F474660

General Info

Members Datasets Scaffolds Average Seq Length
678 318 669 287

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10274055|Ga0307407_102740552
Length 319
Sequence VALAADRTGPPDPRSGGPPPWLSRGAAPDAPTQPGRKLASWLHRHAGVRLAALLSAPMAWLVVAYLGSLAVLLVSSLWTVNSFTGTLIREPTLDNFRTILTEPVYRNVVLRSIGVAAAVTVIDAAIALPMALFMAKVASPRARHWLVIAILTPLWASYLVKAYAWRVMLANGGPIDWLLGGDGHGPGYGLTATVIVLSYLWLPYMILPVFTGLDRLPDSLLEASADLGARAGTTFRTVVVPMVMPSLVAGSIFTFSLSLGDYITVQIVGGRSQLIGNLVYANIGAANNLPFAAALATIPVAIMVGYLLAVRRTGALDQL

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
3 2643221615 Nocardioides sp. Root224 Isolate Unclassified
4 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
5 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
6 2902582711 Micromonospora sp. AP08 Isolate Unclassified
7 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
8 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
9 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
209 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
234 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
238 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
239 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
240 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
241 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
242 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
243 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
244 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
309 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
312 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
318 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.23
Nodule 0
Rhizoplane 11.95
Rhizosphere 78.91
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002434 3300000549 Bacteria 2589
2 JGI24751J29686_10004243 3300002459 Bacteria 2908
3 Ga0070658_10065628 3300005327 Bacteria 2963
4 Ga0070676_10021068 3300005328 Bacteria 3647
5 Ga0070676_10036389 3300005328 Bacteria 2836
6 Ga0070683_100064097 3300005329 Bacteria 3420
7 Ga0070683_100164202 3300005329 Bacteria 2107
8 Ga0070683_100429970 3300005329 Bacteria 1260
9 Ga0070690_100005532 3300005330 Bacteria 7106
10 Ga0070670_100019163 3300005331 Bacteria 5868
11 Ga0068869_100018671 3300005334 Bacteria 4724
12 Ga0070666_10013334 3300005335 Bacteria 5211
13 Ga0070680_100063795 3300005336 Bacteria 3018
14 Ga0070682_100057933 3300005337 Bacteria 2442
15 Ga0068868_100003930 3300005338 Bacteria 10383
16 Ga0068868_100007923 3300005338 Bacteria 7588
17 Ga0068868_100051739 3300005338 Bacteria 3232
18 Ga0068868_100096907 3300005338 Bacteria 2383
19 Ga0068868_100106629 3300005338 Bacteria 2273
20 Ga0068868_100197183 3300005338 Bacteria 1677
21 Ga0068868_100338476 3300005338 Bacteria 1286
22 Ga0070660_100051368 3300005339 Bacteria 3175
23 Ga0070689_100018679 3300005340 Bacteria 5112
24 Ga0070689_100036289 3300005340 Bacteria 3770
25 Ga0070689_100339580 3300005340 Bacteria 1258
26 Ga0070691_10001538 3300005341 Bacteria 9931
27 Ga0070691_10021319 3300005341 Bacteria 2998
28 Ga0070687_100071630 3300005343 Bacteria 1863
29 Ga0070692_10006877 3300005345 Bacteria 4970
30 Ga0070692_10100436 3300005345 Bacteria 1585
31 Ga0070668_100003460 3300005347 Bacteria 11657
32 Ga0070668_100182781 3300005347 Bacteria 1714
33 Ga0070668_100228552 3300005347 Bacteria 1537
34 Ga0070675_100316758 3300005354 Bacteria 1377
35 Ga0070671_100037911 3300005355 Bacteria 3999
36 Ga0070671_100051390 3300005355 Bacteria 3428
37 Ga0070674_100086744 3300005356 Bacteria 2249
38 Ga0070674_100123075 3300005356 Bacteria 1923
39 Ga0070674_100274906 3300005356 Bacteria 1333
40 Ga0070673_100105013 3300005364 Bacteria 2333
41 Ga0070673_100368787 3300005364 Bacteria 1278
42 Ga0070688_100225661 3300005365 Bacteria 1322
43 Ga0070688_100479097 3300005365 Bacteria 935
44 Ga0070659_100033853 3300005366 Bacteria 3972
45 Ga0070659_100062698 3300005366 Bacteria 2939
46 Ga0070667_100490145 3300005367 Bacteria 1126
47 Ga0070714_100025924 3300005435 Bacteria 4842
48 Ga0070713_100003753 3300005436 Bacteria 10050
49 Ga0070701_10016722 3300005438 Bacteria 3417
50 Ga0070705_100021187 3300005440 Bacteria 3453
51 Ga0070705_100119167 3300005440 Bacteria 1701
52 Ga0070705_100123500 3300005440 Bacteria 1676
53 Ga0070700_100168072 3300005441 Bacteria 1516
54 Ga0070694_100248624 3300005444 Bacteria 1344
55 Ga0070663_100002020 3300005455 Bacteria 11335
56 Ga0070663_100010278 3300005455 Bacteria 5830
57 Ga0070678_100022800 3300005456 Bacteria 4158
58 Ga0070678_100316281 3300005456 Bacteria 1332
59 Ga0070662_100007677 3300005457 Bacteria 6998
60 Ga0070662_100136432 3300005457 Bacteria 1897
61 Ga0070681_10035257 3300005458 Bacteria 5026
62 Ga0068867_100001167 3300005459 Bacteria 17965
63 Ga0070685_10117074 3300005466 Bacteria 1650
64 Ga0070706_100156215 3300005467 Bacteria 2129
65 Ga0070707_100070989 3300005468 Bacteria 3354
66 Ga0070698_100001085 3300005471 Bacteria 29891
67 Ga0070698_100019165 3300005471 Bacteria 7192
68 Ga0070698_100252529 3300005471 Bacteria 1696
69 Ga0070699_100203607 3300005518 Bacteria 1760
70 Ga0070684_100021842 3300005535 Bacteria 5332
71 Ga0070684_100026608 3300005535 Bacteria 4874
72 Ga0070684_100557422 3300005535 Bacteria 1064
73 Ga0070697_100190224 3300005536 Bacteria 1742
74 Ga0068853_100252251 3300005539 Bacteria 1619
75 Ga0070686_100010954 3300005544 Bacteria 5133
76 Ga0070686_100034332 3300005544 Bacteria 3125
77 Ga0070695_100082640 3300005545 Bacteria 2127
78 Ga0070696_100012733 3300005546 Bacteria 5648
79 Ga0070696_100103945 3300005546 Bacteria 2039
80 Ga0070696_100154679 3300005546 Bacteria 1686
81 Ga0070665_100134065 3300005548 Bacteria 2478
82 Ga0070665_100476023 3300005548 Bacteria 1259
83 Ga0070704_100041860 3300005549 Bacteria 3165
84 Ga0070704_100219556 3300005549 Bacteria 1545
85 Ga0068855_100046262 3300005563 Bacteria 5145
86 Ga0068855_100229606 3300005563 Bacteria 2079
87 Ga0068855_100422517 3300005563 Bacteria 1458
88 Ga0068855_100426121 3300005563 Bacteria 1451
89 Ga0070664_100037100 3300005564 Bacteria 4095
90 Ga0068857_100288327 3300005577 Bacteria 1511
91 Ga0068854_100033288 3300005578 Bacteria 3592
92 Ga0068854_100109920 3300005578 Bacteria 2078
93 Ga0068854_100242942 3300005578 Bacteria 1435
94 Ga0068856_100079472 3300005614 Bacteria 3252
95 Ga0068856_100195529 3300005614 Bacteria 2036
96 Ga0070702_100100048 3300005615 Bacteria 1776
97 Ga0068852_100030291 3300005616 Bacteria 4453
98 Ga0068852_100039008 3300005616 Bacteria 3996
99 Ga0068864_100082387 3300005618 Bacteria 2823
100 Ga0068864_100194781 3300005618 Bacteria 1859
101 Ga0068864_100314251 3300005618 Bacteria 1470
102 Ga0068866_10021563 3300005718 Bacteria 2970
103 Ga0068861_100067244 3300005719 Bacteria 2765
104 Ga0068861_100123814 3300005719 Bacteria 2089
105 Ga0068861_100147802 3300005719 Bacteria 1925
106 Ga0068851_10019739 3300005834 Bacteria 3258
107 Ga0068870_10035440 3300005840 Bacteria 2560
108 Ga0068863_100009789 3300005841 Bacteria 9344
109 Ga0068863_100018636 3300005841 Bacteria 6641
110 Ga0068863_100041764 3300005841 Bacteria 4360
111 Ga0068863_100267334 3300005841 Bacteria 1654
112 Ga0068863_100514077 3300005841 Bacteria 1180
113 Ga0068858_100073576 3300005842 Bacteria 3172
114 Ga0068858_100212087 3300005842 Bacteria 1833
115 Ga0068860_100026646 3300005843 Bacteria 5573
116 Ga0068860_100030588 3300005843 Bacteria 5178
117 Ga0068860_100053843 3300005843 Bacteria 3825
118 Ga0068862_100063231 3300005844 Bacteria 3185
119 Ga0081455_10003611 3300005937 Bacteria 17731
120 Ga0081455_10025145 3300005937 Bacteria 5501
121 Ga0081455_10038418 3300005937 Bacteria 4240
122 Ga0081538_10075614 3300005981 Bacteria 1826
123 Ga0081540_1012872 3300005983 Bacteria 5471
124 Ga0081540_1016724 3300005983 Bacteria 4573
125 Ga0081540_1063298 3300005983 Bacteria 1751
126 Ga0081539_10001405 3300005985 Bacteria 41451
127 Ga0081539_10009012 3300005985 Bacteria 8478
128 Ga0081539_10011886 3300005985 Bacteria 6801
129 Ga0070717_10044621 3300006028 Bacteria 3621
130 Ga0075365_10003573 3300006038 Bacteria 8041
131 Ga0075365_10050839 3300006038 Bacteria 2735
132 Ga0075365_10117490 3300006038 Bacteria 1832
133 Ga0075365_10120784 3300006038 Bacteria 1807
134 Ga0075365_10150907 3300006038 Bacteria 1616
135 Ga0075363_100001228 3300006048 Bacteria 9491
136 Ga0075363_100111591 3300006048 Bacteria 1520
137 Ga0075364_10007483 3300006051 Bacteria 6489
138 Ga0075364_10100229 3300006051 Bacteria 1928
139 Ga0075364_10129013 3300006051 Bacteria 1696
140 Ga0075364_10337751 3300006051 Bacteria 1026
141 Ga0075432_10030525 3300006058 Bacteria 1862
142 Ga0075362_10005215 3300006177 Bacteria 4738
143 Ga0075362_10059067 3300006177 Bacteria 1731
144 Ga0075362_10116848 3300006177 Bacteria 1260
145 Ga0075367_10025230 3300006178 Bacteria 3360
146 Ga0075367_10051347 3300006178 Bacteria 2437
147 Ga0075367_10213671 3300006178 Bacteria 1206
148 Ga0075366_10058694 3300006195 Bacteria 2286
149 Ga0075370_10034045 3300006353 Bacteria 2855
150 Ga0075370_10077574 3300006353 Bacteria 1906
151 Ga0075370_10109066 3300006353 Bacteria 1606
152 Ga0068871_100114290 3300006358 Bacteria 2274
153 Ga0068871_100114414 3300006358 Bacteria 2273
154 Ga0068871_100128346 3300006358 Bacteria 2148
155 Ga0075428_100052542 3300006844 Bacteria 4465
156 Ga0075428_100080554 3300006844 Bacteria 3553
157 Ga0075430_100247716 3300006846 Bacteria 1476
158 Ga0075431_100000676 3300006847 Bacteria 29173
159 Ga0075431_100033118 3300006847 Bacteria 5326
160 Ga0075431_100125811 3300006847 Bacteria 2644
161 Ga0075431_100287615 3300006847 Bacteria 1663
162 Ga0075433_10070532 3300006852 Bacteria 3071
163 Ga0075434_100001921 3300006871 Bacteria 18017
164 Ga0075434_100049120 3300006871 Bacteria 4188
165 Ga0075429_100002702 3300006880 Bacteria 14953
166 Ga0075429_100286346 3300006880 Bacteria 1443
167 Ga0068865_100053131 3300006881 Bacteria 2811
168 Ga0068865_100076556 3300006881 Bacteria 2388
169 Ga0075436_100000663 3300006914 Bacteria 22664
170 Ga0075435_100002027 3300007076 Bacteria 13255
171 Ga0105240_10526148 3300009093 Bacteria 1311
172 Ga0111539_10022261 3300009094 Bacteria 7790
173 Ga0111539_10103122 3300009094 Bacteria 3348
174 Ga0111539_10168091 3300009094 Bacteria 2563
175 Ga0105245_10017702 3300009098 Bacteria 6220
176 Ga0105245_10221768 3300009098 Bacteria 1825
177 Ga0105245_10285659 3300009098 Bacteria 1614
178 Ga0114129_10170060 3300009147 Bacteria 2972
179 Ga0114129_10227875 3300009147 Bacteria 2511
180 Ga0105243_10010116 3300009148 Bacteria 7177
181 Ga0105243_10085613 3300009148 Bacteria 2584
182 Ga0105243_10164247 3300009148 Bacteria 1917
183 Ga0105243_10212016 3300009148 Bacteria 1706
184 Ga0105243_10266094 3300009148 Bacteria 1537
185 Ga0105243_10517557 3300009148 Bacteria 1134
186 Ga0105241_10028260 3300009174 Bacteria 4179
187 Ga0105242_10059867 3300009176 Bacteria 3126
188 Ga0105242_10127408 3300009176 Bacteria 2193
189 Ga0105248_10025546 3300009177 Bacteria 6567
190 Ga0105248_10031432 3300009177 Bacteria 5934
191 Ga0105248_10116774 3300009177 Bacteria 3009
192 Ga0105248_10154291 3300009177 Bacteria 2591
193 Ga0105248_10195647 3300009177 Bacteria 2278
194 Ga0105237_10054318 3300009545 Bacteria 4014
195 Ga0105237_10436164 3300009545 Bacteria 1316
196 Ga0105237_10768228 3300009545 Bacteria 970
197 Ga0105238_10056206 3300009551 Bacteria 3949
198 Ga0105238_10181967 3300009551 Bacteria 2079
199 Ga0105238_10228852 3300009551 Bacteria 1836
200 Ga0105249_10071356 3300009553 Bacteria 3208
201 Ga0105249_10102728 3300009553 Bacteria 2691
202 Ga0105249_10192783 3300009553 Bacteria 1990
203 Ga0105249_10252993 3300009553 Bacteria 1747
204 Ga0105249_10367840 3300009553 Unclassified 1461
205 Ga0105239_10032152 3300010375 Bacteria 5767
206 Ga0105239_10092943 3300010375 Bacteria 3330
207 Ga0105239_10171522 3300010375 Bacteria 2426
208 Ga0105239_10459591 3300010375 Bacteria 1445
209 Ga0105246_10008187 3300011119 Bacteria 6419
210 Ga0157371_10176500 3300013102 Bacteria 1527
211 Ga0157370_10031765 3300013104 Bacteria 5162
212 Ga0157369_10075291 3300013105 Bacteria 3620
213 Ga0157374_10010504 3300013296 Bacteria 7967
214 Ga0157374_10279034 3300013296 Bacteria 1649
215 Ga0157378_10007665 3300013297 Bacteria 9422
216 Ga0163162_10008544 3300013306 Bacteria 9984
217 Ga0163162_10074333 3300013306 Bacteria 3457
218 Ga0163162_10718608 3300013306 Bacteria 1120
219 Ga0157372_10058270 3300013307 Bacteria 4317
220 Ga0157372_10145615 3300013307 Bacteria 2732
221 Ga0157372_10332913 3300013307 Bacteria 1768
222 Ga0157375_10017673 3300013308 Bacteria 6444
223 Ga0157375_10185620 3300013308 Bacteria 2233
224 Ga0157375_10210860 3300013308 Bacteria 2100
225 Ga0157375_10464673 3300013308 Bacteria 1431
226 Ga0157375_10792477 3300013308 Bacteria 1097
227 Ga0163163_10060007 3300014325 Bacteria 3765
228 Ga0163163_10065583 3300014325 Bacteria 3605
229 Ga0163163_10174065 3300014325 Bacteria 2199
230 Ga0157380_10119787 3300014326 Bacteria 2227
231 Ga0157380_10247065 3300014326 Bacteria 1613
232 Ga0182008_10039488 3300014497 Bacteria 2358
233 Ga0157377_10005400 3300014745 Bacteria 6005
234 Ga0157377_10009619 3300014745 Bacteria 4753
235 Ga0157379_10056354 3300014968 Bacteria 3512
236 Ga0157379_10114027 3300014968 Bacteria 2429
237 Ga0157379_10240244 3300014968 Bacteria 1643
238 Ga0157379_10297725 3300014968 Bacteria 1470
239 Ga0157379_10452663 3300014968 Bacteria 1185
240 Ga0157376_10237808 3300014969 Bacteria 1695
241 Ga0157376_10438211 3300014969 Bacteria 1272
242 Ga0163161_10044339 3300017792 Bacteria 3203
243 Ga0207656_10004547 3300025321 Bacteria 4854
244 Ga0207688_10005360 3300025901 Bacteria 6963
245 Ga0207688_10018631 3300025901 Bacteria 3776
246 Ga0207680_10206000 3300025903 Bacteria 1343
247 Ga0207699_10066241 3300025906 Bacteria 2192
248 Ga0207645_10029478 3300025907 Bacteria 3537
249 Ga0207645_10042479 3300025907 Bacteria 2909
250 Ga0207645_10111585 3300025907 Bacteria 1770
251 Ga0207643_10000117 3300025908 Bacteria 54338
252 Ga0207705_10019086 3300025909 Bacteria 4904
253 Ga0207654_10014770 3300025911 Bacteria 4040
254 Ga0207707_10213441 3300025912 Bacteria 1681
255 Ga0207695_10137665 3300025913 Bacteria 2393
256 Ga0207693_10033341 3300025915 Bacteria 4063
257 Ga0207660_10243717 3300025917 Bacteria 1417
258 Ga0207662_10052216 3300025918 Bacteria 2432
259 Ga0207657_10030915 3300025919 Bacteria 4854
260 Ga0207652_10048958 3300025921 Bacteria 3615
261 Ga0207694_10146703 3300025924 Bacteria 1899
262 Ga0207650_10000493 3300025925 Bacteria 32882
263 Ga0207659_10023592 3300025926 Bacteria 4108
264 Ga0207659_10041269 3300025926 Bacteria 3231
265 Ga0207659_10103230 3300025926 Bacteria 2154
266 Ga0207687_10018266 3300025927 Bacteria 4626
267 Ga0207687_10048371 3300025927 Bacteria 2952
268 Ga0207687_10048752 3300025927 Bacteria 2943
269 Ga0207700_10024192 3300025928 Bacteria 4199
270 Ga0207700_10279956 3300025928 Bacteria 1434
271 Ga0207664_10221539 3300025929 Bacteria 1641
272 Ga0207644_10024057 3300025931 Bacteria 4177
273 Ga0207644_10030397 3300025931 Bacteria 3756
274 Ga0207690_10029835 3300025932 Bacteria 3472
275 Ga0207690_10239279 3300025932 Bacteria 1397
276 Ga0207706_10003126 3300025933 Bacteria 15895
277 Ga0207706_10009698 3300025933 Bacteria 8836
278 Ga0207706_10072389 3300025933 Bacteria 3032
279 Ga0207706_10137202 3300025933 Bacteria 2152
280 Ga0207706_10287047 3300025933 Bacteria 1435
281 Ga0207686_10077183 3300025934 Bacteria 2162
282 Ga0207709_10009069 3300025935 Bacteria 5485
283 Ga0207709_10063853 3300025935 Bacteria 2309
284 Ga0207709_10067848 3300025935 Bacteria 2252
285 Ga0207709_10143913 3300025935 Bacteria 1642
286 Ga0207709_10299897 3300025935 Bacteria 1194
287 Ga0207670_10019642 3300025936 Bacteria 4132
288 Ga0207669_10016656 3300025937 Bacteria 3742
289 Ga0207665_10025133 3300025939 Bacteria 3929
290 Ga0207691_10032484 3300025940 Bacteria 4865
291 Ga0207711_10112825 3300025941 Bacteria 2420
292 Ga0207711_10197339 3300025941 Bacteria 1836
293 Ga0207689_10009422 3300025942 Bacteria 8432
294 Ga0207689_10193688 3300025942 Bacteria 1677
295 Ga0207661_10021598 3300025944 Bacteria 4825
296 Ga0207661_10518664 3300025944 Bacteria 1090
297 Ga0207679_10002230 3300025945 Bacteria 11971
298 Ga0207679_10008645 3300025945 Bacteria 6491
299 Ga0207667_10082423 3300025949 Bacteria 3332
300 Ga0207667_10375243 3300025949 Bacteria 1449
301 Ga0207667_10506536 3300025949 Bacteria 1224
302 Ga0207712_10081619 3300025961 Bacteria 2355
303 Ga0207712_10134629 3300025961 Bacteria 1888
304 Ga0207712_10241055 3300025961 Unclassified 1456
305 Ga0207668_10001892 3300025972 Bacteria 12254
306 Ga0207668_10046396 3300025972 Bacteria 2969
307 Ga0207668_10071674 3300025972 Bacteria 2476
308 Ga0207668_10191064 3300025972 Bacteria 1623
309 Ga0207668_10251689 3300025972 Bacteria 1435
310 Ga0207640_10101431 3300025981 Bacteria 2019
311 Ga0207640_10179125 3300025981 Bacteria 1587
312 Ga0207658_10164721 3300025986 Bacteria 1820
313 Ga0207677_10005764 3300026023 Bacteria 6740
314 Ga0207677_10072877 3300026023 Bacteria 2430
315 Ga0207677_10145613 3300026023 Bacteria 1820
316 Ga0207677_10253965 3300026023 Bacteria 1429
317 Ga0207703_10087530 3300026035 Bacteria 2612
318 Ga0207703_10120589 3300026035 Bacteria 2251
319 Ga0207678_10000391 3300026067 Bacteria 39957
320 Ga0207678_10209134 3300026067 Bacteria 1669
321 Ga0207708_10017312 3300026075 Bacteria 5425
322 Ga0207708_10021321 3300026075 Bacteria 4885
323 Ga0207708_10047309 3300026075 Bacteria 3275
324 Ga0207708_10096740 3300026075 Bacteria 2282
325 Ga0207708_10151342 3300026075 Bacteria 1827
326 Ga0207708_10205977 3300026075 Bacteria 1571
327 Ga0207702_10002078 3300026078 Bacteria 19339
328 Ga0207702_10084488 3300026078 Bacteria 2764
329 Ga0207702_10115268 3300026078 Bacteria 2396
330 Ga0207702_10419071 3300026078 Bacteria 1294
331 Ga0207702_10618807 3300026078 Bacteria 1063
332 Ga0207641_10011671 3300026088 Bacteria 7214
333 Ga0207641_10017730 3300026088 Bacteria 5832
334 Ga0207641_10029839 3300026088 Bacteria 4511
335 Ga0207648_10002699 3300026089 Bacteria 18877
336 Ga0207648_10034388 3300026089 Bacteria 4468
337 Ga0207648_10060948 3300026089 Bacteria 3290
338 Ga0207676_10001839 3300026095 Bacteria 15547
339 Ga0207676_10076495 3300026095 Bacteria 2705
340 Ga0207676_10080092 3300026095 Bacteria 2650
341 Ga0207676_10361718 3300026095 Bacteria 1345
342 Ga0207674_10030133 3300026116 Bacteria 5708
343 Ga0207674_10055380 3300026116 Bacteria 4032
344 Ga0207674_10356367 3300026116 Bacteria 1414
345 Ga0207675_100000686 3300026118 Bacteria 33362
346 Ga0207675_100061350 3300026118 Bacteria 3510
347 Ga0207675_100066810 3300026118 Bacteria 3361
348 Ga0207675_100110177 3300026118 Bacteria 2598
349 Ga0207675_100258016 3300026118 Bacteria 1688
350 Ga0207683_10044178 3300026121 Bacteria 3895
351 Ga0207698_10048649 3300026142 Bacteria 3221
352 Ga0207698_10133262 3300026142 Bacteria 2127
353 Ga0207698_10212024 3300026142 Bacteria 1743
354 Ga0209813_10042107 3300027866 Bacteria 1395
355 Ga0207428_10022628 3300027907 Bacteria 5301
356 Ga0268266_10124063 3300028379 Bacteria 2302
357 Ga0268266_10255450 3300028379 Bacteria 1622
358 Ga0268266_10374409 3300028379 Bacteria 1342
359 Ga0268265_10015214 3300028380 Bacteria 5260
360 Ga0268265_10233863 3300028380 Bacteria 1617
361 Ga0268264_10030952 3300028381 Bacteria 4388
362 Ga0268264_10138905 3300028381 Bacteria 2164
363 Ga0307515_10126220 3300028794 Bacteria 2856
364 Ga0307511_10001274 3300030521 Bacteria 26705
365 Ga0307513_10025522 3300031456 Bacteria 6842
366 Ga0307509_10019348 3300031507 Bacteria 7768
367 Ga0307408_100059051 3300031548 Bacteria 2791
368 Ga0307508_10001935 3300031616 Bacteria 22718
369 Ga0316576_10307938 3300031727 Bacteria 1183
370 Ga0307413_10191722 3300031824 Bacteria 1468
371 Ga0307413_10283746 3300031824 Bacteria 1247
372 Ga0307518_10000241 3300031838 Bacteria 41161
373 Ga0307410_10056268 3300031852 Bacteria 2674
374 Ga0326468_10000083 3300031889 Bacteria 8124
375 Ga0307406_10039433 3300031901 Bacteria 2930
376 Ga0307406_10123415 3300031901 Bacteria 1805
377 Ga0307406_10191399 3300031901 Bacteria 1498
378 Ga0307406_10217854 3300031901 Bacteria 1417
379 Ga0307406_10218021 3300031901 Bacteria 1416
380 Ga0307407_10026838 3300031903 Bacteria 3056
381 Ga0307407_10042103 3300031903 Bacteria 2558
382 Ga0307407_10079625 3300031903 Bacteria 1977
383 Ga0307407_10274055 3300031903 Bacteria 1166
384 Ga0307409_100001479 3300031995 Bacteria 11588
385 Ga0307409_100047500 3300031995 Bacteria 3259
386 Ga0307416_100010065 3300032002 Bacteria 6227
387 Ga0307416_100029855 3300032002 Bacteria 4081
388 Ga0307416_100076442 3300032002 Bacteria 2806
389 Ga0307416_100250724 3300032002 Bacteria 1723
390 Ga0307416_100427702 3300032002 Bacteria 1370
391 Ga0307416_100436073 3300032002 Bacteria 1359
392 Ga0307411_10280456 3300032005 Bacteria 1326
393 Ga0307415_100000049 3300032126 Bacteria 51581
394 Ga0307415_100057980 3300032126 Bacteria 2664
395 Ga0307415_100076829 3300032126 Bacteria 2369
396 Ga0307507_10056762 3300033179 Bacteria 3696
397 Ga0316574_0094024 3300035398 Bacteria 1914
398 Ga0373931_0181162 3300035691 Bacteria 1248
399 Ga0373935_0018731 3300035692 Bacteria 4217
400 Ga0373935_0166156 3300035692 Bacteria 1507
401 Ga0373947_0168992 3300035725 Bacteria 1418
402 Ga0395899_0007240 3300037312 Bacteria 8589
403 Ga0395899_0017405 3300037312 Bacteria 5475
404 Ga0395899_0030723 3300037312 Bacteria 4039
405 Ga0395900_0022618 3300037418 Bacteria 6433
406 Ga0395900_0144622 3300037418 Bacteria 2432
407 Ga0395900_0196035 3300037418 Bacteria 2046
408 Ga0395900_0209837 3300037418 Bacteria 1967
409 Ga0395898_0014756 3300037466 Bacteria 8020
410 Ga0395898_0163142 3300037466 Bacteria 2131
411 Ga0395898_0827038 3300037466 Bacteria 866
412 Ga0395905_0046823 3300037471 Bacteria 4055
413 Ga0395905_0312292 3300037471 Bacteria 1460
414 Ga0395901_0026456 3300038443 Bacteria 5956
415 Ga0395901_0271572 3300038443 Bacteria 1763
416 Ga0439463_011559 3300042016 Bacteria 2167
417 Ga0439463_033195 3300042016 Bacteria 1305
418 Ga0450902_003876 3300042137 Bacteria 2209
419 Ga0451577_0002607 3300042876 Bacteria 21201
420 Ga0466969_0040154 3300044656 Bacteria 2345
421 Ga0466972_0096218 3300044658 Bacteria 1402
422 Ga0453683_0122589 3300044673 Bacteria 1637
423 Ga0466965_0013666 3300044683 Bacteria 3833
424 Ga0466966_0001252 3300044684 Bacteria 16267
425 Ga0466961_0018128 3300044693 Bacteria 4527
426 Ga0466961_0052418 3300044693 Bacteria 2603
427 Ga0466963_0016775 3300044694 Bacteria 4558
428 Ga0466963_0028854 3300044694 Bacteria 3566
429 Ga0466963_0208105 3300044694 Bacteria 1369
430 Ga0466964_0002836 3300044706 Bacteria 6246
431 Ga0453684_0003257 3300044712 Bacteria 37095
432 Ga0466970_0008269 3300044765 Bacteria 5230
433 Ga0466970_0083549 3300044765 Bacteria 1728
434 Ga0466970_0095488 3300044765 Bacteria 1616
435 Ga0466970_0258849 3300044765 Bacteria 976
436 Ga0466957_0029745 3300044842 Bacteria 3258
437 Ga0466960_0004512 3300044901 Bacteria 5453
438 Ga0466960_0009790 3300044901 Bacteria 3963
439 Ga0466960_0015885 3300044901 Bacteria 3254
440 Ga0466960_0273099 3300044901 Bacteria 945
441 Ga0466960_0325747 3300044901 Bacteria 871
442 Ga0466959_0002606 3300045049 Bacteria 11578
443 Ga0451576_0039926 3300045051 Bacteria 4968
444 Ga0466958_0122084 3300045836 Bacteria 1631
445 Ga0466967_0017731 3300045976 Bacteria 5664
446 Ga0466967_0096872 3300045976 Bacteria 2692
447 Ga0466967_0482288 3300045976 Bacteria 1215
448 Ga0495638_0105041 3300046460 Bacteria 1684
449 Ga0495582_0033736 3300046473 Bacteria 2815
450 Ga0495605_0079009 3300046474 Bacteria 1541
451 Ga0495584_0045248 3300046491 Bacteria 2220
452 Ga0495585_0039507 3300046492 Bacteria 2652
453 Ga0495594_0014519 3300046499 Bacteria 4129
454 Ga0495596_0068695 3300046500 Bacteria 1377
455 Ga0495607_0070044 3300046501 Bacteria 1961
456 Ga0495616_0121646 3300046513 Bacteria 1204
457 Ga0495616_0135421 3300046513 Bacteria 1126
458 Ga0495630_0094582 3300046517 Bacteria 2259
459 Ga0495637_0028030 3300046520 Bacteria 2517
460 Ga0495663_0015948 3300046525 Bacteria 2122
461 Ga0495598_0089171 3300046537 Bacteria 1003
462 Ga0495621_0057250 3300046539 Bacteria 1407
463 Ga0495633_0075409 3300046558 Bacteria 1571
464 Ga0495656_0005188 3300046615 Bacteria 4492
465 Ga0495656_0021113 3300046615 Bacteria 2532
466 Ga0495611_0018526 3300046648 Bacteria 2986
467 Ga0495661_0063313 3300046665 Bacteria 2187
468 Ga0495670_0044141 3300046691 Bacteria 2225
469 Ga0495671_0094168 3300046692 Bacteria 1466
470 Ga0495589_0060452 3300046794 Bacteria 1861
471 Ga0495589_0082299 3300046794 Bacteria 1565
472 Ga0495581_0168235 3300047315 Bacteria 1282
473 Ga0495636_0029986 3300047318 Bacteria 2222
474 Ga0495672_0004033 3300047320 Bacteria 12274
475 Ga0495685_056398 3300047447 Bacteria 1328
476 Ga0496100_0003941 3300048903 Bacteria 7803
477 Ga0496100_0043703 3300048903 Bacteria 2867
478 Ga0496100_0086907 3300048903 Bacteria 2125
479 Ga0496100_0302111 3300048903 Bacteria 1198
480 Ga0496100_0370141 3300048903 Bacteria 1086
481 Ga0496101_0021327 3300048904 Bacteria 4451
482 Ga0496101_0024796 3300048904 Bacteria 4156
483 Ga0496101_0138707 3300048904 Bacteria 1852
484 Ga0496102_0004051 3300048905 Bacteria 12422
485 Ga0496102_0041815 3300048905 Bacteria 4152
486 Ga0496102_0045548 3300048905 Bacteria 3983
487 Ga0496102_0083069 3300048905 Bacteria 2955
488 Ga0496102_0255359 3300048905 Bacteria 1653
489 Ga0496102_0395761 3300048905 Unclassified 1299
490 Ga0496102_0406138 3300048905 Bacteria 1280
491 Ga0496104_0003502 3300048907 Bacteria 13540
492 Ga0496104_0031749 3300048907 Bacteria 4913
493 Ga0496104_0170589 3300048907 Bacteria 2086
494 Ga0496104_0242324 3300048907 Bacteria 1715
495 Ga0496104_0301932 3300048907 Bacteria 1513
496 Ga0496105_0003442 3300048908 Bacteria 11724
497 Ga0496105_0005173 3300048908 Bacteria 9892
498 Ga0496105_0025991 3300048908 Bacteria 4771
499 Ga0496105_0078002 3300048908 Bacteria 2735
500 Ga0496105_0310370 3300048908 Bacteria 1266
501 Ga0496106_0001302 3300048909 Bacteria 18735
502 Ga0496106_0006553 3300048909 Bacteria 8623
503 Ga0496106_0009225 3300048909 Bacteria 7288
504 Ga0496106_0097240 3300048909 Bacteria 2279
505 Ga0496107_0005994 3300048910 Bacteria 8332
506 Ga0496107_0013612 3300048910 Bacteria 5686
507 Ga0496107_0036116 3300048910 Bacteria 3544
508 Ga0496107_0079858 3300048910 Bacteria 2385
509 Ga0496107_0156697 3300048910 Bacteria 1686
510 Ga0496108_0000343 3300048911 Bacteria 39300
511 Ga0496108_0000996 3300048911 Bacteria 22097
512 Ga0496108_0001459 3300048911 Bacteria 18696
513 Ga0496108_0004061 3300048911 Bacteria 11743
514 Ga0496108_0040566 3300048911 Bacteria 3881
515 Ga0496108_0536443 3300048911 Bacteria 1021
516 Ga0496109_0008631 3300048912 Bacteria 8674
517 Ga0496109_0017442 3300048912 Bacteria 6294
518 Ga0496109_0022341 3300048912 Bacteria 5602
519 Ga0496109_0075581 3300048912 Bacteria 3097
520 Ga0496109_0090052 3300048912 Bacteria 2837
521 Ga0496109_0147818 3300048912 Bacteria 2199
522 Ga0496109_0151843 3300048912 Bacteria 2168
523 Ga0496109_0304077 3300048912 Unclassified 1504
524 Ga0496109_0350217 3300048912 Bacteria 1395
525 Ga0496110_0012203 3300048913 Bacteria 7059
526 Ga0496110_0043863 3300048913 Bacteria 3904
527 Ga0496110_0476106 3300048913 Bacteria 1137
528 Ga0496111_0002132 3300048914 Bacteria 11826
529 Ga0496111_0005798 3300048914 Bacteria 7966
530 Ga0496111_0014423 3300048914 Bacteria 5397
531 Ga0496111_0042423 3300048914 Bacteria 3266
532 Ga0496111_0083852 3300048914 Bacteria 2329
533 Ga0496111_0106471 3300048914 Bacteria 2064
534 Ga0496111_0172904 3300048914 Bacteria 1605
535 Ga0496112_0000886 3300048915 Bacteria 21512
536 Ga0496112_0023403 3300048915 Bacteria 5903
537 Ga0496112_0033527 3300048915 Bacteria 4993
538 Ga0496112_0113005 3300048915 Bacteria 2686
539 Ga0496112_0237615 3300048915 Bacteria 1775
540 Ga0496112_0560969 3300048915 Bacteria 1075
541 Ga0496113_0001514 3300048916 Bacteria 13025
542 Ga0496113_0012183 3300048916 Bacteria 5772
543 Ga0496113_0028509 3300048916 Bacteria 4016
544 Ga0496113_0030191 3300048916 Bacteria 3921
545 Ga0496113_0240011 3300048916 Unclassified 1446
546 Ga0496113_0386753 3300048916 Bacteria 1123
547 Ga0496114_0007060 3300048917 Bacteria 8861
548 Ga0496114_0011372 3300048917 Bacteria 7109
549 Ga0496114_0019559 3300048917 Bacteria 5487
550 Ga0496114_0028469 3300048917 Bacteria 4586
551 Ga0496114_0040332 3300048917 Bacteria 3865
552 Ga0496114_0095624 3300048917 Bacteria 2528
553 Ga0496114_0150743 3300048917 Bacteria 2017
554 Ga0496114_0177344 3300048917 Bacteria 1860
555 Ga0496114_0350062 3300048917 Bacteria 1306
556 Ga0496115_0123310 3300048918 Bacteria 2133
557 Ga0501032_0193512 3300049569 Bacteria 1329
558 Ga0501034_0006228 3300049571 Bacteria 12842
559 Ga0501036_0007464 3300049572 Bacteria 8912
560 Ga0501036_0205127 3300049572 Bacteria 1657
561 Ga0501037_0005067 3300049573 Bacteria 9586
562 Ga0501038_0012940 3300049574 Bacteria 7611
563 Ga0501038_0081095 3300049574 Bacteria 2734
564 Ga0501039_0030912 3300049575 Bacteria 4129
565 Ga0501039_0067700 3300049575 Bacteria 2773
566 Ga0501039_0113531 3300049575 Bacteria 2119
567 Ga0501040_0034607 3300049576 Bacteria 3422
568 Ga0501040_0043681 3300049576 Bacteria 3056
569 Ga0501041_0064861 3300049577 Bacteria 2237
570 Ga0501042_0005357 3300049578 Bacteria 8251
571 Ga0501042_0126635 3300049578 Bacteria 1839
572 Ga0501043_0008609 3300049579 Bacteria 8041
573 Ga0501046_0037033 3300049580 Bacteria 3922
574 Ga0501047_0007043 3300049581 Bacteria 10556
575 Ga0501048_0000973 3300049582 Bacteria 21220
576 Ga0501048_0007742 3300049582 Bacteria 8143
577 Ga0501067_0002098 3300049583 Bacteria 10978
578 Ga0501067_0027021 3300049583 Bacteria 3179
579 Ga0501069_0000952 3300049585 Bacteria 13786
580 Ga0501069_0050230 3300049585 Bacteria 2319
581 Ga0501070_0000730 3300049586 Bacteria 30031
582 Ga0501070_0051044 3300049586 Bacteria 3433
583 Ga0501070_0128324 3300049586 Bacteria 2096
584 Ga0501070_0160242 3300049586 Bacteria 1855
585 Ga0501070_0324077 3300049586 Bacteria 1253
586 Ga0501071_0043166 3300049587 Bacteria 3232
587 Ga0501071_0234859 3300049587 Bacteria 1382
588 Ga0501072_0134239 3300049588 Bacteria 1973
589 Ga0501072_0169203 3300049588 Bacteria 1744
590 Ga0501073_0011797 3300049589 Bacteria 6379
591 Ga0501073_0240117 3300049589 Bacteria 1251
592 Ga0501074_0000620 3300049590 Bacteria 22112
593 Ga0501074_0044051 3300049590 Bacteria 3231
594 Ga0501074_0138667 3300049590 Bacteria 1740
595 Ga0501074_0213348 3300049590 Bacteria 1375
596 Ga0501074_0271837 3300049590 Bacteria 1205
597 Ga0501075_0017442 3300049591 Bacteria 5187
598 Ga0501075_0133287 3300049591 Bacteria 1893
599 Ga0501076_0014733 3300049592 Bacteria 5894
600 Ga0501076_0041834 3300049592 Bacteria 3607
601 Ga0501076_0169418 3300049592 Bacteria 1780
602 Ga0501077_0046778 3300049593 Bacteria 2749
603 Ga0501077_0070313 3300049593 Bacteria 2218
604 Ga0501077_0310412 3300049593 Bacteria 1005
605 Ga0501079_0151215 3300049741 Bacteria 1810
606 Ga0501035_0030660 3300049822 Bacteria 4902
607 Ga0501045_0066622 3300049824 Bacteria 2644
608 Ga0501045_0335782 3300049824 Bacteria 1125
609 nmdc:mga03683_111319_c1 3300050489 Bacteria 1211
610 nmdc:mga03683_149090_c1 3300050489 Bacteria 1055
611 nmdc:mga03n38_16734_c1 3300050490 Bacteria 2859
612 nmdc:mga00v17_136514_c1 3300050491 Bacteria 1571
613 nmdc:mga00v17_137894_c1 3300050491 Bacteria 1563
614 nmdc:mga00v17_26837_c1 3300050491 Bacteria 3359
615 nmdc:mga00v17_40173_c1 3300050491 Bacteria 2806
616 nmdc:mga00v17_55728_c1 3300050491 Bacteria 2415
617 nmdc:mga0yw44_138019_c1 3300050492 Bacteria 1583
618 nmdc:mga0yw44_29693_c1 3300050492 Bacteria 3159
619 nmdc:mga0yw44_3355_c1 3300050492 Bacteria 7098
620 nmdc:mga0yw44_479452_c1 3300050492 Bacteria 844
621 nmdc:mga0yw44_7135_c1 3300050492 Bacteria 5472
622 nmdc:mga0yw44_77146_c1 3300050492 Bacteria 2081
623 nmdc:mga0yw44_92733_c1 3300050492 Bacteria 1912
624 nmdc:mga0k408_189958_c1 3300050493 Bacteria 1225
625 nmdc:mga06z11_135356_c1 3300050494 Bacteria 1388
626 nmdc:mga06z11_54334_c1 3300050494 Bacteria 2064
627 nmdc:mga06z11_85314_c1 3300050494 Bacteria 1703
628 nmdc:mga06z11_91144_c1 3300050494 Bacteria 1655
629 nmdc:mga07m45_16382_c1 3300050496 Bacteria 3969
630 nmdc:mga07m45_18953_c1 3300050496 Bacteria 3724
631 nmdc:mga07m45_82522_c1 3300050496 Bacteria 1836
632 nmdc:mga05p37_126130_c1 3300050507 Bacteria 3143
633 nmdc:mga05p37_294352_c1 3300050507 Bacteria 1931
634 nmdc:mga05p37_36027_c1 3300050507 Bacteria 6071
635 nmdc:mga05p37_520953_c1 3300050507 Bacteria 1360
636 nmdc:mga09592_102883_c1 3300050508 Bacteria 2447
637 nmdc:mga09592_11966_c1 3300050508 Bacteria 7058
638 nmdc:mga0qj67_26341_c1 3300050509 Bacteria 4501
639 nmdc:mga0qj67_341163_c1 3300050509 Bacteria 1212
640 nmdc:mga06r32_4332_c1 3300050510 Bacteria 12706
641 nmdc:mga06r32_556321_c1 3300050510 Bacteria 1121
642 nmdc:mga06r32_574960_c1 3300050510 Bacteria 1099
643 nmdc:mga06r32_727691_c1 3300050510 Bacteria 956
644 nmdc:mga06r32_907_c1 3300050510 Bacteria 26417
645 nmdc:mga08y16_19899_c1 3300050511 Bacteria 7080
646 nmdc:mga08y16_65779_c1 3300050511 Bacteria 3784
647 nmdc:mga08y16_76756_c1 3300050511 Bacteria 3483
648 nmdc:mga0n895_10411_c1 3300050512 Bacteria 8212
649 nmdc:mga0n895_47538_c1 3300050512 Bacteria 4195
650 nmdc:mga08x19_135541_c1 3300050514 Bacteria 1659
651 nmdc:mga08x19_261359_c1 3300050514 Bacteria 1197
652 nmdc:mga0a205_31401_c1 3300050515 Bacteria 5088
653 nmdc:mga0a205_58720_c1 3300050515 Bacteria 3716
654 nmdc:mga0sz30_6672_c1 3300050516 Bacteria 4300
655 Ga0495655_0003785 3300053083 Bacteria 2530
656 Ga0495619_0008871 3300053085 Bacteria 6356
657 Ga0500644_0000090 3300053088 Bacteria 56710
658 Ga0500556_0106594 3300053104 Bacteria 1084
659 Ga0500616_0014387 3300053153 Bacteria 4547
660 Ga0501084_0026872 3300054114 Bacteria 4808
661 Ga0501084_0090625 3300054114 Bacteria 2567
662 Ga0501082_0025248 3300060353 Bacteria 5120
663 Ga0466962_0009384 3300061719 Bacteria 4690
664 Ga0530510_0043046 3300061734 Bacteria 3261
665 Ga0530510_0048500 3300061734 Bacteria 3070
666 Ga0530510_0064905 3300061734 Bacteria 2645
667 Ga0530510_0206564 3300061734 Bacteria 1459
668 Ga0530510_0297615 3300061734 Bacteria 1207
669 Ga0530510_0468966 3300061734 Bacteria 953

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10154291 Ga0105248_101542913 235
2 3300014325 Ga0163163_10174065 Ga0163163_101740652 235
3 3300014968 Ga0157379_10114027 Ga0157379_101140273 235
4 3300048908 Ga0496105_0025991 Ga0496105_0025991_2781_3575 235
5 3300048911 Ga0496108_0004061 Ga0496108_0004061_8010_8804 235
6 3300048912 Ga0496109_0008631 Ga0496109_0008631_6008_6802 235
7 3300048914 Ga0496111_0005798 Ga0496111_0005798_1957_2751 235
8 3300048915 Ga0496112_0237615 Ga0496112_0237615_434_1228 235
9 3300048916 Ga0496113_0028509 Ga0496113_0028509_2958_3752 235
10 3300049576 Ga0501040_0043681 Ga0501040_0043681_80_877 239
11 3300061734 Ga0530510_0297615 Ga0530510_0297615_249_1163 239
12 3300025926 Ga0207659_10103230 Ga0207659_101032302 245
13 3300031903 Ga0307407_10079625 Ga0307407_100796252 248
14 3300049586 Ga0501070_0000730 Ga0501070_0000730_28341_29264 251
15 3300009094 Ga0111539_10168091 Ga0111539_101680912 252
16 3300031824 Ga0307413_10191722 Ga0307413_101917221 252
17 3300044694 Ga0466963_0208105 Ga0466963_0208105_434_1351 252
18 3300061734 Ga0530510_0048500 Ga0530510_0048500_1999_2937 252
19 3300045976 Ga0466967_0096872 Ga0466967_0096872_1208_2065 253
20 3300048915 Ga0496112_0113005 Ga0496112_0113005_18_902 253
21 3300005330 Ga0070690_100005532 Ga0070690_1000055322 254
22 3300005338 Ga0068868_100338476 Ga0068868_1003384761 254
23 3300005340 Ga0070689_100036289 Ga0070689_1000362894 254
24 3300005340 Ga0070689_100339580 Ga0070689_1003395802 254
25 3300005356 Ga0070674_100086744 Ga0070674_1000867443 254
26 3300005365 Ga0070688_100479097 Ga0070688_1004790971 254
27 3300005367 Ga0070667_100490145 Ga0070667_1004901451 254
28 3300005459 Ga0068867_100001167 Ga0068867_1000011674 254
29 3300005544 Ga0070686_100010954 Ga0070686_1000109543 254
30 3300005719 Ga0068861_100067244 Ga0068861_1000672442 254
31 3300005841 Ga0068863_100041764 Ga0068863_1000417644 254
32 3300005842 Ga0068858_100212087 Ga0068858_1002120872 254
33 3300005844 Ga0068862_100063231 Ga0068862_1000632312 254
34 3300006881 Ga0068865_100076556 Ga0068865_1000765562 254
35 3300009098 Ga0105245_10221768 Ga0105245_102217682 254
36 3300009148 Ga0105243_10010116 Ga0105243_100101163 254
37 3300009177 Ga0105248_10031432 Ga0105248_100314322 254
38 3300009553 Ga0105249_10102728 Ga0105249_101027282 254
39 3300013297 Ga0157378_10007665 Ga0157378_100076654 254
40 3300013308 Ga0157375_10792477 Ga0157375_107924772 254
41 3300014968 Ga0157379_10056354 Ga0157379_100563543 254
42 3300014969 Ga0157376_10237808 Ga0157376_102378082 254
43 3300025907 Ga0207645_10111585 Ga0207645_101115852 254
44 3300025927 Ga0207687_10048752 Ga0207687_100487523 254
45 3300025935 Ga0207709_10009069 Ga0207709_100090692 254
46 3300025936 Ga0207670_10019642 Ga0207670_100196424 254
47 3300025937 Ga0207669_10016656 Ga0207669_100166562 254
48 3300025941 Ga0207711_10112825 Ga0207711_101128252 254
49 3300025986 Ga0207658_10164721 Ga0207658_101647212 254
50 3300026023 Ga0207677_10253965 Ga0207677_102539652 254
51 3300026075 Ga0207708_10021321 Ga0207708_100213214 254
52 3300026088 Ga0207641_10029839 Ga0207641_100298395 254
53 3300026089 Ga0207648_10002699 Ga0207648_1000269916 254
54 3300026116 Ga0207674_10055380 Ga0207674_100553802 254
55 3300026118 Ga0207675_100066810 Ga0207675_1000668103 254
56 3300032126 Ga0307415_100057980 Ga0307415_1000579803 254
57 3300048903 Ga0496100_0086907 Ga0496100_0086907_555_1322 254
58 3300048905 Ga0496102_0255359 Ga0496102_0255359_772_1539 254
59 3300048907 Ga0496104_0031749 Ga0496104_0031749_2983_3750 254
60 3300048908 Ga0496105_0005173 Ga0496105_0005173_2807_3574 254
61 3300048909 Ga0496106_0006553 Ga0496106_0006553_6414_7181 254
62 3300048910 Ga0496107_0036116 Ga0496107_0036116_648_1415 254
63 3300048914 Ga0496111_0083852 Ga0496111_0083852_45_812 254
64 3300048917 Ga0496114_0011372 Ga0496114_0011372_19_786 254
65 3300050510 nmdc:mga06r32_727691_c1 nmdc:mga06r32_727691_c1_49_909 254
66 3300005329 Ga0070683_100164202 Ga0070683_1001642023 255
67 3300005471 Ga0070698_100019165 Ga0070698_1000191652 255
68 3300005563 Ga0068855_100422517 Ga0068855_1004225172 255
69 3300005841 Ga0068863_100009789 Ga0068863_1000097892 255
70 3300009177 Ga0105248_10116774 Ga0105248_101167744 255
71 3300014325 Ga0163163_10060007 Ga0163163_100600073 255
72 3300025906 Ga0207699_10066241 Ga0207699_100662412 255
73 3300025928 Ga0207700_10279956 Ga0207700_102799562 255
74 3300025939 Ga0207665_10025133 Ga0207665_100251333 255
75 3300025941 Ga0207711_10197339 Ga0207711_101973392 255
76 3300026088 Ga0207641_10017730 Ga0207641_100177305 255
77 3300026095 Ga0207676_10080092 Ga0207676_100800923 255
78 3300026095 Ga0207676_10361718 Ga0207676_103617182 255
79 3300028379 Ga0268266_10124063 Ga0268266_101240632 255
80 3300028381 Ga0268264_10138905 Ga0268264_101389052 255
81 3300037312 Ga0395899_0030723 Ga0395899_0030723_3134_3901 255
82 3300048915 Ga0496112_0023403 Ga0496112_0023403_197_1105 255
83 3300005616 Ga0068852_100039008 Ga0068852_1000390082 256
84 3300009551 Ga0105238_10056206 Ga0105238_100562063 256
85 3300025924 Ga0207694_10146703 Ga0207694_101467032 256
86 3300025972 Ga0207668_10251689 Ga0207668_102516892 256
87 3300026142 Ga0207698_10212024 Ga0207698_102120241 256
88 3300037312 Ga0395899_0017405 Ga0395899_0017405_2495_3409 256
89 3300049577 Ga0501041_0064861 Ga0501041_0064861_458_1420 256
90 3300049590 Ga0501074_0213348 Ga0501074_0213348_493_1359 256
91 3300049591 Ga0501075_0133287 Ga0501075_0133287_431_1393 256
92 3300049824 Ga0501045_0066622 Ga0501045_0066622_1124_2086 256
93 3300061734 Ga0530510_0064905 Ga0530510_0064905_1035_1997 256
94 3300010375 Ga0105239_10092943 Ga0105239_100929433 258
95 3300037466 Ga0395898_0827038 Ga0395898_0827038_78_854 258
96 3300046474 Ga0495605_0079009 Ga0495605_0079009_338_1234 258
97 3300046492 Ga0495585_0039507 Ga0495585_0039507_1259_2155 258
98 3300046500 Ga0495596_0068695 Ga0495596_0068695_445_1341 258
99 3300046513 Ga0495616_0135421 Ga0495616_0135421_213_1109 258
100 3300046520 Ga0495637_0028030 Ga0495637_0028030_1336_2232 258
101 3300046525 Ga0495663_0015948 Ga0495663_0015948_286_1182 258
102 3300046558 Ga0495633_0075409 Ga0495633_0075409_286_1182 258
103 3300046615 Ga0495656_0021113 Ga0495656_0021113_589_1485 258
104 3300046648 Ga0495611_0018526 Ga0495611_0018526_1265_2161 258
105 3300046665 Ga0495661_0063313 Ga0495661_0063313_627_1523 258
106 3300046691 Ga0495670_0044141 Ga0495670_0044141_610_1506 258
107 3300046692 Ga0495671_0094168 Ga0495671_0094168_481_1377 258
108 3300046794 Ga0495589_0082299 Ga0495589_0082299_199_1095 258
109 3300047447 Ga0495685_056398 Ga0495685_056398_41_937 258
110 3300049586 Ga0501070_0051044 Ga0501070_0051044_2019_2795 258
111 3300006847 Ga0075431_100125811 Ga0075431_1001258113 259
112 3300028379 Ga0268266_10374409 Ga0268266_103744092 259
113 3300047320 Ga0495672_0004033 Ga0495672_0004033_9670_10533 259
114 iso_pu_bacteria 2643221615 2644089777 259
115 iso_pu_bacteria 2643221657 2644319622 259
116 3300005338 Ga0068868_100051739 Ga0068868_1000517393 260
117 3300005338 Ga0068868_100197183 Ga0068868_1001971832 261
118 3300005981 Ga0081538_10075614 Ga0081538_100756142 261
119 3300005983 Ga0081540_1016724 Ga0081540_10167244 261
120 3300009176 Ga0105242_10059867 Ga0105242_100598672 261
121 3300009177 Ga0105248_10195647 Ga0105248_101956472 261
122 3300009551 Ga0105238_10228852 Ga0105238_102288521 261
123 3300013308 Ga0157375_10210860 Ga0157375_102108602 261
124 3300014325 Ga0163163_10065583 Ga0163163_100655832 261
125 3300026023 Ga0207677_10145613 Ga0207677_101456132 261
126 3300026067 Ga0207678_10209134 Ga0207678_102091342 261
127 3300031507 Ga0307509_10019348 Ga0307509_100193482 261
128 3300048905 Ga0496102_0083069 Ga0496102_0083069_1856_2722 261
129 3300048908 Ga0496105_0078002 Ga0496105_0078002_658_1524 261
130 3300048910 Ga0496107_0079858 Ga0496107_0079858_986_1852 261
131 3300048911 Ga0496108_0040566 Ga0496108_0040566_2062_2928 261
132 3300048912 Ga0496109_0151843 Ga0496109_0151843_1082_1948 261
133 3300048913 Ga0496110_0043863 Ga0496110_0043863_1734_2600 261
134 3300048914 Ga0496111_0014423 Ga0496111_0014423_2966_3832 261
135 3300048915 Ga0496112_0033527 Ga0496112_0033527_1798_2664 261
136 3300048916 Ga0496113_0012183 Ga0496113_0012183_660_1526 261
137 3300030521 Ga0307511_10001274 Ga0307511_1000127420 262
138 3300031616 Ga0307508_10001935 Ga0307508_100019358 262
139 3300035692 Ga0373935_0166156 Ga0373935_0166156_43_837 262
140 3300042016 Ga0439463_033195 Ga0439463_033195_459_1250 262
141 3300044765 Ga0466970_0258849 Ga0466970_0258849_59_847 262
142 3300046517 Ga0495630_0094582 Ga0495630_0094582_1334_2128 262
143 3300048915 Ga0496112_0560969 Ga0496112_0560969_48_839 262
144 3300005444 Ga0070694_100248624 Ga0070694_1002486242 263
145 3300005618 Ga0068864_100314251 Ga0068864_1003142512 263
146 3300005937 Ga0081455_10038418 Ga0081455_100384182 263
147 3300006051 Ga0075364_10337751 Ga0075364_103377511 263
148 3300006177 Ga0075362_10059067 Ga0075362_100590672 263
149 3300006177 Ga0075362_10116848 Ga0075362_101168482 263
150 3300006178 Ga0075367_10025230 Ga0075367_100252302 263
151 3300006178 Ga0075367_10213671 Ga0075367_102136712 263
152 3300006353 Ga0075370_10109066 Ga0075370_101090662 263
153 3300028380 Ga0268265_10233863 Ga0268265_102338632 263
154 3300031903 Ga0307407_10042103 Ga0307407_100421032 263
155 3300032002 Ga0307416_100010065 Ga0307416_1000100652 263
156 3300037418 Ga0395900_0209837 Ga0395900_0209837_572_1363 263
157 3300044765 Ga0466970_0095488 Ga0466970_0095488_600_1391 263
158 3300044901 Ga0466960_0273099 Ga0466960_0273099_14_808 263
159 3300045976 Ga0466967_0482288 Ga0466967_0482288_14_805 263
160 3300048917 Ga0496114_0040332 Ga0496114_0040332_779_1570 263
161 3300049575 Ga0501039_0067700 Ga0501039_0067700_294_1085 263
162 3300049586 Ga0501070_0324077 Ga0501070_0324077_84_875 263
163 3300049589 Ga0501073_0240117 Ga0501073_0240117_208_999 263
164 3300049590 Ga0501074_0138667 Ga0501074_0138667_626_1417 263
165 3300050489 nmdc:mga03683_111319_c1 nmdc:mga03683_111319_c1_378_1169 263
166 3300050490 nmdc:mga03n38_16734_c1 nmdc:mga03n38_16734_c1_1868_2659 263
167 3300050491 nmdc:mga00v17_136514_c1 nmdc:mga00v17_136514_c1_716_1507 263
168 3300050491 nmdc:mga00v17_137894_c1 nmdc:mga00v17_137894_c1_231_1022 263
169 3300050491 nmdc:mga00v17_26837_c1 nmdc:mga00v17_26837_c1_2274_3065 263
170 3300050491 nmdc:mga00v17_55728_c1 nmdc:mga00v17_55728_c1_1482_2273 263
171 3300050492 nmdc:mga0yw44_138019_c1 nmdc:mga0yw44_138019_c1_464_1255 263
172 3300050492 nmdc:mga0yw44_29693_c1 nmdc:mga0yw44_29693_c1_1712_2503 263
173 3300050492 nmdc:mga0yw44_479452_c1 nmdc:mga0yw44_479452_c1_31_822 263
174 3300050492 nmdc:mga0yw44_77146_c1 nmdc:mga0yw44_77146_c1_941_1732 263
175 3300050492 nmdc:mga0yw44_92733_c1 nmdc:mga0yw44_92733_c1_716_1507 263
176 3300050494 nmdc:mga06z11_135356_c1 nmdc:mga06z11_135356_c1_425_1216 263
177 3300050494 nmdc:mga06z11_85314_c1 nmdc:mga06z11_85314_c1_733_1524 263
178 3300050494 nmdc:mga06z11_91144_c1 nmdc:mga06z11_91144_c1_714_1505 263
179 3300050496 nmdc:mga07m45_16382_c1 nmdc:mga07m45_16382_c1_2742_3533 263
180 3300050496 nmdc:mga07m45_18953_c1 nmdc:mga07m45_18953_c1_2585_3376 263
181 3300053083 Ga0495655_0003785 Ga0495655_0003785_309_1100 263
182 3300053088 Ga0500644_0000090 Ga0500644_0000090_26476_27267 263
183 3300053104 Ga0500556_0106594 Ga0500556_0106594_209_1030 263
184 3300054114 Ga0501084_0090625 Ga0501084_0090625_1058_1849 263
185 3300031901 Ga0307406_10191399 Ga0307406_101913992 264
186 3300032002 Ga0307416_100436073 Ga0307416_1004360732 264
187 3300032126 Ga0307415_100076829 Ga0307415_1000768292 264
188 3300049575 Ga0501039_0030912 Ga0501039_0030912_3145_4107 264
189 3300049587 Ga0501071_0043166 Ga0501071_0043166_1966_2862 264
190 3300049587 Ga0501071_0234859 Ga0501071_0234859_46_1008 264
191 3300049590 Ga0501074_0271837 Ga0501074_0271837_118_1014 264
192 3300049592 Ga0501076_0041834 Ga0501076_0041834_1519_2415 264
193 3300049593 Ga0501077_0310412 Ga0501077_0310412_43_909 264
194 3300049741 Ga0501079_0151215 Ga0501079_0151215_203_1099 264
195 3300061734 Ga0530510_0468966 Ga0530510_0468966_16_909 264
196 3300009148 Ga0105243_10212016 Ga0105243_102120162 265
197 3300014326 Ga0157380_10119787 Ga0157380_101197872 265
198 3300025942 Ga0207689_10193688 Ga0207689_101936881 265
199 3300046460 Ga0495638_0105041 Ga0495638_0105041_697_1605 265
200 3300050489 nmdc:mga03683_149090_c1 nmdc:mga03683_149090_c1_49_849 265
201 3300050491 nmdc:mga00v17_40173_c1 nmdc:mga00v17_40173_c1_737_1537 265
202 3300050492 nmdc:mga0yw44_7135_c1 nmdc:mga0yw44_7135_c1_1842_2642 265
203 3300050493 nmdc:mga0k408_189958_c1 nmdc:mga0k408_189958_c1_52_852 265
204 3300050494 nmdc:mga06z11_54334_c1 nmdc:mga06z11_54334_c1_299_1099 265
205 3300053153 Ga0500616_0014387 Ga0500616_0014387_344_1252 265
206 3300005329 Ga0070683_100429970 Ga0070683_1004299701 266
207 3300028794 Ga0307515_10126220 Ga0307515_101262203 266
208 3300049569 Ga0501032_0193512 Ga0501032_0193512_400_1293 266
209 3300049572 Ga0501036_0205127 Ga0501036_0205127_94_987 266
210 3300049574 Ga0501038_0081095 Ga0501038_0081095_1413_2306 266
211 3300049576 Ga0501040_0034607 Ga0501040_0034607_168_1061 266
212 3300049578 Ga0501042_0126635 Ga0501042_0126635_89_982 266
213 3300049580 Ga0501046_0037033 Ga0501046_0037033_2945_3838 266
214 3300049582 Ga0501048_0007742 Ga0501048_0007742_5489_6382 266
215 3300049586 Ga0501070_0128324 Ga0501070_0128324_1132_2025 266
216 3300049588 Ga0501072_0134239 Ga0501072_0134239_173_1066 266
217 3300049590 Ga0501074_0044051 Ga0501074_0044051_1027_1920 266
218 3300049591 Ga0501075_0017442 Ga0501075_0017442_2224_3117 266
219 3300049592 Ga0501076_0014733 Ga0501076_0014733_2965_3858 266
220 3300049593 Ga0501077_0046778 Ga0501077_0046778_437_1330 266
221 3300049822 Ga0501035_0030660 Ga0501035_0030660_1958_2851 266
222 3300054114 Ga0501084_0026872 Ga0501084_0026872_1940_2833 266
223 3300060353 Ga0501082_0025248 Ga0501082_0025248_1494_2387 266
224 3300061734 Ga0530510_0206564 Ga0530510_0206564_288_1181 266
225 3300005341 Ga0070691_10021319 Ga0070691_100213193 267
226 3300005563 Ga0068855_100046262 Ga0068855_1000462623 267
227 3300005937 Ga0081455_10025145 Ga0081455_100251455 267
228 3300009176 Ga0105242_10127408 Ga0105242_101274082 267
229 3300013102 Ga0157371_10176500 Ga0157371_101765002 267
230 3300013307 Ga0157372_10058270 Ga0157372_100582703 267
231 3300025933 Ga0207706_10072389 Ga0207706_100723893 267
232 3300025949 Ga0207667_10082423 Ga0207667_100824232 267
233 3300042016 Ga0439463_011559 Ga0439463_011559_932_1810 267
234 3300031727 Ga0316576_10307938 Ga0316576_103079382 269
235 3300033179 Ga0307507_10056762 Ga0307507_100567622 269
236 3300035398 Ga0316574_0094024 Ga0316574_0094024_60_869 269
237 3300042876 Ga0451577_0002607 Ga0451577_0002607_8110_9039 269
238 3300044712 Ga0453684_0003257 Ga0453684_0003257_1145_2074 269
239 3300037418 Ga0395900_0196035 Ga0395900_0196035_31_843 270
240 3300031903 Ga0307407_10026838 Ga0307407_100268382 271
241 3300031995 Ga0307409_100047500 Ga0307409_1000475003 271
242 3300032002 Ga0307416_100029855 Ga0307416_1000298553 271
243 3300049583 Ga0501067_0027021 Ga0501067_0027021_2291_3106 271
244 3300049585 Ga0501069_0050230 Ga0501069_0050230_1309_2124 271
245 3300049588 Ga0501072_0169203 Ga0501072_0169203_178_993 271
246 3300049592 Ga0501076_0169418 Ga0501076_0169418_857_1672 271
247 3300005983 Ga0081540_1012872 Ga0081540_10128723 273
248 3300044683 Ga0466965_0013666 Ga0466965_0013666_1151_1999 273
249 3300044901 Ga0466960_0015885 Ga0466960_0015885_1411_2259 273
250 3300046473 Ga0495582_0033736 Ga0495582_0033736_852_1673 273
251 3300009147 Ga0114129_10170060 Ga0114129_101700603 274
252 3300050507 nmdc:mga05p37_126130_c1 nmdc:mga05p37_126130_c1_406_1320 274
253 3300005327 Ga0070658_10065628 Ga0070658_100656283 276
254 3300005338 Ga0068868_100106629 Ga0068868_1001066293 276
255 3300005339 Ga0070660_100051368 Ga0070660_1000513682 276
256 3300005455 Ga0070663_100002020 Ga0070663_1000020204 276
257 3300005563 Ga0068855_100229606 Ga0068855_1002296062 276
258 3300005719 Ga0068861_100123814 Ga0068861_1001238142 276
259 3300005843 Ga0068860_100053843 Ga0068860_1000538433 276
260 3300009553 Ga0105249_10071356 Ga0105249_100713562 276
261 3300013308 Ga0157375_10464673 Ga0157375_104646732 276
262 3300025919 Ga0207657_10030915 Ga0207657_100309153 276
263 3300025932 Ga0207690_10239279 Ga0207690_102392792 276
264 3300025949 Ga0207667_10506536 Ga0207667_105065362 276
265 3300026067 Ga0207678_10000391 Ga0207678_1000039120 276
266 3300026118 Ga0207675_100061350 Ga0207675_1000613504 276
267 3300028381 Ga0268264_10030952 Ga0268264_100309523 276
268 3300044658 Ga0466972_0096218 Ga0466972_0096218_199_1038 276
269 3300005578 Ga0068854_100242942 Ga0068854_1002429422 277
270 3300005618 Ga0068864_100194781 Ga0068864_1001947812 277
271 3300006038 Ga0075365_10003573 Ga0075365_100035733 277
272 3300006051 Ga0075364_10007483 Ga0075364_100074833 277
273 3300006177 Ga0075362_10005215 Ga0075362_100052153 277
274 3300006178 Ga0075367_10051347 Ga0075367_100513473 277
275 3300006195 Ga0075366_10058694 Ga0075366_100586943 277
276 3300006353 Ga0075370_10077574 Ga0075370_100775742 277
277 3300006358 Ga0068871_100114290 Ga0068871_1001142902 277
278 3300014968 Ga0157379_10452663 Ga0157379_104526632 277
279 3300026035 Ga0207703_10087530 Ga0207703_100875302 277
280 3300026078 Ga0207702_10618807 Ga0207702_106188071 277
281 3300027866 Ga0209813_10042107 Ga0209813_100421072 277
282 3300048911 Ga0496108_0000343 Ga0496108_0000343_22777_23616 277
283 3300048912 Ga0496109_0350217 Ga0496109_0350217_275_1159 277
284 3300048917 Ga0496114_0019559 Ga0496114_0019559_1465_2355 277
285 3300048917 Ga0496114_0177344 Ga0496114_0177344_232_1116 277
286 3300050516 nmdc:mga0sz30_6672_c1 nmdc:mga0sz30_6672_c1_2835_3710 277
287 3300005356 Ga0070674_100123075 Ga0070674_1001230752 278
288 3300005841 Ga0068863_100514077 Ga0068863_1005140772 278
289 3300006358 Ga0068871_100114414 Ga0068871_1001144142 278
290 3300009553 Ga0105249_10192783 Ga0105249_101927832 278
291 3300013308 Ga0157375_10017673 Ga0157375_100176736 278
292 3300017792 Ga0163161_10044339 Ga0163161_100443392 278
293 3300025935 Ga0207709_10063853 Ga0207709_100638532 278
294 3300025972 Ga0207668_10191064 Ga0207668_101910642 278
295 3300031901 Ga0307406_10123415 Ga0307406_101234152 279
296 iso_pu_bacteria 2751185782 2753268881 279
297 3300005355 Ga0070671_100037911 Ga0070671_1000379112 280
298 3300005440 Ga0070705_100021187 Ga0070705_1000211873 280
299 3300005440 Ga0070705_100119167 Ga0070705_1001191672 280
300 3300005467 Ga0070706_100156215 Ga0070706_1001562152 280
301 3300005468 Ga0070707_100070989 Ga0070707_1000709892 280
302 3300005471 Ga0070698_100001085 Ga0070698_10000108516 280
303 3300005471 Ga0070698_100252529 Ga0070698_1002525292 280
304 3300005518 Ga0070699_100203607 Ga0070699_1002036071 280
305 3300005536 Ga0070697_100190224 Ga0070697_1001902242 280
306 3300005545 Ga0070695_100082640 Ga0070695_1000826402 280
307 3300005546 Ga0070696_100012733 Ga0070696_1000127336 280
308 3300005546 Ga0070696_100103945 Ga0070696_1001039452 280
309 3300005578 Ga0068854_100109920 Ga0068854_1001099202 280
310 3300005614 Ga0068856_100195529 Ga0068856_1001955292 280
311 3300006048 Ga0075363_100111591 Ga0075363_1001115912 280
312 3300006051 Ga0075364_10129013 Ga0075364_101290132 280
313 3300006846 Ga0075430_100247716 Ga0075430_1002477161 280
314 3300006847 Ga0075431_100000676 Ga0075431_10000067612 280
315 3300006871 Ga0075434_100049120 Ga0075434_1000491202 280
316 3300009148 Ga0105243_10266094 Ga0105243_102660942 280
317 3300009553 Ga0105249_10367840 Ga0105249_103678402 280
318 3300010375 Ga0105239_10171522 Ga0105239_101715221 280
319 3300014968 Ga0157379_10240244 Ga0157379_102402441 280
320 3300014969 Ga0157376_10438211 Ga0157376_104382111 280
321 3300025917 Ga0207660_10243717 Ga0207660_102437172 280
322 3300025931 Ga0207644_10030397 Ga0207644_100303972 280
323 3300025933 Ga0207706_10137202 Ga0207706_101372022 280
324 3300025935 Ga0207709_10299897 Ga0207709_102998972 280
325 3300025961 Ga0207712_10241055 Ga0207712_102410552 280
326 3300025981 Ga0207640_10101431 Ga0207640_101014312 280
327 3300026078 Ga0207702_10084488 Ga0207702_100844883 280
328 3300037312 Ga0395899_0007240 Ga0395899_0007240_5410_6306 280
329 3300037418 Ga0395900_0022618 Ga0395900_0022618_534_1430 280
330 3300037418 Ga0395900_0144622 Ga0395900_0144622_654_1562 280
331 3300037466 Ga0395898_0014756 Ga0395898_0014756_6513_7421 280
332 3300037466 Ga0395898_0163142 Ga0395898_0163142_1183_2079 280
333 3300037471 Ga0395905_0046823 Ga0395905_0046823_14_922 280
334 3300037471 Ga0395905_0312292 Ga0395905_0312292_512_1408 280
335 3300038443 Ga0395901_0026456 Ga0395901_0026456_57_953 280
336 3300038443 Ga0395901_0271572 Ga0395901_0271572_395_1303 280
337 3300044673 Ga0453683_0122589 Ga0453683_0122589_66_962 280
338 3300044901 Ga0466960_0004512 Ga0466960_0004512_3811_4653 280
339 3300045051 Ga0451576_0039926 Ga0451576_0039926_2975_3871 280
340 3300046537 Ga0495598_0089171 Ga0495598_0089171_71_967 280
341 3300048903 Ga0496100_0043703 Ga0496100_0043703_984_1880 280
342 3300048904 Ga0496101_0024796 Ga0496101_0024796_628_1524 280
343 3300048905 Ga0496102_0041815 Ga0496102_0041815_1664_2560 280
344 3300048905 Ga0496102_0395761 Ga0496102_0395761_208_1062 280
345 3300048907 Ga0496104_0003502 Ga0496104_0003502_7219_8115 280
346 3300048907 Ga0496104_0301932 Ga0496104_0301932_192_1046 280
347 3300048908 Ga0496105_0003442 Ga0496105_0003442_10100_10996 280
348 3300048908 Ga0496105_0310370 Ga0496105_0310370_203_1057 280
349 3300048909 Ga0496106_0009225 Ga0496106_0009225_2524_3420 280
350 3300048910 Ga0496107_0005994 Ga0496107_0005994_5328_6224 280
351 3300048911 Ga0496108_0000996 Ga0496108_0000996_4538_5434 280
352 3300048911 Ga0496108_0536443 Ga0496108_0536443_141_995 280
353 3300048912 Ga0496109_0022341 Ga0496109_0022341_3866_4762 280
354 3300048912 Ga0496109_0075581 Ga0496109_0075581_1950_2804 280
355 3300048912 Ga0496109_0304077 Ga0496109_0304077_614_1468 280
356 3300048913 Ga0496110_0012203 Ga0496110_0012203_3866_4762 280
357 3300048914 Ga0496111_0002132 Ga0496111_0002132_6608_7504 280
358 3300048914 Ga0496111_0172904 Ga0496111_0172904_381_1235 280
359 3300048915 Ga0496112_0000886 Ga0496112_0000886_10434_11330 280
360 3300048916 Ga0496113_0001514 Ga0496113_0001514_7592_8488 280
361 3300048916 Ga0496113_0240011 Ga0496113_0240011_222_1076 280
362 3300048916 Ga0496113_0386753 Ga0496113_0386753_210_1064 280
363 3300048917 Ga0496114_0150743 Ga0496114_0150743_188_1084 280
364 3300048917 Ga0496114_0350062 Ga0496114_0350062_202_1056 280
365 3300049583 Ga0501067_0002098 Ga0501067_0002098_5400_6296 280
366 3300049585 Ga0501069_0000952 Ga0501069_0000952_2836_3732 280
367 3300049586 Ga0501070_0160242 Ga0501070_0160242_297_1193 280
368 3300050509 nmdc:mga0qj67_341163_c1 nmdc:mga0qj67_341163_c1_176_1102 280
369 3300050510 nmdc:mga06r32_4332_c1 nmdc:mga06r32_4332_c1_7713_8639 280
370 3300050512 nmdc:mga0n895_47538_c1 nmdc:mga0n895_47538_c1_202_1098 280
371 3300050514 nmdc:mga08x19_135541_c1 nmdc:mga08x19_135541_c1_287_1183 280
372 3300061734 Ga0530510_0043046 Ga0530510_0043046_942_1838 280
373 3300005328 Ga0070676_10021068 Ga0070676_100210683 281
374 3300005329 Ga0070683_100064097 Ga0070683_1000640972 281
375 3300005338 Ga0068868_100003930 Ga0068868_1000039305 281
376 3300005343 Ga0070687_100071630 Ga0070687_1000716302 281
377 3300005345 Ga0070692_10100436 Ga0070692_101004362 281
378 3300005347 Ga0070668_100003460 Ga0070668_10000346012 281
379 3300005347 Ga0070668_100228552 Ga0070668_1002285522 281
380 3300005364 Ga0070673_100368787 Ga0070673_1003687872 281
381 3300005366 Ga0070659_100033853 Ga0070659_1000338533 281
382 3300005456 Ga0070678_100316281 Ga0070678_1003162812 281
383 3300005457 Ga0070662_100007677 Ga0070662_1000076777 281
384 3300005535 Ga0070684_100021842 Ga0070684_1000218424 281
385 3300005535 Ga0070684_100026608 Ga0070684_1000266087 281
386 3300005548 Ga0070665_100476023 Ga0070665_1004760232 281
387 3300005564 Ga0070664_100037100 Ga0070664_1000371003 281
388 3300005577 Ga0068857_100288327 Ga0068857_1002883272 281
389 3300005616 Ga0068852_100030291 Ga0068852_1000302914 281
390 3300005618 Ga0068864_100082387 Ga0068864_1000823872 281
391 3300005719 Ga0068861_100147802 Ga0068861_1001478022 281
392 3300005842 Ga0068858_100073576 Ga0068858_1000735762 281
393 3300005843 Ga0068860_100030588 Ga0068860_1000305882 281
394 3300005985 Ga0081539_10011886 Ga0081539_100118869 281
395 3300006844 Ga0075428_100052542 Ga0075428_1000525424 281
396 3300009094 Ga0111539_10022261 Ga0111539_100222614 281
397 3300009098 Ga0105245_10017702 Ga0105245_100177027 281
398 3300009147 Ga0114129_10227875 Ga0114129_102278752 281
399 3300009545 Ga0105237_10436164 Ga0105237_104361642 281
400 3300009545 Ga0105237_10768228 Ga0105237_107682281 281
401 3300010375 Ga0105239_10032152 Ga0105239_100321525 281
402 3300013306 Ga0163162_10718608 Ga0163162_107186082 281
403 3300014326 Ga0157380_10247065 Ga0157380_102470652 281
404 3300014745 Ga0157377_10009619 Ga0157377_100096194 281
405 3300025907 Ga0207645_10042479 Ga0207645_100424792 281
406 3300025918 Ga0207662_10052216 Ga0207662_100522163 281
407 3300025926 Ga0207659_10041269 Ga0207659_100412692 281
408 3300025927 Ga0207687_10018266 Ga0207687_100182664 281
409 3300025932 Ga0207690_10029835 Ga0207690_100298352 281
410 3300025933 Ga0207706_10009698 Ga0207706_100096987 281
411 3300025944 Ga0207661_10021598 Ga0207661_100215983 281
412 3300025944 Ga0207661_10518664 Ga0207661_105186642 281
413 3300025945 Ga0207679_10008645 Ga0207679_100086455 281
414 3300025972 Ga0207668_10001892 Ga0207668_1000189212 281
415 3300025972 Ga0207668_10071674 Ga0207668_100716743 281
416 3300026035 Ga0207703_10120589 Ga0207703_101205892 281
417 3300026075 Ga0207708_10151342 Ga0207708_101513422 281
418 3300026095 Ga0207676_10076495 Ga0207676_100764952 281
419 3300026116 Ga0207674_10030133 Ga0207674_100301335 281
420 3300026116 Ga0207674_10356367 Ga0207674_103563672 281
421 3300026118 Ga0207675_100110177 Ga0207675_1001101772 281
422 3300026142 Ga0207698_10048649 Ga0207698_100486493 281
423 3300028380 Ga0268265_10015214 Ga0268265_100152144 281
424 3300031548 Ga0307408_100059051 Ga0307408_1000590513 281
425 3300031824 Ga0307413_10283746 Ga0307413_102837462 281
426 3300031852 Ga0307410_10056268 Ga0307410_100562683 281
427 3300031889 Ga0326468_10000083 Ga0326468_100000833 281
428 3300031901 Ga0307406_10039433 Ga0307406_100394332 281
429 3300031901 Ga0307406_10217854 Ga0307406_102178541 281
430 3300031903 Ga0307407_10274055 Ga0307407_102740552 281
431 3300031995 Ga0307409_100001479 Ga0307409_1000014796 281
432 3300032002 Ga0307416_100076442 Ga0307416_1000764421 281
433 3300032126 Ga0307415_100000049 Ga0307415_10000004911 281
434 3300035692 Ga0373935_0018731 Ga0373935_0018731_2590_3471 281
435 3300044656 Ga0466969_0040154 Ga0466969_0040154_360_1256 281
436 3300044684 Ga0466966_0001252 Ga0466966_0001252_9948_10844 281
437 3300044693 Ga0466961_0018128 Ga0466961_0018128_2941_3840 281
438 3300044765 Ga0466970_0008269 Ga0466970_0008269_3284_4183 281
439 3300045049 Ga0466959_0002606 Ga0466959_0002606_1573_2469 281
440 3300046499 Ga0495594_0014519 Ga0495594_0014519_48_953 281
441 3300047315 Ga0495581_0168235 Ga0495581_0168235_30_935 281
442 3300050507 nmdc:mga05p37_294352_c1 nmdc:mga05p37_294352_c1_749_1645 281
443 3300050510 nmdc:mga06r32_574960_c1 nmdc:mga06r32_574960_c1_120_1016 281
444 3300050511 nmdc:mga08y16_65779_c1 nmdc:mga08y16_65779_c1_2480_3400 281
445 3300053085 Ga0495619_0008871 Ga0495619_0008871_1905_2819 281
446 iso_pu_bacteria 2622736626 2623587338 281
447 iso_pu_bacteria 2902582711 2902587876 281
448 iso_pu_bacteria 2996221748 2996226491 281
449 3300002459 JGI24751J29686_10004243 JGI24751J29686_100042433 282
450 3300005328 Ga0070676_10036389 Ga0070676_100363893 282
451 3300005331 Ga0070670_100019163 Ga0070670_1000191632 282
452 3300005334 Ga0068869_100018671 Ga0068869_1000186712 282
453 3300005335 Ga0070666_10013334 Ga0070666_100133342 282
454 3300005336 Ga0070680_100063795 Ga0070680_1000637953 282
455 3300005337 Ga0070682_100057933 Ga0070682_1000579332 282
456 3300005338 Ga0068868_100007923 Ga0068868_1000079233 282
457 3300005338 Ga0068868_100096907 Ga0068868_1000969072 282
458 3300005340 Ga0070689_100018679 Ga0070689_1000186795 282
459 3300005341 Ga0070691_10001538 Ga0070691_100015385 282
460 3300005345 Ga0070692_10006877 Ga0070692_100068773 282
461 3300005347 Ga0070668_100182781 Ga0070668_1001827812 282
462 3300005354 Ga0070675_100316758 Ga0070675_1003167582 282
463 3300005355 Ga0070671_100051390 Ga0070671_1000513902 282
464 3300005356 Ga0070674_100274906 Ga0070674_1002749062 282
465 3300005364 Ga0070673_100105013 Ga0070673_1001050132 282
466 3300005365 Ga0070688_100225661 Ga0070688_1002256612 282
467 3300005366 Ga0070659_100062698 Ga0070659_1000626983 282
468 3300005435 Ga0070714_100025924 Ga0070714_1000259244 282
469 3300005436 Ga0070713_100003753 Ga0070713_1000037539 282
470 3300005438 Ga0070701_10016722 Ga0070701_100167223 282
471 3300005440 Ga0070705_100123500 Ga0070705_1001235002 282
472 3300005455 Ga0070663_100010278 Ga0070663_1000102782 282
473 3300005456 Ga0070678_100022800 Ga0070678_1000228004 282
474 3300005458 Ga0070681_10035257 Ga0070681_100352574 282
475 3300005466 Ga0070685_10117074 Ga0070685_101170742 282
476 3300005535 Ga0070684_100557422 Ga0070684_1005574222 282
477 3300005539 Ga0068853_100252251 Ga0068853_1002522512 282
478 3300005544 Ga0070686_100034332 Ga0070686_1000343322 282
479 3300005546 Ga0070696_100154679 Ga0070696_1001546792 282
480 3300005548 Ga0070665_100134065 Ga0070665_1001340653 282
481 3300005549 Ga0070704_100041860 Ga0070704_1000418602 282
482 3300005549 Ga0070704_100219556 Ga0070704_1002195562 282
483 3300005563 Ga0068855_100426121 Ga0068855_1004261212 282
484 3300005578 Ga0068854_100033288 Ga0068854_1000332884 282
485 3300005614 Ga0068856_100079472 Ga0068856_1000794721 282
486 3300005615 Ga0070702_100100048 Ga0070702_1001000481 282
487 3300005718 Ga0068866_10021563 Ga0068866_100215633 282
488 3300005834 Ga0068851_10019739 Ga0068851_100197392 282
489 3300005840 Ga0068870_10035440 Ga0068870_100354402 282
490 3300005841 Ga0068863_100018636 Ga0068863_1000186366 282
491 3300005841 Ga0068863_100267334 Ga0068863_1002673342 282
492 3300005843 Ga0068860_100026646 Ga0068860_1000266463 282
493 3300005983 Ga0081540_1063298 Ga0081540_10632981 282
494 3300006028 Ga0070717_10044621 Ga0070717_100446212 282
495 3300006038 Ga0075365_10050839 Ga0075365_100508392 282
496 3300006038 Ga0075365_10117490 Ga0075365_101174902 282
497 3300006038 Ga0075365_10120784 Ga0075365_101207842 282
498 3300006038 Ga0075365_10150907 Ga0075365_101509072 282
499 3300006048 Ga0075363_100001228 Ga0075363_1000012287 282
500 3300006051 Ga0075364_10100229 Ga0075364_101002292 282
501 3300006058 Ga0075432_10030525 Ga0075432_100305252 282
502 3300006353 Ga0075370_10034045 Ga0075370_100340453 282
503 3300006358 Ga0068871_100128346 Ga0068871_1001283461 282
504 3300006844 Ga0075428_100080554 Ga0075428_1000805544 282
505 3300006847 Ga0075431_100287615 Ga0075431_1002876152 282
506 3300006852 Ga0075433_10070532 Ga0075433_100705323 282
507 3300006871 Ga0075434_100001921 Ga0075434_10000192120 282
508 3300006880 Ga0075429_100286346 Ga0075429_1002863462 282
509 3300006881 Ga0068865_100053131 Ga0068865_1000531312 282
510 3300006914 Ga0075436_100000663 Ga0075436_10000066320 282
511 3300007076 Ga0075435_100002027 Ga0075435_1000020275 282
512 3300009093 Ga0105240_10526148 Ga0105240_105261482 282
513 3300009094 Ga0111539_10103122 Ga0111539_101031221 282
514 3300009098 Ga0105245_10285659 Ga0105245_102856592 282
515 3300009148 Ga0105243_10164247 Ga0105243_101642472 282
516 3300009148 Ga0105243_10517557 Ga0105243_105175572 282
517 3300009174 Ga0105241_10028260 Ga0105241_100282601 282
518 3300009177 Ga0105248_10025546 Ga0105248_100255463 282
519 3300009545 Ga0105237_10054318 Ga0105237_100543183 282
520 3300009551 Ga0105238_10181967 Ga0105238_101819672 282
521 3300009553 Ga0105249_10252993 Ga0105249_102529932 282
522 3300010375 Ga0105239_10459591 Ga0105239_104595911 282
523 3300011119 Ga0105246_10008187 Ga0105246_100081875 282
524 3300013104 Ga0157370_10031765 Ga0157370_100317656 282
525 3300013296 Ga0157374_10010504 Ga0157374_100105042 282
526 3300013296 Ga0157374_10279034 Ga0157374_102790342 282
527 3300013306 Ga0163162_10074333 Ga0163162_100743331 282
528 3300013307 Ga0157372_10332913 Ga0157372_103329132 282
529 3300013308 Ga0157375_10185620 Ga0157375_101856203 282
530 3300014497 Ga0182008_10039488 Ga0182008_100394883 282
531 3300014745 Ga0157377_10005400 Ga0157377_100054002 282
532 3300014968 Ga0157379_10297725 Ga0157379_102977252 282
533 3300025321 Ga0207656_10004547 Ga0207656_100045475 282
534 3300025901 Ga0207688_10005360 Ga0207688_100053606 282
535 3300025901 Ga0207688_10018631 Ga0207688_100186313 282
536 3300025903 Ga0207680_10206000 Ga0207680_102060002 282
537 3300025907 Ga0207645_10029478 Ga0207645_100294783 282
538 3300025908 Ga0207643_10000117 Ga0207643_1000011746 282
539 3300025909 Ga0207705_10019086 Ga0207705_100190861 282
540 3300025911 Ga0207654_10014770 Ga0207654_100147702 282
541 3300025912 Ga0207707_10213441 Ga0207707_102134412 282
542 3300025913 Ga0207695_10137665 Ga0207695_101376652 282
543 3300025915 Ga0207693_10033341 Ga0207693_100333414 282
544 3300025921 Ga0207652_10048958 Ga0207652_100489582 282
545 3300025925 Ga0207650_10000493 Ga0207650_100004932 282
546 3300025926 Ga0207659_10023592 Ga0207659_100235923 282
547 3300025927 Ga0207687_10048371 Ga0207687_100483713 282
548 3300025928 Ga0207700_10024192 Ga0207700_100241921 282
549 3300025929 Ga0207664_10221539 Ga0207664_102215392 282
550 3300025931 Ga0207644_10024057 Ga0207644_100240571 282
551 3300025933 Ga0207706_10287047 Ga0207706_102870472 282
552 3300025934 Ga0207686_10077183 Ga0207686_100771832 282
553 3300025935 Ga0207709_10067848 Ga0207709_100678482 282
554 3300025935 Ga0207709_10143913 Ga0207709_101439132 282
555 3300025940 Ga0207691_10032484 Ga0207691_100324846 282
556 3300025942 Ga0207689_10009422 Ga0207689_100094225 282
557 3300025945 Ga0207679_10002230 Ga0207679_1000223010 282
558 3300025949 Ga0207667_10375243 Ga0207667_103752432 282
559 3300025961 Ga0207712_10134629 Ga0207712_101346292 282
560 3300025972 Ga0207668_10046396 Ga0207668_100463962 282
561 3300025981 Ga0207640_10179125 Ga0207640_101791252 282
562 3300026023 Ga0207677_10005764 Ga0207677_100057642 282
563 3300026023 Ga0207677_10072877 Ga0207677_100728772 282
564 3300026075 Ga0207708_10017312 Ga0207708_100173123 282
565 3300026075 Ga0207708_10096740 Ga0207708_100967403 282
566 3300026075 Ga0207708_10205977 Ga0207708_102059772 282
567 3300026078 Ga0207702_10002078 Ga0207702_100020786 282
568 3300026078 Ga0207702_10115268 Ga0207702_101152682 282
569 3300026088 Ga0207641_10011671 Ga0207641_100116716 282
570 3300026089 Ga0207648_10034388 Ga0207648_100343884 282
571 3300026089 Ga0207648_10060948 Ga0207648_100609483 282
572 3300026095 Ga0207676_10001839 Ga0207676_1000183913 282
573 3300026118 Ga0207675_100258016 Ga0207675_1002580161 282
574 3300026121 Ga0207683_10044178 Ga0207683_100441783 282
575 3300028379 Ga0268266_10255450 Ga0268266_102554501 282
576 3300035691 Ga0373931_0181162 Ga0373931_0181162_136_993 282
577 3300035725 Ga0373947_0168992 Ga0373947_0168992_520_1377 282
578 3300042137 Ga0450902_003876 Ga0450902_003876_1315_2193 282
579 3300044693 Ga0466961_0052418 Ga0466961_0052418_1642_2490 282
580 3300044694 Ga0466963_0028854 Ga0466963_0028854_1229_2077 282
581 3300044706 Ga0466964_0002836 Ga0466964_0002836_4160_5008 282
582 3300044842 Ga0466957_0029745 Ga0466957_0029745_1712_2560 282
583 3300044901 Ga0466960_0009790 Ga0466960_0009790_1358_2206 282
584 3300044901 Ga0466960_0325747 Ga0466960_0325747_10_858 282
585 3300045836 Ga0466958_0122084 Ga0466958_0122084_216_1064 282
586 3300045976 Ga0466967_0017731 Ga0466967_0017731_316_1164 282
587 3300048903 Ga0496100_0003941 Ga0496100_0003941_796_1698 282
588 3300048903 Ga0496100_0302111 Ga0496100_0302111_235_1179 282
589 3300048903 Ga0496100_0370141 Ga0496100_0370141_183_1049 282
590 3300048904 Ga0496101_0021327 Ga0496101_0021327_652_1554 282
591 3300048904 Ga0496101_0138707 Ga0496101_0138707_152_1030 282
592 3300048905 Ga0496102_0004051 Ga0496102_0004051_4988_5890 282
593 3300048905 Ga0496102_0045548 Ga0496102_0045548_13_891 282
594 3300048905 Ga0496102_0406138 Ga0496102_0406138_348_1214 282
595 3300048907 Ga0496104_0170589 Ga0496104_0170589_1111_1989 282
596 3300048909 Ga0496106_0001302 Ga0496106_0001302_3162_4064 282
597 3300048909 Ga0496106_0097240 Ga0496106_0097240_81_959 282
598 3300048910 Ga0496107_0013612 Ga0496107_0013612_2459_3361 282
599 3300048910 Ga0496107_0156697 Ga0496107_0156697_753_1631 282
600 3300048911 Ga0496108_0001459 Ga0496108_0001459_13275_14153 282
601 3300048912 Ga0496109_0017442 Ga0496109_0017442_5303_6181 282
602 3300048912 Ga0496109_0090052 Ga0496109_0090052_1486_2388 282
603 3300048913 Ga0496110_0476106 Ga0496110_0476106_62_940 282
604 3300048914 Ga0496111_0042423 Ga0496111_0042423_2373_3251 282
605 3300048916 Ga0496113_0030191 Ga0496113_0030191_2480_3358 282
606 3300048917 Ga0496114_0007060 Ga0496114_0007060_6298_7200 282
607 3300048918 Ga0496115_0123310 Ga0496115_0123310_613_1515 282
608 3300050492 nmdc:mga0yw44_3355_c1 nmdc:mga0yw44_3355_c1_2549_3397 282
609 3300050496 nmdc:mga07m45_82522_c1 nmdc:mga07m45_82522_c1_967_1815 282
610 3300050507 nmdc:mga05p37_520953_c1 nmdc:mga05p37_520953_c1_265_1143 282
611 3300050508 nmdc:mga09592_102883_c1 nmdc:mga09592_102883_c1_680_1558 282
612 3300050510 nmdc:mga06r32_556321_c1 nmdc:mga06r32_556321_c1_199_1056 282
613 3300050511 nmdc:mga08y16_19899_c1 nmdc:mga08y16_19899_c1_5728_6606 282
614 3300050512 nmdc:mga0n895_10411_c1 nmdc:mga0n895_10411_c1_7128_8006 282
615 3300050514 nmdc:mga08x19_261359_c1 nmdc:mga08x19_261359_c1_146_1003 282
616 3300050515 nmdc:mga0a205_58720_c1 nmdc:mga0a205_58720_c1_2745_3623 282
617 3300061719 Ga0466962_0009384 Ga0466962_0009384_2919_3767 282
618 3300000549 LJQas_1002434 LJQas_10024343 283
619 3300005441 Ga0070700_100168072 Ga0070700_1001680722 283
620 3300005457 Ga0070662_100136432 Ga0070662_1001364322 283
621 3300005937 Ga0081455_10003611 Ga0081455_100036112 283
622 3300005985 Ga0081539_10001405 Ga0081539_1000140527 283
623 3300005985 Ga0081539_10009012 Ga0081539_100090126 283
624 3300006847 Ga0075431_100033118 Ga0075431_1000331183 283
625 3300006880 Ga0075429_100002702 Ga0075429_10000270210 283
626 3300009148 Ga0105243_10085613 Ga0105243_100856132 283
627 3300013105 Ga0157369_10075291 Ga0157369_100752913 283
628 3300013306 Ga0163162_10008544 Ga0163162_100085443 283
629 3300013307 Ga0157372_10145615 Ga0157372_101456153 283
630 3300025933 Ga0207706_10003126 Ga0207706_100031264 283
631 3300025961 Ga0207712_10081619 Ga0207712_100816193 283
632 3300026075 Ga0207708_10047309 Ga0207708_100473093 283
633 3300026078 Ga0207702_10419071 Ga0207702_104190712 283
634 3300026118 Ga0207675_100000686 Ga0207675_1000006869 283
635 3300026142 Ga0207698_10133262 Ga0207698_101332622 283
636 3300027907 Ga0207428_10022628 Ga0207428_100226285 283
637 3300031456 Ga0307513_10025522 Ga0307513_100255224 283
638 3300031838 Ga0307518_10000241 Ga0307518_1000024112 283
639 3300031901 Ga0307406_10218021 Ga0307406_102180212 283
640 3300032002 Ga0307416_100250724 Ga0307416_1002507242 283
641 3300032002 Ga0307416_100427702 Ga0307416_1004277022 283
642 3300032005 Ga0307411_10280456 Ga0307411_102804562 283
643 3300044694 Ga0466963_0016775 Ga0466963_0016775_3339_4247 283
644 3300044765 Ga0466970_0083549 Ga0466970_0083549_426_1286 283
645 3300046491 Ga0495584_0045248 Ga0495584_0045248_977_1855 283
646 3300046501 Ga0495607_0070044 Ga0495607_0070044_371_1249 283
647 3300046513 Ga0495616_0121646 Ga0495616_0121646_107_985 283
648 3300046539 Ga0495621_0057250 Ga0495621_0057250_138_1016 283
649 3300046615 Ga0495656_0005188 Ga0495656_0005188_818_1696 283
650 3300046794 Ga0495589_0060452 Ga0495589_0060452_389_1267 283
651 3300047318 Ga0495636_0029986 Ga0495636_0029986_918_1796 283
652 3300048907 Ga0496104_0242324 Ga0496104_0242324_68_991 283
653 3300048912 Ga0496109_0147818 Ga0496109_0147818_24_908 283
654 3300048914 Ga0496111_0106471 Ga0496111_0106471_939_1862 283
655 3300048917 Ga0496114_0028469 Ga0496114_0028469_3195_4079 283
656 3300048917 Ga0496114_0095624 Ga0496114_0095624_206_1129 283
657 3300049571 Ga0501034_0006228 Ga0501034_0006228_7092_7982 283
658 3300049572 Ga0501036_0007464 Ga0501036_0007464_5161_6051 283
659 3300049573 Ga0501037_0005067 Ga0501037_0005067_4986_5876 283
660 3300049574 Ga0501038_0012940 Ga0501038_0012940_6073_6963 283
661 3300049575 Ga0501039_0113531 Ga0501039_0113531_359_1249 283
662 3300049578 Ga0501042_0005357 Ga0501042_0005357_967_1857 283
663 3300049579 Ga0501043_0008609 Ga0501043_0008609_4680_5570 283
664 3300049581 Ga0501047_0007043 Ga0501047_0007043_4071_4961 283
665 3300049582 Ga0501048_0000973 Ga0501048_0000973_2345_3235 283
666 3300049589 Ga0501073_0011797 Ga0501073_0011797_4503_5393 283
667 3300049590 Ga0501074_0000620 Ga0501074_0000620_15937_16827 283
668 3300049593 Ga0501077_0070313 Ga0501077_0070313_353_1267 283
669 3300049824 Ga0501045_0335782 Ga0501045_0335782_157_1047 283
670 3300050507 nmdc:mga05p37_36027_c1 nmdc:mga05p37_36027_c1_876_1802 283
671 3300050508 nmdc:mga09592_11966_c1 nmdc:mga09592_11966_c1_2503_3429 283
672 3300050509 nmdc:mga0qj67_26341_c1 nmdc:mga0qj67_26341_c1_24_908 283
673 3300050510 nmdc:mga06r32_907_c1 nmdc:mga06r32_907_c1_18532_19458 283
674 3300050511 nmdc:mga08y16_76756_c1 nmdc:mga08y16_76756_c1_2240_3166 283
675 3300050515 nmdc:mga0a205_31401_c1 nmdc:mga0a205_31401_c1_2519_3445 283
676 iso_pu_bacteria 2558860280 2559425956 283
677 iso_pu_bacteria 2917736166 2917740515 283
678 iso_pu_bacteria 8053945823 8053947185 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

120

312

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8724 11 277
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8599 7 271
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8565 11 277
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.8562 13 273
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.8436 13 273
ID Description Score Start End Superfamily
af_P77156_29_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9415 14 272 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9173 17 280 1.10.3720.10
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.911 15 271 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8978 17 280 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8926 53 283 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4T0URA4-F1-model_v4 ABC transporter permease 0.9866 22 283 GO:0005886
GO:0055085
AF-A0A4T0URA4-F1-model_v4 ABC transporter permease 0.9792 22 283 GO:0005886
GO:0055085
AF-A0A7Y9JBH3-F1-model_v4 Putative spermidine/putrescine transport system permease protein 0.9785 8 283 GO:0005886
GO:0055085
AF-A0A286G6K8-F1-model_v4 Putative spermidine/putrescine transport system permease protein 0.9784 30 283 GO:0005886
GO:0055085
AF-X5LIP7-F1-model_v4 deleted 0.9772 12 283

Feature Viewer

pLDDT pTM Quality
91.8 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map