 | Ga0207690_100298352 | 281 |
| 410 | 3300025933 | Ga0207706_10009698 | Ga0207706_100096987 | 281 |
| 411 | 3300025944 | Ga0207661_10021598 | Ga0207661_100215983 | 281 |
| 412 | 3300025944 | Ga0207661_10518664 | Ga0207661_105186642 | 281 |
| 413 | 3300025945 | Ga0207679_10008645 | Ga0207679_100086455 | 281 |
| 414 | 3300025972 | Ga0207668_10001892 | Ga0207668_1000189212 | 281 |
| 415 | 3300025972 | Ga0207668_10071674 | Ga0207668_100716743 | 281 |
| 416 | 3300026035 | Ga0207703_10120589 | Ga0207703_101205892 | 281 |
| 417 | 3300026075 | Ga0207708_10151342 | Ga0207708_101513422 | 281 |
| 418 | 3300026095 | Ga0207676_10076495 | Ga0207676_100764952 | 281 |
| 419 | 3300026116 | Ga0207674_10030133 | Ga0207674_100301335 | 281 |
| 420 | 3300026116 | Ga0207674_10356367 | Ga0207674_103563672 | 281 |
| 421 | 3300026118 | Ga0207675_100110177 | Ga0207675_1001101772 | 281 |
| 422 | 3300026142 | Ga0207698_10048649 | Ga0207698_100486493 | 281 |
| 423 | 3300028380 | Ga0268265_10015214 | Ga0268265_100152144 | 281 |
| 424 | 3300031548 | Ga0307408_100059051 | Ga0307408_1000590513 | 281 |
| 425 | 3300031824 | Ga0307413_10283746 | Ga0307413_102837462 | 281 |
| 426 | 3300031852 | Ga0307410_10056268 | Ga0307410_100562683 | 281 |
| 427 | 3300031889 | Ga0326468_10000083 | Ga0326468_100000833 | 281 |
| 428 | 3300031901 | Ga0307406_10039433 | Ga0307406_100394332 | 281 |
| 429 | 3300031901 | Ga0307406_10217854 | Ga0307406_102178541 | 281 |
| 430 | 3300031903 | Ga0307407_10274055 | Ga0307407_102740552 | 281 |
| 431 | 3300031995 | Ga0307409_100001479 | Ga0307409_1000014796 | 281 |
| 432 | 3300032002 | Ga0307416_100076442 | Ga0307416_1000764421 | 281 |
| 433 | 3300032126 | Ga0307415_100000049 | Ga0307415_10000004911 | 281 |
| 434 | 3300035692 | Ga0373935_0018731 | Ga0373935_0018731_2590_3471 | 281 |
| 435 | 3300044656 | Ga0466969_0040154 | Ga0466969_0040154_360_1256 | 281 |
| 436 | 3300044684 | Ga0466966_0001252 | Ga0466966_0001252_9948_10844 | 281 |
| 437 | 3300044693 | Ga0466961_0018128 | Ga0466961_0018128_2941_3840 | 281 |
| 438 | 3300044765 | Ga0466970_0008269 | Ga0466970_0008269_3284_4183 | 281 |
| 439 | 3300045049 | Ga0466959_0002606 | Ga0466959_0002606_1573_2469 | 281 |
| 440 | 3300046499 | Ga0495594_0014519 | Ga0495594_0014519_48_953 | 281 |
| 441 | 3300047315 | Ga0495581_0168235 | Ga0495581_0168235_30_935 | 281 |
| 442 | 3300050507 | nmdc:mga05p37_294352_c1 | nmdc:mga05p37_294352_c1_749_1645 | 281 |
| 443 | 3300050510 | nmdc:mga06r32_574960_c1 | nmdc:mga06r32_574960_c1_120_1016 | 281 |
| 444 | 3300050511 | nmdc:mga08y16_65779_c1 | nmdc:mga08y16_65779_c1_2480_3400 | 281 |
| 445 | 3300053085 | Ga0495619_0008871 | Ga0495619_0008871_1905_2819 | 281 |
| 446 | iso_pu_bacteria | 2622736626 | 2623587338 | 281 |
| 447 | iso_pu_bacteria | 2902582711 | 2902587876 | 281 |
| 448 | iso_pu_bacteria | 2996221748 | 2996226491 | 281 |
| 449 | 3300002459 | JGI24751J29686_10004243 | JGI24751J29686_100042433 | 282 |
| 450 | 3300005328 | Ga0070676_10036389 | Ga0070676_100363893 | 282 |
| 451 | 3300005331 | Ga0070670_100019163 | Ga0070670_1000191632 | 282 |
| 452 | 3300005334 | Ga0068869_100018671 | Ga0068869_1000186712 | 282 |
| 453 | 3300005335 | Ga0070666_10013334 | Ga0070666_100133342 | 282 |
| 454 | 3300005336 | Ga0070680_100063795 | Ga0070680_1000637953 | 282 |
| 455 | 3300005337 | Ga0070682_100057933 | Ga0070682_1000579332 | 282 |
| 456 | 3300005338 | Ga0068868_100007923 | Ga0068868_1000079233 | 282 |
| 457 | 3300005338 | Ga0068868_100096907 | Ga0068868_1000969072 | 282 |
| 458 | 3300005340 | Ga0070689_100018679 | Ga0070689_1000186795 | 282 |
| 459 | 3300005341 | Ga0070691_10001538 | Ga0070691_100015385 | 282 |
| 460 | 3300005345 | Ga0070692_10006877 | Ga0070692_100068773 | 282 |
| 461 | 3300005347 | Ga0070668_100182781 | Ga0070668_1001827812 | 282 |
| 462 | 3300005354 | Ga0070675_100316758 | Ga0070675_1003167582 | 282 |
| 463 | 3300005355 | Ga0070671_100051390 | Ga0070671_1000513902 | 282 |
| 464 | 3300005356 | Ga0070674_100274906 | Ga0070674_1002749062 | 282 |
| 465 | 3300005364 | Ga0070673_100105013 | Ga0070673_1001050132 | 282 |
| 466 | 3300005365 | Ga0070688_100225661 | Ga0070688_1002256612 | 282 |
| 467 | 3300005366 | Ga0070659_100062698 | Ga0070659_1000626983 | 282 |
| 468 | 3300005435 | Ga0070714_100025924 | Ga0070714_1000259244 | 282 |
| 469 | 3300005436 | Ga0070713_100003753 | Ga0070713_1000037539 | 282 |
| 470 | 3300005438 | Ga0070701_10016722 | Ga0070701_100167223 | 282 |
| 471 | 3300005440 | Ga0070705_100123500 | Ga0070705_1001235002 | 282 |
| 472 | 3300005455 | Ga0070663_100010278 | Ga0070663_1000102782 | 282 |
| 473 | 3300005456 | Ga0070678_100022800 | Ga0070678_1000228004 | 282 |
| 474 | 3300005458 | Ga0070681_10035257 | Ga0070681_100352574 | 282 |
| 475 | 3300005466 | Ga0070685_10117074 | Ga0070685_101170742 | 282 |
| 476 | 3300005535 | Ga0070684_100557422 | Ga0070684_1005574222 | 282 |
| 477 | 3300005539 | Ga0068853_100252251 | Ga0068853_1002522512 | 282 |
| 478 | 3300005544 | Ga0070686_100034332 | Ga0070686_1000343322 | 282 |
| 479 | 3300005546 | Ga0070696_100154679 | Ga0070696_1001546792 | 282 |
| 480 | 3300005548 | Ga0070665_100134065 | Ga0070665_1001340653 | 282 |
| 481 | 3300005549 | Ga0070704_100041860 | Ga0070704_1000418602 | 282 |
| 482 | 3300005549 | Ga0070704_100219556 | Ga0070704_1002195562 | 282 |
| 483 | 3300005563 | Ga0068855_100426121 | Ga0068855_1004261212 | 282 |
| 484 | 3300005578 | Ga0068854_100033288 | Ga0068854_1000332884 | 282 |
| 485 | 3300005614 | Ga0068856_100079472 | Ga0068856_1000794721 | 282 |
| 486 | 3300005615 | Ga0070702_100100048 | Ga0070702_1001000481 | 282 |
| 487 | 3300005718 | Ga0068866_10021563 | Ga0068866_100215633 | 282 |
| 488 | 3300005834 | Ga0068851_10019739 | Ga0068851_100197392 | 282 |
| 489 | 3300005840 | Ga0068870_10035440 | Ga0068870_100354402 | 282 |
| 490 | 3300005841 | Ga0068863_100018636 | Ga0068863_1000186366 | 282 |
| 491 | 3300005841 | Ga0068863_100267334 | Ga0068863_1002673342 | 282 |
| 492 | 3300005843 | Ga0068860_100026646 | Ga0068860_1000266463 | 282 |
| 493 | 3300005983 | Ga0081540_1063298 | Ga0081540_10632981 | 282 |
| 494 | 3300006028 | Ga0070717_10044621 | Ga0070717_100446212 | 282 |
| 495 | 3300006038 | Ga0075365_10050839 | Ga0075365_100508392 | 282 |
| 496 | 3300006038 | Ga0075365_10117490 | Ga0075365_101174902 | 282 |
| 497 | 3300006038 | Ga0075365_10120784 | Ga0075365_101207842 | 282 |
| 498 | 3300006038 | Ga0075365_10150907 | Ga0075365_101509072 | 282 |
| 499 | 3300006048 | Ga0075363_100001228 | Ga0075363_1000012287 | 282 |
| 500 | 3300006051 | Ga0075364_10100229 | Ga0075364_101002292 | 282 |
| 501 | 3300006058 | Ga0075432_10030525 | Ga0075432_100305252 | 282 |
| 502 | 3300006353 | Ga0075370_10034045 | Ga0075370_100340453 | 282 |
| 503 | 3300006358 | Ga0068871_100128346 | Ga0068871_1001283461 | 282 |
| 504 | 3300006844 | Ga0075428_100080554 | Ga0075428_1000805544 | 282 |
| 505 | 3300006847 | Ga0075431_100287615 | Ga0075431_1002876152 | 282 |
| 506 | 3300006852 | Ga0075433_10070532 | Ga0075433_100705323 | 282 |
| 507 | 3300006871 | Ga0075434_100001921 | Ga0075434_10000192120 | 282 |
| 508 | 3300006880 | Ga0075429_100286346 | Ga0075429_1002863462 | 282 |
| 509 | 3300006881 | Ga0068865_100053131 | Ga0068865_1000531312 | 282 |
| 510 | 3300006914 | Ga0075436_100000663 | Ga0075436_10000066320 | 282 |
| 511 | 3300007076 | Ga0075435_100002027 | Ga0075435_1000020275 | 282 |
| 512 | 3300009093 | Ga0105240_10526148 | Ga0105240_105261482 | 282 |
| 513 | 3300009094 | Ga0111539_10103122 | Ga0111539_101031221 | 282 |
| 514 | 3300009098 | Ga0105245_10285659 | Ga0105245_102856592 | 282 |
| 515 | 3300009148 | Ga0105243_10164247 | Ga0105243_101642472 | 282 |
| 516 | 3300009148 | Ga0105243_10517557 | Ga0105243_105175572 | 282 |
| 517 | 3300009174 | Ga0105241_10028260 | Ga0105241_100282601 | 282 |
| 518 | 3300009177 | Ga0105248_10025546 | Ga0105248_100255463 | 282 |
| 519 | 3300009545 | Ga0105237_10054318 | Ga0105237_100543183 | 282 |
| 520 | 3300009551 | Ga0105238_10181967 | Ga0105238_101819672 | 282 |
| 521 | 3300009553 | Ga0105249_10252993 | Ga0105249_102529932 | 282 |
| 522 | 3300010375 | Ga0105239_10459591 | Ga0105239_104595911 | 282 |
| 523 | 3300011119 | Ga0105246_10008187 | Ga0105246_100081875 | 282 |
| 524 | 3300013104 | Ga0157370_10031765 | Ga0157370_100317656 | 282 |
| 525 | 3300013296 | Ga0157374_10010504 | Ga0157374_100105042 | 282 |
| 526 | 3300013296 | Ga0157374_10279034 | Ga0157374_102790342 | 282 |
| 527 | 3300013306 | Ga0163162_10074333 | Ga0163162_100743331 | 282 |
| 528 | 3300013307 | Ga0157372_10332913 | Ga0157372_103329132 | 282 |
| 529 | 3300013308 | Ga0157375_10185620 | Ga0157375_101856203 | 282 |
| 530 | 3300014497 | Ga0182008_10039488 | Ga0182008_100394883 | 282 |
| 531 | 3300014745 | Ga0157377_10005400 | Ga0157377_100054002 | 282 |
| 532 | 3300014968 | Ga0157379_10297725 | Ga0157379_102977252 | 282 |
| 533 | 3300025321 | Ga0207656_10004547 | Ga0207656_100045475 | 282 |
| 534 | 3300025901 | Ga0207688_10005360 | Ga0207688_100053606 | 282 |
| 535 | 3300025901 | Ga0207688_10018631 | Ga0207688_100186313 | 282 |
| 536 | 3300025903 | Ga0207680_10206000 | Ga0207680_102060002 | 282 |
| 537 | 3300025907 | Ga0207645_10029478 | Ga0207645_100294783 | 282 |
| 538 | 3300025908 | Ga0207643_10000117 | Ga0207643_1000011746 | 282 |
| 539 | 3300025909 | Ga0207705_10019086 | Ga0207705_100190861 | 282 |
| 540 | 3300025911 | Ga0207654_10014770 | Ga0207654_100147702 | 282 |
| 541 | 3300025912 | Ga0207707_10213441 | Ga0207707_102134412 | 282 |
| 542 | 3300025913 | Ga0207695_10137665 | Ga0207695_101376652 | 282 |
| 543 | 3300025915 | Ga0207693_10033341 | Ga0207693_100333414 | 282 |
| 544 | 3300025921 | Ga0207652_10048958 | Ga0207652_100489582 | 282 |
| 545 | 3300025925 | Ga0207650_10000493 | Ga0207650_100004932 | 282 |
| 546 | 3300025926 | Ga0207659_10023592 | Ga0207659_100235923 | 282 |
| 547 | 3300025927 | Ga0207687_10048371 | Ga0207687_100483713 | 282 |
| 548 | 3300025928 | Ga0207700_10024192 | Ga0207700_100241921 | 282 |
| 549 | 3300025929 | Ga0207664_10221539 | Ga0207664_102215392 | 282 |
| 550 | 3300025931 | Ga0207644_10024057 | Ga0207644_100240571 | 282 |
| 551 | 3300025933 | Ga0207706_10287047 | Ga0207706_102870472 | 282 |
| 552 | 3300025934 | Ga0207686_10077183 | Ga0207686_100771832 | 282 |
| 553 | 3300025935 | Ga0207709_10067848 | Ga0207709_100678482 | 282 |
| 554 | 3300025935 | Ga0207709_10143913 | Ga0207709_101439132 | 282 |
| 555 | 3300025940 | Ga0207691_10032484 | Ga0207691_100324846 | 282 |
| 556 | 3300025942 | Ga0207689_10009422 | Ga0207689_100094225 | 282 |
| 557 | 3300025945 | Ga0207679_10002230 | Ga0207679_1000223010 | 282 |
| 558 | 3300025949 | Ga0207667_10375243 | Ga0207667_103752432 | 282 |
| 559 | 3300025961 | Ga0207712_10134629 | Ga0207712_101346292 | 282 |
| 560 | 3300025972 | Ga0207668_10046396 | Ga0207668_100463962 | 282 |
| 561 | 3300025981 | Ga0207640_10179125 | Ga0207640_101791252 | 282 |
| 562 | 3300026023 | Ga0207677_10005764 | Ga0207677_100057642 | 282 |
| 563 | 3300026023 | Ga0207677_10072877 | Ga0207677_100728772 | 282 |
| 564 | 3300026075 | Ga0207708_10017312 | Ga0207708_100173123 | 282 |
| 565 | 3300026075 | Ga0207708_10096740 | Ga0207708_100967403 | 282 |
| 566 | 3300026075 | Ga0207708_10205977 | Ga0207708_102059772 | 282 |
| 567 | 3300026078 | Ga0207702_10002078 | Ga0207702_100020786 | 282 |
| 568 | 3300026078 | Ga0207702_10115268 | Ga0207702_101152682 | 282 |
| 569 | 3300026088 | Ga0207641_10011671 | Ga0207641_100116716 | 282 |
| 570 | 3300026089 | Ga0207648_10034388 | Ga0207648_100343884 | 282 |
| 571 | 3300026089 | Ga0207648_10060948 | Ga0207648_100609483 | 282 |
| 572 | 3300026095 | Ga0207676_10001839 | Ga0207676_1000183913 | 282 |
| 573 | 3300026118 | Ga0207675_100258016 | Ga0207675_1002580161 | 282 |
| 574 | 3300026121 | Ga0207683_10044178 | Ga0207683_100441783 | 282 |
| 575 | 3300028379 | Ga0268266_10255450 | Ga0268266_102554501 | 282 |
| 576 | 3300035691 | Ga0373931_0181162 | Ga0373931_0181162_136_993 | 282 |
| 577 | 3300035725 | Ga0373947_0168992 | Ga0373947_0168992_520_1377 | 282 |
| 578 | 3300042137 | Ga0450902_003876 | Ga0450902_003876_1315_2193 | 282 |
| 579 | 3300044693 | Ga0466961_0052418 | Ga0466961_0052418_1642_2490 | 282 |
| 580 | 3300044694 | Ga0466963_0028854 | Ga0466963_0028854_1229_2077 | 282 |
| 581 | 3300044706 | Ga0466964_0002836 | Ga0466964_0002836_4160_5008 | 282 |
| 582 | 3300044842 | Ga0466957_0029745 | Ga0466957_0029745_1712_2560 | 282 |
| 583 | 3300044901 | Ga0466960_0009790 | Ga0466960_0009790_1358_2206 | 282 |
| 584 | 3300044901 | Ga0466960_0325747 | Ga0466960_0325747_10_858 | 282 |
| 585 | 3300045836 | Ga0466958_0122084 | Ga0466958_0122084_216_1064 | 282 |
| 586 | 3300045976 | Ga0466967_0017731 | Ga0466967_0017731_316_1164 | 282 |
| 587 | 3300048903 | Ga0496100_0003941 | Ga0496100_0003941_796_1698 | 282 |
| 588 | 3300048903 | Ga0496100_0302111 | Ga0496100_0302111_235_1179 | 282 |
| 589 | 3300048903 | Ga0496100_0370141 | Ga0496100_0370141_183_1049 | 282 |
| 590 | 3300048904 | Ga0496101_0021327 | Ga0496101_0021327_652_1554 | 282 |
| 591 | 3300048904 | Ga0496101_0138707 | Ga0496101_0138707_152_1030 | 282 |
| 592 | 3300048905 | Ga0496102_0004051 | Ga0496102_0004051_4988_5890 | 282 |
| 593 | 3300048905 | Ga0496102_0045548 | Ga0496102_0045548_13_891 | 282 |
| 594 | 3300048905 | Ga0496102_0406138 | Ga0496102_0406138_348_1214 | 282 |
| 595 | 3300048907 | Ga0496104_0170589 | Ga0496104_0170589_1111_1989 | 282 |
| 596 | 3300048909 | Ga0496106_0001302 | Ga0496106_0001302_3162_4064 | 282 |
| 597 | 3300048909 | Ga0496106_0097240 | Ga0496106_0097240_81_959 | 282 |
| 598 | 3300048910 | Ga0496107_0013612 | Ga0496107_0013612_2459_3361 | 282 |
| 599 | 3300048910 | Ga0496107_0156697 | Ga0496107_0156697_753_1631 | 282 |
| 600 | 3300048911 | Ga0496108_0001459 | Ga0496108_0001459_13275_14153 | 282 |
| 601 | 3300048912 | Ga0496109_0017442 | Ga0496109_0017442_5303_6181 | 282 |
| 602 | 3300048912 | Ga0496109_0090052 | Ga0496109_0090052_1486_2388 | 282 |
| 603 | 3300048913 | Ga0496110_0476106 | Ga0496110_0476106_62_940 | 282 |
| 604 | 3300048914 | Ga0496111_0042423 | Ga0496111_0042423_2373_3251 | 282 |
| 605 | 3300048916 | Ga0496113_0030191 | Ga0496113_0030191_2480_3358 | 282 |
| 606 | 3300048917 | Ga0496114_0007060 | Ga0496114_0007060_6298_7200 | 282 |
| 607 | 3300048918 | Ga0496115_0123310 | Ga0496115_0123310_613_1515 | 282 |
| 608 | 3300050492 | nmdc:mga0yw44_3355_c1 | nmdc:mga0yw44_3355_c1_2549_3397 | 282 |
| 609 | 3300050496 | nmdc:mga07m45_82522_c1 | nmdc:mga07m45_82522_c1_967_1815 | 282 |
| 610 | 3300050507 | nmdc:mga05p37_520953_c1 | nmdc:mga05p37_520953_c1_265_1143 | 282 |
| 611 | 3300050508 | nmdc:mga09592_102883_c1 | nmdc:mga09592_102883_c1_680_1558 | 282 |
| 612 | 3300050510 | nmdc:mga06r32_556321_c1 | nmdc:mga06r32_556321_c1_199_1056 | 282 |
| 613 | 3300050511 | nmdc:mga08y16_19899_c1 | nmdc:mga08y16_19899_c1_5728_6606 | 282 |
| 614 | 3300050512 | nmdc:mga0n895_10411_c1 | nmdc:mga0n895_10411_c1_7128_8006 | 282 |
| 615 | 3300050514 | nmdc:mga08x19_261359_c1 | nmdc:mga08x19_261359_c1_146_1003 | 282 |
| 616 | 3300050515 | nmdc:mga0a205_58720_c1 | nmdc:mga0a205_58720_c1_2745_3623 | 282 |
| 617 | 3300061719 | Ga0466962_0009384 | Ga0466962_0009384_2919_3767 | 282 |
| 618 | 3300000549 | LJQas_1002434 | LJQas_10024343 | 283 |
| 619 | 3300005441 | Ga0070700_100168072 | Ga0070700_1001680722 | 283 |
| 620 | 3300005457 | Ga0070662_100136432 | Ga0070662_1001364322 | 283 |
| 621 | 3300005937 | Ga0081455_10003611 | Ga0081455_100036112 | 283 |
| 622 | 3300005985 | Ga0081539_10001405 | Ga0081539_1000140527 | 283 |
| 623 | 3300005985 | Ga0081539_10009012 | Ga0081539_100090126 | 283 |
| 624 | 3300006847 | Ga0075431_100033118 | Ga0075431_1000331183 | 283 |
| 625 | 3300006880 | Ga0075429_100002702 | Ga0075429_10000270210 | 283 |
| 626 | 3300009148 | Ga0105243_10085613 | Ga0105243_100856132 | 283 |
| 627 | 3300013105 | Ga0157369_10075291 | Ga0157369_100752913 | 283 |
| 628 | 3300013306 | Ga0163162_10008544 | Ga0163162_100085443 | 283 |
| 629 | 3300013307 | Ga0157372_10145615 | Ga0157372_101456153 | 283 |
| 630 | 3300025933 | Ga0207706_10003126 | Ga0207706_100031264 | 283 |
| 631 | 3300025961 | Ga0207712_10081619 | Ga0207712_100816193 | 283 |
| 632 | 3300026075 | Ga0207708_10047309 | Ga0207708_100473093 | 283 |
| 633 | 3300026078 | Ga0207702_10419071 | Ga0207702_104190712 | 283 |
| 634 | 3300026118 | Ga0207675_100000686 | Ga0207675_1000006869 | 283 |
| 635 | 3300026142 | Ga0207698_10133262 | Ga0207698_101332622 | 283 |
| 636 | 3300027907 | Ga0207428_10022628 | Ga0207428_100226285 | 283 |
| 637 | 3300031456 | Ga0307513_10025522 | Ga0307513_100255224 | 283 |
| 638 | 3300031838 | Ga0307518_10000241 | Ga0307518_1000024112 | 283 |
| 639 | 3300031901 | Ga0307406_10218021 | Ga0307406_102180212 | 283 |
| 640 | 3300032002 | Ga0307416_100250724 | Ga0307416_1002507242 | 283 |
| 641 | 3300032002 | Ga0307416_100427702 | Ga0307416_1004277022 | 283 |
| 642 | 3300032005 | Ga0307411_10280456 | Ga0307411_102804562 | 283 |
| 643 | 3300044694 | Ga0466963_0016775 | Ga0466963_0016775_3339_4247 | 283 |
| 644 | 3300044765 | Ga0466970_0083549 | Ga0466970_0083549_426_1286 | 283 |
| 645 | 3300046491 | Ga0495584_0045248 | Ga0495584_0045248_977_1855 | 283 |
| 646 | 3300046501 | Ga0495607_0070044 | Ga0495607_0070044_371_1249 | 283 |
| 647 | 3300046513 | Ga0495616_0121646 | Ga0495616_0121646_107_985 | 283 |
| 648 | 3300046539 | Ga0495621_0057250 | Ga0495621_0057250_138_1016 | 283 |
| 649 | 3300046615 | Ga0495656_0005188 | Ga0495656_0005188_818_1696 | 283 |
| 650 | 3300046794 | Ga0495589_0060452 | Ga0495589_0060452_389_1267 | 283 |
| 651 | 3300047318 | Ga0495636_0029986 | Ga0495636_0029986_918_1796 | 283 |
| 652 | 3300048907 | Ga0496104_0242324 | Ga0496104_0242324_68_991 | 283 |
| 653 | 3300048912 | Ga0496109_0147818 | Ga0496109_0147818_24_908 | 283 |
| 654 | 3300048914 | Ga0496111_0106471 | Ga0496111_0106471_939_1862 | 283 |
| 655 | 3300048917 | Ga0496114_0028469 | Ga0496114_0028469_3195_4079 | 283 |
| 656 | 3300048917 | Ga0496114_0095624 | Ga0496114_0095624_206_1129 | 283 |
| 657 | 3300049571 | Ga0501034_0006228 | Ga0501034_0006228_7092_7982 | 283 |
| 658 | 3300049572 | Ga0501036_0007464 | Ga0501036_0007464_5161_6051 | 283 |
| 659 | 3300049573 | Ga0501037_0005067 | Ga0501037_0005067_4986_5876 | 283 |
| 660 | 3300049574 | Ga0501038_0012940 | Ga0501038_0012940_6073_6963 | 283 |
| 661 | 3300049575 | Ga0501039_0113531 | Ga0501039_0113531_359_1249 | 283 |
| 662 | 3300049578 | Ga0501042_0005357 | Ga0501042_0005357_967_1857 | 283 |
| 663 | 3300049579 | Ga0501043_0008609 | Ga0501043_0008609_4680_5570 | 283 |
| 664 | 3300049581 | Ga0501047_0007043 | Ga0501047_0007043_4071_4961 | 283 |
| 665 | 3300049582 | Ga0501048_0000973 | Ga0501048_0000973_2345_3235 | 283 |
| 666 | 3300049589 | Ga0501073_0011797 | Ga0501073_0011797_4503_5393 | 283 |
| 667 | 3300049590 | Ga0501074_0000620 | Ga0501074_0000620_15937_16827 | 283 |
| 668 | 3300049593 | Ga0501077_0070313 | Ga0501077_0070313_353_1267 | 283 |
| 669 | 3300049824 | Ga0501045_0335782 | Ga0501045_0335782_157_1047 | 283 |
| 670 | 3300050507 | nmdc:mga05p37_36027_c1 | nmdc:mga05p37_36027_c1_876_1802 | 283 |
| 671 | 3300050508 | nmdc:mga09592_11966_c1 | nmdc:mga09592_11966_c1_2503_3429 | 283 |
| 672 | 3300050509 | nmdc:mga0qj67_26341_c1 | nmdc:mga0qj67_26341_c1_24_908 | 283 |
| 673 | 3300050510 | nmdc:mga06r32_907_c1 | nmdc:mga06r32_907_c1_18532_19458 | 283 |
| 674 | 3300050511 | nmdc:mga08y16_76756_c1 | nmdc:mga08y16_76756_c1_2240_3166 | 283 |
| 675 | 3300050515 | nmdc:mga0a205_31401_c1 | nmdc:mga0a205_31401_c1_2519_3445 | 283 |
| 676 | iso_pu_bacteria | 2558860280 | 2559425956 | 283 |
| 677 | iso_pu_bacteria | 2917736166 | 2917740515 | 283 |
| 678 | iso_pu_bacteria | 8053945823 | 8053947185 | 283 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
120
312
0.81
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2onk-assembly2.cif.gz_I | abc transporter modbc in complex with its binding protein moda | 0.8724 | 11 | 277 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.8599 | 7 | 271 |
| 2onk-assembly2.cif.gz_I | abc transporter modbc in complex with its binding protein moda | 0.8565 | 11 | 277 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.8562 | 13 | 273 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.8436 | 13 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77156_29_305_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9415 | 14 | 272 | 1.10.3720.10 |
| af_P0AFK4_1_269_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9173 | 17 | 280 | 1.10.3720.10 |
| af_Q2G2B0_2_264_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.911 | 15 | 271 | 1.10.3720.10 |
| af_P0AFK4_1_269_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8978 | 17 | 280 | 1.10.3720.10 |
| af_I6XFF3_60_302_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8926 | 53 | 283 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4T0URA4-F1-model_v4 | ABC transporter permease | 0.9866 | 22 | 283 |
GO:0005886
GO:0055085 |
| AF-A0A4T0URA4-F1-model_v4 | ABC transporter permease | 0.9792 | 22 | 283 |
GO:0005886
GO:0055085 |
| AF-A0A7Y9JBH3-F1-model_v4 | Putative spermidine/putrescine transport system permease protein | 0.9785 | 8 | 283 |
GO:0005886
GO:0055085 |
| AF-A0A286G6K8-F1-model_v4 | Putative spermidine/putrescine transport system permease protein | 0.9784 | 30 | 283 |
GO:0005886
GO:0055085 |
| AF-X5LIP7-F1-model_v4 | deleted | 0.9772 | 12 | 283 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar