F474669

General Info

Members Datasets Scaffolds Average Seq Length
678 348 1356 116

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0000578|Ga0495638_0000578_2544_2966
Length 140
Sequence LVGGARGYKRRDRAKSGRQKESLAMLYLFLKAAISGAIIAAVSEIAKRYPGFGALVASLPLISVLGMIWLWRDTHDPVRMAQHASATFWFVLPSLPMFLVIPALLRQGMSFWLALVLGCGLTVGLYLAMTWVGPRFGLRL

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
112 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
192 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
217 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
218 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
219 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
227 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
228 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
243 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
265 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
266 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
286 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
292 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
293 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
294 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
297 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
298 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
299 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
300 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
301 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
311 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
312 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
313 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
314 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
315 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
316 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
317 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
318 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
319 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
320 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
321 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
322 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
323 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
324 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
325 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
326 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
327 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
330 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
331 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
332 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
333 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
334 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
335 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
336 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
337 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
338 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
340 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
341 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
342 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
343 2643221583 Caulobacter sp. Root655 Isolate Unclassified
344 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
345 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
346 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
347 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
348 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.47
Nodule 0
Rhizoplane 3.54
Rhizosphere 82.01
Stem 0
Stem Tuber 0
Unclassified 4.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0000578 3300046460 Bacteria 41399
2 JGI24741J21665_1009200 3300001915 Bacteria 1825
3 JGI24740J21852_10005110 3300001979 Bacteria 5571
4 JGI24739J22299_10216559 3300001989 Bacteria 561
5 JGI24737J22298_10000390 3300001990 Bacteria 14992
6 JGI24737J22298_10011784 3300001990 Bacteria 2858
7 JGI24743J22301_10025020 3300001991 Bacteria 1155
8 JGI24735J21928_10001871 3300002067 Bacteria 7380
9 JGI24735J21928_10077771 3300002067 Bacteria 950
10 JGI24735J21928_10101817 3300002067 Bacteria 825
11 JGI24735J21928_10103380 3300002067 Bacteria 818
12 rootH1_10056203 3300003316 Bacteria 2626
13 Ga0055529_1008116 3300003763 Bacteria 1404
14 Ga0065712_10639704 3300005290 Unclassified 570
15 Ga0065707_10256150 3300005295 Bacteria 1110
16 Ga0070658_10019321 3300005327 Bacteria 5457
17 Ga0070658_10068599 3300005327 Bacteria 2899
18 Ga0070658_10083169 3300005327 Bacteria 2631
19 Ga0070658_10127562 3300005327 Bacteria 2118
20 Ga0070658_10196151 3300005327 Bacteria 1702
21 Ga0070658_11121265 3300005327 Bacteria 684
22 Ga0070676_10002548 3300005328 Bacteria 9373
23 Ga0070676_10021263 3300005328 Bacteria 3631
24 Ga0070676_10070556 3300005328 Bacteria 2096
25 Ga0070683_100072832 3300005329 Bacteria 3208
26 Ga0070670_100437450 3300005331 Bacteria 1158
27 Ga0070670_101986239 3300005331 Bacteria 536
28 Ga0068869_100000288 3300005334 Bacteria 26913
29 Ga0068869_100117306 3300005334 Bacteria 2032
30 Ga0070666_10041090 3300005335 Bacteria 3089
31 Ga0070666_10148710 3300005335 Bacteria 1634
32 Ga0070666_10691895 3300005335 Bacteria 747
33 Ga0070680_100016087 3300005336 Bacteria 5878
34 Ga0070680_100079917 3300005336 Bacteria 2696
35 Ga0070680_100338976 3300005336 Bacteria 1277
36 Ga0070682_100084240 3300005337 Bacteria 2065
37 Ga0068868_100000589 3300005338 Bacteria 24447
38 Ga0070660_100016924 3300005339 Bacteria 5306
39 Ga0070660_100053096 3300005339 Bacteria 3125
40 Ga0070660_100121706 3300005339 Bacteria 2083
41 Ga0070660_100819715 3300005339 Bacteria 783
42 Ga0070691_10000901 3300005341 Bacteria 12057
43 Ga0070691_10383184 3300005341 Bacteria 788
44 Ga0070687_100585764 3300005343 Bacteria 764
45 Ga0070661_100008732 3300005344 Bacteria 7013
46 Ga0070661_100306632 3300005344 Bacteria 1237
47 Ga0070692_10083769 3300005345 Bacteria 1722
48 Ga0070668_100063494 3300005347 Bacteria 2863
49 Ga0070668_100899828 3300005347 Bacteria 791
50 Ga0070668_101047353 3300005347 Bacteria 735
51 Ga0070669_100117319 3300005353 Bacteria 2026
52 Ga0070669_100144766 3300005353 Bacteria 1835
53 Ga0070675_100318251 3300005354 Bacteria 1374
54 Ga0070675_100582253 3300005354 Bacteria 1014
55 Ga0070671_100020693 3300005355 Bacteria 5367
56 Ga0070671_101119251 3300005355 Bacteria 692
57 Ga0070674_100024357 3300005356 Bacteria 3927
58 Ga0070674_100046750 3300005356 Bacteria 2963
59 Ga0070674_100181997 3300005356 Bacteria 1610
60 Ga0070674_100424080 3300005356 Bacteria 1092
61 Ga0070673_100000012 3300005364 Bacteria 141279
62 Ga0070673_100240765 3300005364 Bacteria 1573
63 Ga0070673_102307182 3300005364 Bacteria 512
64 Ga0070659_100018252 3300005366 Bacteria 5294
65 Ga0070659_100054520 3300005366 Bacteria 3149
66 Ga0070659_100109430 3300005366 Bacteria 2230
67 Ga0070659_101259617 3300005366 Bacteria 655
68 Ga0070667_100006690 3300005367 Bacteria 9578
69 Ga0070667_100041863 3300005367 Bacteria 3841
70 Ga0070667_100100850 3300005367 Bacteria 2493
71 Ga0070667_100359373 3300005367 Bacteria 1319
72 Ga0070667_100687470 3300005367 Bacteria 946
73 Ga0070667_100820143 3300005367 Bacteria 864
74 Ga0070709_10002750 3300005434 Bacteria 9515
75 Ga0070709_10032251 3300005434 Bacteria 3157
76 Ga0070714_100048928 3300005435 Bacteria 3598
77 Ga0070714_100634828 3300005435 Bacteria 1027
78 Ga0070714_100872573 3300005435 Bacteria 873
79 Ga0070713_100000003 3300005436 Bacteria 245840
80 Ga0070711_100387781 3300005439 Bacteria 1131
81 Ga0070663_100020557 3300005455 Bacteria 4372
82 Ga0070663_100219883 3300005455 Bacteria 1491
83 Ga0070663_100740623 3300005455 Bacteria 838
84 Ga0070662_100048753 3300005457 Bacteria 3052
85 Ga0070662_100059615 3300005457 Bacteria 2781
86 Ga0070662_100567542 3300005457 Bacteria 952
87 Ga0070662_100643504 3300005457 Bacteria 894
88 Ga0070662_101332104 3300005457 Bacteria 618
89 Ga0070681_10116552 3300005458 Bacteria 2608
90 Ga0070681_10314268 3300005458 Bacteria 1476
91 Ga0070681_11592291 3300005458 Bacteria 578
92 Ga0068867_100000253 3300005459 Bacteria 35386
93 Ga0070699_100117094 3300005518 Bacteria 2342
94 Ga0070679_100000005 3300005530 Bacteria 263201
95 Ga0070679_100035713 3300005530 Bacteria 4931
96 Ga0070679_100863783 3300005530 Bacteria 848
97 Ga0070679_101129176 3300005530 Bacteria 729
98 Ga0070684_100153213 3300005535 Bacteria 2089
99 Ga0070684_100189568 3300005535 Bacteria 1871
100 Ga0070697_100355429 3300005536 Bacteria 1266
101 Ga0068853_100007582 3300005539 Bacteria 8690
102 Ga0068853_100094634 3300005539 Bacteria 2632
103 Ga0068853_100425067 3300005539 Bacteria 1246
104 Ga0070672_100126701 3300005543 Bacteria 2095
105 Ga0070686_100005600 3300005544 Bacteria 6959
106 Ga0070695_100036999 3300005545 Bacteria 3074
107 Ga0070665_100073818 3300005548 Bacteria 3416
108 Ga0068855_100031785 3300005563 Bacteria 6301
109 Ga0068855_100558916 3300005563 Bacteria 1238
110 Ga0070664_100023876 3300005564 Bacteria 5051
111 Ga0070664_100172238 3300005564 Bacteria 1920
112 Ga0070664_100624575 3300005564 Bacteria 1000
113 Ga0070664_100983386 3300005564 Bacteria 793
114 Ga0070664_101587473 3300005564 Bacteria 620
115 Ga0070664_101983277 3300005564 Bacteria 552
116 Ga0068857_100000050 3300005577 Bacteria 65116
117 Ga0068857_100004703 3300005577 Bacteria 11572
118 Ga0068857_100201700 3300005577 Bacteria 1813
119 Ga0068857_101191813 3300005577 Bacteria 737
120 Ga0068854_100023229 3300005578 Bacteria 4234
121 Ga0068854_100418579 3300005578 Bacteria 1112
122 Ga0068854_100454686 3300005578 Bacteria 1070
123 Ga0068856_100000075 3300005614 Bacteria 94156
124 Ga0068856_100008276 3300005614 Bacteria 10137
125 Ga0068856_100062034 3300005614 Bacteria 3693
126 Ga0068856_100529028 3300005614 Unclassified 1200
127 Ga0068856_101355846 3300005614 Bacteria 726
128 Ga0068856_101795597 3300005614 Bacteria 625
129 Ga0068852_100183289 3300005616 Bacteria 1970
130 Ga0068852_100634882 3300005616 Bacteria 1074
131 Ga0068852_102238233 3300005616 Bacteria 568
132 Ga0068859_100000109 3300005617 Bacteria 77572
133 Ga0068859_100116247 3300005617 Bacteria 2739
134 Ga0068864_100012776 3300005618 Bacteria 6941
135 Ga0068864_101660019 3300005618 Bacteria 643
136 Ga0068861_100003719 3300005719 Bacteria 10177
137 Ga0068861_101716012 3300005719 Bacteria 621
138 Ga0068851_10656911 3300005834 Bacteria 642
139 Ga0068863_100054664 3300005841 Bacteria 3782
140 Ga0068863_100183272 3300005841 Bacteria 2010
141 Ga0068863_100455277 3300005841 Bacteria 1256
142 Ga0068863_100870228 3300005841 Bacteria 901
143 Ga0068858_100007088 3300005842 Bacteria 10883
144 Ga0068858_100065946 3300005842 Bacteria 3351
145 Ga0068858_100087024 3300005842 Bacteria 2906
146 Ga0068858_100182614 3300005842 Bacteria 1981
147 Ga0068858_100270394 3300005842 Bacteria 1617
148 Ga0068860_100024963 3300005843 Bacteria 5770
149 Ga0068860_100037979 3300005843 Bacteria 4608
150 Ga0068860_100038414 3300005843 Bacteria 4579
151 Ga0068860_100367864 3300005843 Bacteria 1417
152 Ga0068860_102664829 3300005843 Bacteria 519
153 Ga0068862_100000197 3300005844 Bacteria 66711
154 Ga0068862_100079950 3300005844 Bacteria 2834
155 Ga0068862_100106940 3300005844 Bacteria 2453
156 Ga0068862_100277367 3300005844 Bacteria 1535
157 Ga0075365_10200331 3300006038 Bacteria 1398
158 Ga0075364_10605420 3300006051 Bacteria 749
159 Ga0075432_10422572 3300006058 Unclassified 580
160 Ga0070716_100043072 3300006173 Bacteria 2522
161 Ga0070712_100000326 3300006175 Bacteria 26980
162 Ga0075362_10497012 3300006177 Unclassified 623
163 Ga0075367_10273186 3300006178 Unclassified 1062
164 Ga0075367_10476433 3300006178 Unclassified 791
165 Ga0075367_10792357 3300006178 Bacteria 604
166 Ga0075366_10339896 3300006195 Unclassified 920
167 Ga0075366_10375217 3300006195 Bacteria 874
168 Ga0097621_100204565 3300006237 Bacteria 1715
169 Ga0097621_101446918 3300006237 Bacteria 651
170 Ga0075370_10223251 3300006353 Bacteria 1114
171 Ga0075370_10343028 3300006353 Unclassified 892
172 Ga0068871_100065938 3300006358 Bacteria 2967
173 Ga0075433_10507842 3300006852 Unclassified 1061
174 Ga0075434_100145282 3300006871 Bacteria 2392
175 Ga0075434_100324225 3300006871 Bacteria 1561
176 Ga0075429_100240526 3300006880 Bacteria 1586
177 Ga0068865_100000002 3300006881 Bacteria 285745
178 Ga0075436_100000038 3300006914 Bacteria 82918
179 Ga0075436_100045433 3300006914 Bacteria 3029
180 Ga0075436_100148920 3300006914 Bacteria 1646
181 Ga0097620_100000109 3300006931 Bacteria 77572
182 Ga0097620_100116243 3300006931 Bacteria 2739
183 Ga0075435_100064632 3300007076 Bacteria 2973
184 Ga0075435_101049089 3300007076 Bacteria 712
185 Ga0105240_10046586 3300009093 Bacteria 5493
186 Ga0105240_11274987 3300009093 Bacteria 776
187 Ga0105245_10006472 3300009098 Bacteria 10302
188 Ga0105245_10428445 3300009098 Bacteria 1327
189 Ga0105247_10154818 3300009101 Bacteria 1513
190 Ga0105243_10000799 3300009148 Bacteria 30094
191 Ga0105243_10079674 3300009148 Bacteria 2670
192 Ga0105243_10468581 3300009148 Bacteria 1186
193 Ga0105241_10005673 3300009174 Bacteria 9209
194 Ga0105241_10031304 3300009174 Bacteria 3983
195 Ga0105241_10892096 3300009174 Unclassified 825
196 Ga0105241_12657856 3300009174 Bacteria 503
197 Ga0105242_10018988 3300009176 Bacteria 5385
198 Ga0105242_10566587 3300009176 Bacteria 1092
199 Ga0105248_10033619 3300009177 Bacteria 5728
200 Ga0105237_10008776 3300009545 Bacteria 10903
201 Ga0105238_10003614 3300009551 Bacteria 15410
202 Ga0105238_10098507 3300009551 Bacteria 2907
203 Ga0105238_10371482 3300009551 Bacteria 1420
204 Ga0105238_11383381 3300009551 Bacteria 731
205 Ga0105249_10130092 3300009553 Bacteria 2402
206 Ga0105249_10301742 3300009553 Bacteria 1607
207 Ga0105249_11366869 3300009553 Bacteria 780
208 Ga0105239_10018447 3300010375 Bacteria 7707
209 Ga0105239_10024012 3300010375 Bacteria 6715
210 Ga0105239_13230049 3300010375 Bacteria 531
211 Ga0105246_10003599 3300011119 Bacteria 9373
212 Ga0105246_10081653 3300011119 Bacteria 2305
213 Ga0105246_11588453 3300011119 Bacteria 618
214 Ga0157373_10002679 3300013100 Bacteria 13499
215 Ga0157373_10270252 3300013100 Bacteria 1203
216 Ga0157373_10399206 3300013100 Bacteria 985
217 Ga0157373_10720258 3300013100 Bacteria 732
218 Ga0157371_10000030 3300013102 Bacteria 241585
219 Ga0157371_10643829 3300013102 Bacteria 791
220 Ga0157370_10001209 3300013104 Bacteria 32283
221 Ga0157369_10053656 3300013105 Bacteria 4356
222 Ga0157369_10244857 3300013105 Bacteria 1872
223 Ga0157369_10848056 3300013105 Bacteria 938
224 Ga0157374_10005851 3300013296 Bacteria 10387
225 Ga0157374_10092954 3300013296 Bacteria 2879
226 Ga0157378_10006716 3300013297 Bacteria 10051
227 Ga0157378_10401502 3300013297 Bacteria 1351
228 Ga0157378_10512223 3300013297 Bacteria 1200
229 Ga0163162_10112458 3300013306 Bacteria 2821
230 Ga0163162_11946548 3300013306 Bacteria 673
231 Ga0157372_10087639 3300013307 Bacteria 3532
232 Ga0157375_10017158 3300013308 Bacteria 6528
233 Ga0157375_11542732 3300013308 Bacteria 784
234 Ga0157375_13145782 3300013308 Bacteria 551
235 Ga0163163_10428582 3300014325 Bacteria 1382
236 Ga0163163_11370638 3300014325 Bacteria 769
237 Ga0157380_10260737 3300014326 Bacteria 1574
238 Ga0157380_10674917 3300014326 Bacteria 1034
239 Ga0157377_10278284 3300014745 Bacteria 1096
240 Ga0157377_10457216 3300014745 Bacteria 883
241 Ga0157379_10011735 3300014968 Bacteria 7651
242 Ga0157379_10015825 3300014968 Bacteria 6627
243 Ga0157379_10236746 3300014968 Bacteria 1655
244 Ga0157379_10975574 3300014968 Bacteria 807
245 Ga0157376_10000080 3300014969 Bacteria 72670
246 Ga0183363_1010 3300015690 Bacteria 108191
247 Ga0183363_1043 3300015690 Bacteria 40750
248 Ga0213876_10575086 3300021384 Unclassified 599
249 Ga0213871_10003873 3300021441 Bacteria 2939
250 Ga0209646_1010646 3300025246 Bacteria 1438
251 Ga0209148_1001703 3300025254 Bacteria 9715
252 Ga0209455_1001220 3300025272 Bacteria 12226
253 Ga0207697_10419065 3300025315 Bacteria 594
254 Ga0207656_10002600 3300025321 Bacteria 6103
255 Ga0207710_10111744 3300025900 Bacteria 1298
256 Ga0207680_10011714 3300025903 Bacteria 4441
257 Ga0207680_10033601 3300025903 Bacteria 2928
258 Ga0207680_10601007 3300025903 Bacteria 787
259 Ga0207647_10013637 3300025904 Bacteria 5627
260 Ga0207647_10026075 3300025904 Bacteria 3827
261 Ga0207647_10044802 3300025904 Bacteria 2763
262 Ga0207647_10086756 3300025904 Bacteria 1870
263 Ga0207699_10000178 3300025906 Bacteria 38460
264 Ga0207645_10001923 3300025907 Bacteria 16755
265 Ga0207645_10080348 3300025907 Bacteria 2090
266 Ga0207645_10105491 3300025907 Bacteria 1821
267 Ga0207705_10000014 3300025909 Bacteria 434286
268 Ga0207705_10001011 3300025909 Bacteria 22858
269 Ga0207705_10004543 3300025909 Bacteria 10480
270 Ga0207705_10007609 3300025909 Bacteria 7964
271 Ga0207705_10007610 3300025909 Bacteria 7964
272 Ga0207705_10029941 3300025909 Bacteria 3883
273 Ga0207705_10092494 3300025909 Bacteria 2216
274 Ga0207705_10167540 3300025909 Bacteria 1653
275 Ga0207654_10000190 3300025911 Bacteria 37976
276 Ga0207654_10232996 3300025911 Bacteria 1227
277 Ga0207654_10250110 3300025911 Bacteria 1188
278 Ga0207654_11233645 3300025911 Bacteria 545
279 Ga0207707_10038812 3300025912 Bacteria 4162
280 Ga0207707_10076990 3300025912 Bacteria 2911
281 Ga0207707_10537903 3300025912 Bacteria 994
282 Ga0207695_10154467 3300025913 Bacteria 2231
283 Ga0207671_10056363 3300025914 Bacteria 2912
284 Ga0207671_10123552 3300025914 Bacteria 1980
285 Ga0207671_10287546 3300025914 Bacteria 1298
286 Ga0207693_10002536 3300025915 Bacteria 15877
287 Ga0207663_10314014 3300025916 Bacteria 1175
288 Ga0207660_10010711 3300025917 Bacteria 5959
289 Ga0207660_10080765 3300025917 Bacteria 2388
290 Ga0207660_10157055 3300025917 Bacteria 1752
291 Ga0207660_11061375 3300025917 Unclassified 660
292 Ga0207662_10037565 3300025918 Bacteria 2834
293 Ga0207662_10229589 3300025918 Bacteria 1212
294 Ga0207657_10024501 3300025919 Bacteria 5583
295 Ga0207657_10062676 3300025919 Bacteria 3182
296 Ga0207657_10074135 3300025919 Bacteria 2875
297 Ga0207649_10002391 3300025920 Bacteria 10525
298 Ga0207652_10000005 3300025921 Bacteria 343384
299 Ga0207652_10000006 3300025921 Bacteria 302991
300 Ga0207652_10000007 3300025921 Bacteria 301303
301 Ga0207652_10000009 3300025921 Bacteria 257234
302 Ga0207652_10099616 3300025921 Bacteria 2564
303 Ga0207652_10238906 3300025921 Bacteria 1637
304 Ga0207652_10884763 3300025921 Bacteria 790
305 Ga0207694_10024462 3300025924 Bacteria 4587
306 Ga0207694_10024835 3300025924 Bacteria 4551
307 Ga0207650_10075730 3300025925 Bacteria 2541
308 Ga0207650_11838699 3300025925 Bacteria 512
309 Ga0207659_10037409 3300025926 Bacteria 3370
310 Ga0207687_10000630 3300025927 Bacteria 23796
311 Ga0207687_10524076 3300025927 Bacteria 991
312 Ga0207700_10000010 3300025928 Bacteria 298473
313 Ga0207664_10139830 3300025929 Bacteria 2047
314 Ga0207664_10557791 3300025929 Bacteria 1028
315 Ga0207664_11293297 3300025929 Bacteria 649
316 Ga0207644_10038842 3300025931 Bacteria 3356
317 Ga0207690_10005251 3300025932 Bacteria 7637
318 Ga0207690_10488113 3300025932 Bacteria 995
319 Ga0207690_10990694 3300025932 Bacteria 699
320 Ga0207690_11197064 3300025932 Bacteria 634
321 Ga0207706_10054440 3300025933 Bacteria 3531
322 Ga0207706_10149927 3300025933 Bacteria 2051
323 Ga0207706_10164388 3300025933 Bacteria 1950
324 Ga0207706_10193368 3300025933 Bacteria 1785
325 Ga0207706_10322176 3300025933 Bacteria 1345
326 Ga0207706_10511707 3300025933 Bacteria 1036
327 Ga0207686_10118077 3300025934 Bacteria 1801
328 Ga0207709_10000559 3300025935 Bacteria 31723
329 Ga0207709_10054419 3300025935 Bacteria 2467
330 Ga0207670_10295137 3300025936 Bacteria 1267
331 Ga0207669_10007122 3300025937 Bacteria 5151
332 Ga0207669_10030323 3300025937 Bacteria 3004
333 Ga0207669_10075287 3300025937 Bacteria 2138
334 Ga0207669_10368726 3300025937 Bacteria 1115
335 Ga0207704_10000003 3300025938 Bacteria 285808
336 Ga0207665_10068241 3300025939 Bacteria 2423
337 Ga0207691_10635356 3300025940 Bacteria 902
338 Ga0207711_10003531 3300025941 Bacteria 13537
339 Ga0207689_10000902 3300025942 Bacteria 28523
340 Ga0207689_10042195 3300025942 Bacteria 3775
341 Ga0207661_10328151 3300025944 Bacteria 1377
342 Ga0207679_10010875 3300025945 Bacteria 5868
343 Ga0207679_10448083 3300025945 Bacteria 1144
344 Ga0207667_10000004 3300025949 Bacteria 737718
345 Ga0207667_10015103 3300025949 Bacteria 8780
346 Ga0207667_11077190 3300025949 Bacteria 788
347 Ga0207651_10000003 3300025960 Bacteria 308050
348 Ga0207651_10468289 3300025960 Bacteria 1084
349 Ga0207712_10262389 3300025961 Bacteria 1401
350 Ga0207712_10270123 3300025961 Bacteria 1383
351 Ga0207712_11089260 3300025961 Bacteria 711
352 Ga0207712_11256606 3300025961 Bacteria 661
353 Ga0207668_10053279 3300025972 Bacteria 2803
354 Ga0207668_10768782 3300025972 Bacteria 851
355 Ga0207640_10040644 3300025981 Bacteria 2952
356 Ga0207640_10180225 3300025981 Bacteria 1583
357 Ga0207640_10575504 3300025981 Bacteria 950
358 Ga0207640_11581357 3300025981 Bacteria 590
359 Ga0207658_10015737 3300025986 Bacteria 5193
360 Ga0207658_10123214 3300025986 Bacteria 2070
361 Ga0207658_10816493 3300025986 Bacteria 847
362 Ga0207677_10001594 3300026023 Bacteria 12032
363 Ga0207677_10018061 3300026023 Bacteria 4225
364 Ga0207703_10026304 3300026035 Bacteria 4578
365 Ga0207703_10075327 3300026035 Bacteria 2797
366 Ga0207703_10390377 3300026035 Bacteria 1289
367 Ga0207639_10003721 3300026041 Bacteria 10262
368 Ga0207639_10005181 3300026041 Bacteria 8794
369 Ga0207639_10020706 3300026041 Bacteria 4712
370 Ga0207639_10022742 3300026041 Bacteria 4519
371 Ga0207639_10048349 3300026041 Bacteria 3219
372 Ga0207678_10010779 3300026067 Bacteria 8031
373 Ga0207678_10047148 3300026067 Bacteria 3727
374 Ga0207678_10534700 3300026067 Bacteria 1024
375 Ga0207678_10611672 3300026067 Bacteria 956
376 Ga0207702_10000013 3300026078 Bacteria 257468
377 Ga0207702_10004616 3300026078 Bacteria 12204
378 Ga0207702_10006371 3300026078 Bacteria 10187
379 Ga0207702_10166628 3300026078 Bacteria 2016
380 Ga0207702_11555621 3300026078 Bacteria 655
381 Ga0207641_10164174 3300026088 Bacteria 2021
382 Ga0207641_10819329 3300026088 Bacteria 921
383 Ga0207648_10000167 3300026089 Bacteria 67709
384 Ga0207676_10008047 3300026095 Bacteria 7497
385 Ga0207676_10012153 3300026095 Bacteria 6163
386 Ga0207676_10410519 3300026095 Bacteria 1268
387 Ga0207674_10000026 3300026116 Bacteria 151359
388 Ga0207674_10010304 3300026116 Bacteria 10601
389 Ga0207674_10034630 3300026116 Bacteria 5277
390 Ga0207674_10144725 3300026116 Bacteria 2336
391 Ga0207675_100007671 3300026118 Bacteria 10186
392 Ga0207675_100378548 3300026118 Bacteria 1391
393 Ga0207675_100859047 3300026118 Bacteria 923
394 Ga0207698_10021357 3300026142 Bacteria 4475
395 Ga0207698_10126914 3300026142 Bacteria 2172
396 Ga0209974_10043266 3300027876 Bacteria 1500
397 Ga0209974_10137574 3300027876 Bacteria 874
398 Ga0268266_10313300 3300028379 Bacteria 1467
399 Ga0268266_12307907 3300028379 Unclassified 509
400 Ga0268265_10000153 3300028380 Bacteria 84364
401 Ga0268265_10025993 3300028380 Bacteria 4162
402 Ga0268265_11407328 3300028380 Bacteria 699
403 Ga0268264_10014717 3300028381 Bacteria 6428
404 Ga0268264_10028095 3300028381 Bacteria 4601
405 Ga0268264_10861685 3300028381 Bacteria 908
406 Ga0268264_11812292 3300028381 Bacteria 620
407 Ga0307517_10006462 3300028786 Bacteria 17342
408 Ga0307517_10045984 3300028786 Bacteria 4569
409 Ga0307515_10034784 3300028794 Bacteria 8226
410 Ga0307515_10059602 3300028794 Bacteria 5466
411 Ga0265324_10072272 3300029957 Bacteria 1175
412 Ga0307513_10003303 3300031456 Bacteria 21966
413 Ga0307513_10896333 3300031456 Bacteria 594
414 Ga0307408_100015823 3300031548 Bacteria 5026
415 Ga0307408_100021977 3300031548 Bacteria 4327
416 Ga0307408_100290228 3300031548 Bacteria 1366
417 Ga0307405_10157252 3300031731 Bacteria 1605
418 Ga0307413_10010199 3300031824 Bacteria 4541
419 Ga0307413_10236426 3300031824 Bacteria 1346
420 Ga0307410_10022349 3300031852 Bacteria 3907
421 Ga0307410_10040923 3300031852 Bacteria 3053
422 Ga0307410_11342682 3300031852 Bacteria 626
423 Ga0307406_10013635 3300031901 Bacteria 4659
424 Ga0307407_10216063 3300031903 Bacteria 1293
425 Ga0307412_10018297 3300031911 Bacteria 4213
426 Ga0307412_10038411 3300031911 Bacteria 3083
427 Ga0307412_11557221 3300031911 Bacteria 602
428 Ga0307409_100017678 3300031995 Bacteria 4762
429 Ga0307416_100003578 3300032002 Bacteria 9166
430 Ga0307416_100170609 3300032002 Bacteria 2024
431 Ga0307416_101447736 3300032002 Bacteria 793
432 Ga0307414_10008735 3300032004 Bacteria 5774
433 Ga0307411_10106008 3300032005 Bacteria 1999
434 Ga0307415_100046251 3300032126 Bacteria 2922
435 Ga0307415_101274798 3300032126 Bacteria 695
436 Ga0373948_0156661 3300034817 Bacteria 572
437 Ga0373928_0048416 3300035084 Bacteria 997
438 Ga0373934_0061868 3300035086 Bacteria 1492
439 Ga0373923_0055969 3300035111 Bacteria 1664
440 Ga0373939_0166023 3300035114 Unclassified 814
441 Ga0373957_0019875 3300035120 Bacteria 2368
442 Ga0373960_0020816 3300035121 Bacteria 1738
443 Ga0373955_0166741 3300035172 Unclassified 1302
444 Ga0373962_0099782 3300035242 Bacteria 904
445 Ga0373931_0083837 3300035691 Bacteria 1764
446 Ga0373935_0911862 3300035692 Bacteria 651
447 Ga0373933_0008594 3300035724 Bacteria 5570
448 Ga0373937_0056121 3300036401 Bacteria 3616
449 Ga0373937_0134307 3300036401 Bacteria 2313
450 Ga0395899_0032108 3300037312 Bacteria 3944
451 Ga0395900_0142865 3300037418 Bacteria 2450
452 Ga0395900_0518752 3300037418 Bacteria 1140
453 Ga0395900_0821723 3300037418 Bacteria 856
454 Ga0395898_0068188 3300037466 Bacteria 3442
455 Ga0395905_0017198 3300037471 Bacteria 6869
456 Ga0395905_0077486 3300037471 Bacteria 3115
457 Ga0395905_0080184 3300037471 Bacteria 3059
458 Ga0395905_0120833 3300037471 Bacteria 2462
459 Ga0395905_0198169 3300037471 Bacteria 1883
460 Ga0395905_1196849 3300037471 Bacteria 663
461 Ga0436364_1151089 3300037853 Bacteria 2362
462 Ga0436364_1397285 3300037853 Bacteria 1647
463 Ga0395901_0088447 3300038443 Bacteria 3240
464 Ga0395901_0161633 3300038443 Bacteria 2352
465 Ga0395901_0268407 3300038443 Bacteria 1775
466 Ga0395901_0374843 3300038443 Bacteria 1465
467 Ga0436365_0015882 3300039437 Bacteria 811
468 Ga0436360_0414090 3300039438 Bacteria 3303
469 Ga0451789_0713449 3300041443 Bacteria 731
470 Ga0451791_1579288 3300041451 Bacteria 514
471 Ga0451841_0680867 3300041498 Bacteria 846
472 Ga0451853_0717586 3300041512 Bacteria 1584
473 Ga0439445_0257184 3300042004 Unclassified 522
474 Ga0439448_0000428 3300042005 Bacteria 9652
475 Ga0439448_0003827 3300042005 Bacteria 4205
476 Ga0439448_0255340 3300042005 Bacteria 619
477 Ga0439455_0005118 3300042012 Bacteria 2644
478 Ga0439455_0005797 3300042012 Bacteria 2529
479 Ga0439458_0000904 3300042157 Bacteria 7664
480 Ga0466963_0014492 3300044694 Bacteria 4861
481 Ga0466964_0072238 3300044706 Bacteria 1462
482 Ga0466971_0027351 3300044719 Bacteria 2554
483 Ga0466957_0031267 3300044842 Bacteria 3180
484 Ga0466957_0087299 3300044842 Bacteria 1950
485 Ga0466957_0810444 3300044842 Bacteria 665
486 Ga0466958_0084845 3300045836 Bacteria 1953
487 Ga0466958_0560958 3300045836 Bacteria 742
488 Ga0466967_0011214 3300045976 Bacteria 6775
489 Ga0466967_0209811 3300045976 Bacteria 1847
490 Ga0466967_0222416 3300045976 Bacteria 1795
491 Ga0495617_022285 3300046452 Bacteria 2141
492 Ga0495627_000796 3300046453 Bacteria 23045
493 Ga0495590_0001368 3300046457 Bacteria 10594
494 Ga0495629_0243275 3300046459 Bacteria 1238
495 Ga0495638_0171061 3300046460 Bacteria 1246
496 Ga0495650_0000340 3300046471 Bacteria 83278
497 Ga0495650_0059221 3300046471 Bacteria 1543
498 Ga0495580_0015858 3300046472 Bacteria 5671
499 Ga0495664_0076559 3300046477 Bacteria 2002
500 Ga0495664_0774756 3300046477 Bacteria 565
501 Ga0495585_0245635 3300046492 Bacteria 895
502 Ga0495594_0241449 3300046499 Bacteria 1030
503 Ga0495596_0117607 3300046500 Bacteria 1032
504 Ga0495583_0002670 3300046506 Bacteria 14843
505 Ga0495606_0156159 3300046507 Bacteria 1335
506 Ga0495610_0003009 3300046512 Bacteria 13528
507 Ga0495610_0010756 3300046512 Bacteria 5659
508 Ga0495631_0337896 3300046518 Bacteria 641
509 Ga0495631_0345893 3300046518 Bacteria 633
510 Ga0495643_0001839 3300046522 Bacteria 18026
511 Ga0495643_0086240 3300046522 Bacteria 1627
512 Ga0495648_0029031 3300046524 Bacteria 3676
513 Ga0495642_0078679 3300046528 Bacteria 1386
514 Ga0495654_0079282 3300046530 Bacteria 1543
515 Ga0495609_0224741 3300046538 Bacteria 779
516 Ga0495597_0036536 3300046542 Bacteria 2211
517 Ga0495597_0134591 3300046542 Bacteria 1023
518 Ga0495597_0207605 3300046542 Bacteria 782
519 Ga0495597_0217674 3300046542 Bacteria 759
520 Ga0495645_0144017 3300046543 Bacteria 1660
521 Ga0495622_0111362 3300046557 Bacteria 1253
522 Ga0495633_0008539 3300046558 Bacteria 5758
523 Ga0495633_0034488 3300046558 Bacteria 2434
524 Ga0495668_0000007 3300046616 Bacteria 552902
525 Ga0495611_0080656 3300046648 Bacteria 1496
526 Ga0495625_0000051 3300046660 Bacteria 193325
527 Ga0495625_0000546 3300046660 Bacteria 55126
528 Ga0495625_0020378 3300046660 Bacteria 5120
529 Ga0495625_0116682 3300046660 Bacteria 1821
530 Ga0495635_1026954 3300046663 Bacteria 524
531 Ga0495623_0460801 3300046679 Bacteria 676
532 Ga0495669_0000005 3300046684 Bacteria 193971
533 Ga0495669_0146064 3300046684 Bacteria 1118
534 Ga0495670_0065300 3300046691 Bacteria 1834
535 Ga0495670_0218821 3300046691 Bacteria 1011
536 Ga0495670_0450655 3300046691 Bacteria 697
537 Ga0495670_0507531 3300046691 Bacteria 655
538 Ga0495670_0684165 3300046691 Bacteria 559
539 Ga0495671_0042565 3300046692 Bacteria 2282
540 Ga0495649_0066874 3300046694 Bacteria 1928
541 Ga0495649_0116640 3300046694 Bacteria 1413
542 Ga0495589_0011963 3300046794 Bacteria 4499
543 Ga0495600_0009913 3300046809 Bacteria 5901
544 Ga0495600_0570162 3300046809 Bacteria 690
545 Ga0495674_0012050 3300047319 Bacteria 8149
546 Ga0495672_0002240 3300047320 Bacteria 18005
547 Ga0495676_0180787 3300047321 Bacteria 1478
548 Ga0495680_0082363 3300047322 Bacteria 2428
549 Ga0495680_0770837 3300047322 Bacteria 630
550 Ga0495687_001752 3300047443 Bacteria 19188
551 Ga0495687_040799 3300047443 Bacteria 2042
552 Ga0495677_0041618 3300047445 Bacteria 1681
553 Ga0495681_0110208 3300047470 Bacteria 1193
554 Ga0495684_1065290 3300047471 Bacteria 509
555 Ga0495686_0000650 3300047472 Bacteria 47482
556 Ga0495686_0002725 3300047472 Bacteria 16154
557 Ga0495686_0017646 3300047472 Bacteria 4802
558 Ga0495686_0194377 3300047472 Bacteria 1167
559 Ga0495686_0354932 3300047472 Bacteria 796
560 Ga0495602_0323497 3300048088 Bacteria 1121
561 Ga0495602_1144723 3300048088 Bacteria 509
562 Ga0496100_0018037 3300048903 Bacteria 4179
563 Ga0496101_0041017 3300048904 Bacteria 3298
564 Ga0496101_1423137 3300048904 Unclassified 540
565 Ga0496103_0665512 3300048906 Unclassified 661
566 Ga0496104_0040545 3300048907 Bacteria 4365
567 Ga0496104_1182596 3300048907 Bacteria 668
568 Ga0496106_0008898 3300048909 Bacteria 7421
569 Ga0496106_0441387 3300048909 Unclassified 1046
570 Ga0496107_0004151 3300048910 Bacteria 9770
571 Ga0496107_0231189 3300048910 Bacteria 1376
572 Ga0496107_0237688 3300048910 Bacteria 1356
573 Ga0496108_0019431 3300048911 Bacteria 5579
574 Ga0496109_0009979 3300048912 Bacteria 8108
575 Ga0496109_0051212 3300048912 Bacteria 3761
576 Ga0496109_0373356 3300048912 Unclassified 1347
577 Ga0496110_0004905 3300048913 Bacteria 10440
578 Ga0496110_0206446 3300048913 Bacteria 1786
579 Ga0496110_0898788 3300048913 Bacteria 791
580 Ga0496110_0973885 3300048913 Bacteria 755
581 Ga0496112_0376286 3300048915 Unclassified 1361
582 Ga0496115_0309404 3300048918 Bacteria 1294
583 Ga0496116_0166919 3300048919 Bacteria 1199
584 Ga0496117_0063816 3300048920 Bacteria 2515
585 Ga0496120_0025766 3300048923 Bacteria 3645
586 Ga0496121_0007846 3300048924 Bacteria 12763
587 Ga0496122_0064194 3300048925 Bacteria 2673
588 Ga0496124_0423793 3300048927 Bacteria 916
589 Ga0496126_0897732 3300048929 Bacteria 672
590 Ga0495678_001535 3300049459 Bacteria 17831
591 Ga0501047_0682871 3300049581 Bacteria 845
592 Ga0501071_0371805 3300049587 Bacteria 1089
593 Ga0501202_106395 3300049652 Bacteria 689
594 Ga0501240_094884 3300049673 Bacteria 568
595 Ga0501249_142165 3300049679 Unclassified 598
596 Ga0501267_051452 3300049764 Bacteria 537
597 Ga0501044_0479513 3300049823 Bacteria 1147
598 nmdc:mga03683_464672_c1 3300050489 Unclassified 610
599 nmdc:mga00v17_540907_c1 3300050491 Bacteria 753
600 nmdc:mga0yw44_56241_c1 3300050492 Bacteria 2396
601 nmdc:mga0k408_154027_c1 3300050493 Unclassified 1369
602 nmdc:mga0k408_356373_c1 3300050493 Bacteria 872
603 nmdc:mga0k408_71709_c1 3300050493 Bacteria 2022
604 nmdc:mga06z11_436324_c1 3300050494 Unclassified 790
605 nmdc:mga06z11_461318_c1 3300050494 Bacteria 768
606 nmdc:mga07m45_268035_c1 3300050496 Unclassified 993
607 nmdc:mga09592_161628_c1 3300050508 Bacteria 1935
608 nmdc:mga0n895_128911_c1 3300050512 Bacteria 2554
609 nmdc:mga0rr50_89935_c1 3300050513 Bacteria 2388
610 nmdc:mga0rr50_999895_c1 3300050513 Bacteria 712
611 nmdc:mga08x19_205461_c1 3300050514 Bacteria 1351
612 nmdc:mga08x19_95_c1 3300050514 Bacteria 78182
613 Ga0495601_0004621 3300053077 Bacteria 7964
614 Ga0495601_0090950 3300053077 Bacteria 1964
615 Ga0495601_0289570 3300053077 Unclassified 1068
616 Ga0495612_0001956 3300053078 Bacteria 8486
617 Ga0495655_0266501 3300053083 Bacteria 580
618 Ga0495619_0015256 3300053085 Bacteria 4858
619 Ga0495619_0060638 3300053085 Bacteria 2515
620 Ga0500578_0000004 3300053086 Bacteria 260037
621 Ga0500643_000252 3300053087 Bacteria 49322
622 Ga0500643_004223 3300053087 Bacteria 6578
623 Ga0500643_008423 3300053087 Bacteria 4053
624 Ga0500643_018580 3300053087 Bacteria 2305
625 Ga0500643_111679 3300053087 Bacteria 738
626 Ga0500643_145797 3300053087 Bacteria 636
627 Ga0500644_0002781 3300053088 Bacteria 4354
628 Ga0500644_0182817 3300053088 Bacteria 859
629 Ga0500646_0069388 3300053090 Bacteria 1054
630 Ga0500646_0214585 3300053090 Bacteria 665
631 Ga0500651_0384163 3300053093 Bacteria 791
632 Ga0500566_0478474 3300053094 Bacteria 540
633 Ga0500641_0000218 3300053096 Bacteria 21342
634 Ga0500641_0000613 3300053096 Bacteria 12876
635 Ga0500650_0000065 3300053098 Bacteria 32546
636 Ga0500650_0472540 3300053098 Bacteria 535
637 Ga0500555_087709 3300053103 Bacteria 802
638 Ga0500556_0008066 3300053104 Bacteria 3030
639 Ga0500556_0061187 3300053104 Unclassified 1387
640 Ga0500557_102987 3300053105 Bacteria 948
641 Ga0500562_006019 3300053108 Bacteria 3054
642 Ga0500562_034712 3300053108 Bacteria 1335
643 Ga0500562_103296 3300053108 Bacteria 776
644 Ga0500592_010915 3300053116 Bacteria 1450
645 Ga0500594_0000204 3300053118 Bacteria 14589
646 Ga0500595_001019 3300053119 Bacteria 15741
647 Ga0500595_001397 3300053119 Bacteria 12948
648 Ga0500595_033821 3300053119 Bacteria 1694
649 Ga0500607_233126 3300053121 Bacteria 752
650 Ga0500655_048044 3300053133 Bacteria 847
651 Ga0500559_0090999 3300053136 Bacteria 1397
652 Ga0500568_0000145 3300053139 Bacteria 62300
653 Ga0500568_0048239 3300053139 Bacteria 1685
654 Ga0500573_0251956 3300053140 Bacteria 909
655 Ga0500577_0001343 3300053142 Bacteria 6288
656 Ga0500588_0035766 3300053146 Bacteria 1464
657 Ga0500604_0032611 3300053151 Bacteria 1536
658 Ga0500616_0000080 3300053153 Bacteria 200381
659 Ga0500616_0008437 3300053153 Bacteria 6401
660 Ga0500616_0014413 3300053153 Bacteria 4543
661 Ga0500616_0298469 3300053153 Bacteria 670
662 Ga0500622_0001052 3300053156 Bacteria 23008
663 Ga0500622_0088499 3300053156 Bacteria 1540
664 Ga0500636_0022842 3300053177 Bacteria 3697
665 Ga0500645_001100 3300053730 Bacteria 14793
666 Ga0500645_011652 3300053730 Bacteria 2863
667 Ga0500552_096353 3300053733 Bacteria 558
668 Ga0500596_001380 3300053735 Bacteria 4901
669 Ga0466962_0031561 3300061719 Bacteria 2536
670 2511124830 2510917020 Bacteria 5657507
671 2585146382 2582581279 Bacteria 4980720
672 2600204244 2599185354 Bacteria 4398675
673 2643922380 2643221583 Bacteria 5218014
674 2643998385 2643221598 Bacteria 4578346
675 2644086754 2643221614 Bacteria 4260023
676 2644341708 2643221661 Bacteria 4267604
677 2644367995 2643221666 Bacteria 4265935
678 2753767541 2751185897 Bacteria 5322941
679 Ga0495638_0000578
680 JGI24741J21665_1009200
681 JGI24740J21852_10005110
682 JGI24739J22299_10216559
683 JGI24737J22298_10000390
684 JGI24737J22298_10011784
685 JGI24743J22301_10025020
686 JGI24735J21928_10001871
687 JGI24735J21928_10077771
688 JGI24735J21928_10101817
689 JGI24735J21928_10103380
690 rootH1_10056203
691 Ga0055529_1008116
692 Ga0065712_10639704
693 Ga0065707_10256150
694 Ga0070658_10019321
695 Ga0070658_10068599
696 Ga0070658_10083169
697 Ga0070658_10127562
698 Ga0070658_10196151
699 Ga0070658_11121265
700 Ga0070676_10002548
701 Ga0070676_10021263
702 Ga0070676_10070556
703 Ga0070683_100072832
704 Ga0070670_100437450
705 Ga0070670_101986239
706 Ga0068869_100000288
707 Ga0068869_100117306
708 Ga0070666_10041090
709 Ga0070666_10148710
710 Ga0070666_10691895
711 Ga0070680_100016087
712 Ga0070680_100079917
713 Ga0070680_100338976
714 Ga0070682_100084240
715 Ga0068868_100000589
716 Ga0070660_100016924
717 Ga0070660_100053096
718 Ga0070660_100121706
719 Ga0070660_100819715
720 Ga0070691_10000901
721 Ga0070691_10383184
722 Ga0070687_100585764
723 Ga0070661_100008732
724 Ga0070661_100306632
725 Ga0070692_10083769
726 Ga0070668_100063494
727 Ga0070668_100899828
728 Ga0070668_101047353
729 Ga0070669_100117319
730 Ga0070669_100144766
731 Ga0070675_100318251
732 Ga0070675_100582253
733 Ga0070671_100020693
734 Ga0070671_101119251
735 Ga0070674_100024357
736 Ga0070674_100046750
737 Ga0070674_100181997
738 Ga0070674_100424080
739 Ga0070673_100000012
740 Ga0070673_100240765
741 Ga0070673_102307182
742 Ga0070659_100018252
743 Ga0070659_100054520
744 Ga0070659_100109430
745 Ga0070659_101259617
746 Ga0070667_100006690
747 Ga0070667_100041863
748 Ga0070667_100100850
749 Ga0070667_100359373
750 Ga0070667_100687470
751 Ga0070667_100820143
752 Ga0070709_10002750
753 Ga0070709_10032251
754 Ga0070714_100048928
755 Ga0070714_100634828
756 Ga0070714_100872573
757 Ga0070713_100000003
758 Ga0070711_100387781
759 Ga0070663_100020557
760 Ga0070663_100219883
761 Ga0070663_100740623
762 Ga0070662_100048753
763 Ga0070662_100059615
764 Ga0070662_100567542
765 Ga0070662_100643504
766 Ga0070662_101332104
767 Ga0070681_10116552
768 Ga0070681_10314268
769 Ga0070681_11592291
770 Ga0068867_100000253
771 Ga0070699_100117094
772 Ga0070679_100000005
773 Ga0070679_100035713
774 Ga0070679_100863783
775 Ga0070679_101129176
776 Ga0070684_100153213
777 Ga0070684_100189568
778 Ga0070697_100355429
779 Ga0068853_100007582
780 Ga0068853_100094634
781 Ga0068853_100425067
782 Ga0070672_100126701
783 Ga0070686_100005600
784 Ga0070695_100036999
785 Ga0070665_100073818
786 Ga0068855_100031785
787 Ga0068855_100558916
788 Ga0070664_100023876
789 Ga0070664_100172238
790 Ga0070664_100624575
791 Ga0070664_100983386
792 Ga0070664_101587473
793 Ga0070664_101983277
794 Ga0068857_100000050
795 Ga0068857_100004703
796 Ga0068857_100201700
797 Ga0068857_101191813
798 Ga0068854_100023229
799 Ga0068854_100418579
800 Ga0068854_100454686
801 Ga0068856_100000075
802 Ga0068856_100008276
803 Ga0068856_100062034
804 Ga0068856_100529028
805 Ga0068856_101355846
806 Ga0068856_101795597
807 Ga0068852_100183289
808 Ga0068852_100634882
809 Ga0068852_102238233
810 Ga0068859_100000109
811 Ga0068859_100116247
812 Ga0068864_100012776
813 Ga0068864_101660019
814 Ga0068861_100003719
815 Ga0068861_101716012
816 Ga0068851_10656911
817 Ga0068863_100054664
818 Ga0068863_100183272
819 Ga0068863_100455277
820 Ga0068863_100870228
821 Ga0068858_100007088
822 Ga0068858_100065946
823 Ga0068858_100087024
824 Ga0068858_100182614
825 Ga0068858_100270394
826 Ga0068860_100024963
827 Ga0068860_100037979
828 Ga0068860_100038414
829 Ga0068860_100367864
830 Ga0068860_102664829
831 Ga0068862_100000197
832 Ga0068862_100079950
833 Ga0068862_100106940
834 Ga0068862_100277367
835 Ga0075365_10200331
836 Ga0075364_10605420
837 Ga0075432_10422572
838 Ga0070716_100043072
839 Ga0070712_100000326
840 Ga0075362_10497012
841 Ga0075367_10273186
842 Ga0075367_10476433
843 Ga0075367_10792357
844 Ga0075366_10339896
845 Ga0075366_10375217
846 Ga0097621_100204565
847 Ga0097621_101446918
848 Ga0075370_10223251
849 Ga0075370_10343028
850 Ga0068871_100065938
851 Ga0075433_10507842
852 Ga0075434_100145282
853 Ga0075434_100324225
854 Ga0075429_100240526
855 Ga0068865_100000002
856 Ga0075436_100000038
857 Ga0075436_100045433
858 Ga0075436_100148920
859 Ga0097620_100000109
860 Ga0097620_100116243
861 Ga0075435_100064632
862 Ga0075435_101049089
863 Ga0105240_10046586
864 Ga0105240_11274987
865 Ga0105245_10006472
866 Ga0105245_10428445
867 Ga0105247_10154818
868 Ga0105243_10000799
869 Ga0105243_10079674
870 Ga0105243_10468581
871 Ga0105241_10005673
872 Ga0105241_10031304
873 Ga0105241_10892096
874 Ga0105241_12657856
875 Ga0105242_10018988
876 Ga0105242_10566587
877 Ga0105248_10033619
878 Ga0105237_10008776
879 Ga0105238_10003614
880 Ga0105238_10098507
881 Ga0105238_10371482
882 Ga0105238_11383381
883 Ga0105249_10130092
884 Ga0105249_10301742
885 Ga0105249_11366869
886 Ga0105239_10018447
887 Ga0105239_10024012
888 Ga0105239_13230049
889 Ga0105246_10003599
890 Ga0105246_10081653
891 Ga0105246_11588453
892 Ga0157373_10002679
893 Ga0157373_10270252
894 Ga0157373_10399206
895 Ga0157373_10720258
896 Ga0157371_10000030
897 Ga0157371_10643829
898 Ga0157370_10001209
899 Ga0157369_10053656
900 Ga0157369_10244857
901 Ga0157369_10848056
902 Ga0157374_10005851
903 Ga0157374_10092954
904 Ga0157378_10006716
905 Ga0157378_10401502
906 Ga0157378_10512223
907 Ga0163162_10112458
908 Ga0163162_11946548
909 Ga0157372_10087639
910 Ga0157375_10017158
911 Ga0157375_11542732
912 Ga0157375_13145782
913 Ga0163163_10428582
914 Ga0163163_11370638
915 Ga0157380_10260737
916 Ga0157380_10674917
917 Ga0157377_10278284
918 Ga0157377_10457216
919 Ga0157379_10011735
920 Ga0157379_10015825
921 Ga0157379_10236746
922 Ga0157379_10975574
923 Ga0157376_10000080
924 Ga0183363_1010
925 Ga0183363_1043
926 Ga0213876_10575086
927 Ga0213871_10003873
928 Ga0209646_1010646
929 Ga0209148_1001703
930 Ga0209455_1001220
931 Ga0207697_10419065
932 Ga0207656_10002600
933 Ga0207710_10111744
934 Ga0207680_10011714
935 Ga0207680_10033601
936 Ga0207680_10601007
937 Ga0207647_10013637
938 Ga0207647_10026075
939 Ga0207647_10044802
940 Ga0207647_10086756
941 Ga0207699_10000178
942 Ga0207645_10001923
943 Ga0207645_10080348
944 Ga0207645_10105491
945 Ga0207705_10000014
946 Ga0207705_10001011
947 Ga0207705_10004543
948 Ga0207705_10007609
949 Ga0207705_10007610
950 Ga0207705_10029941
951 Ga0207705_10092494
952 Ga0207705_10167540
953 Ga0207654_10000190
954 Ga0207654_10232996
955 Ga0207654_10250110
956 Ga0207654_11233645
957 Ga0207707_10038812
958 Ga0207707_10076990
959 Ga0207707_10537903
960 Ga0207695_10154467
961 Ga0207671_10056363
962 Ga0207671_10123552
963 Ga0207671_10287546
964 Ga0207693_10002536
965 Ga0207663_10314014
966 Ga0207660_10010711
967 Ga0207660_10080765
968 Ga0207660_10157055
969 Ga0207660_11061375
970 Ga0207662_10037565
971 Ga0207662_10229589
972 Ga0207657_10024501
973 Ga0207657_10062676
974 Ga0207657_10074135
975 Ga0207649_10002391
976 Ga0207652_10000005
977 Ga0207652_10000006
978 Ga0207652_10000007
979 Ga0207652_10000009
980 Ga0207652_10099616
981 Ga0207652_10238906
982 Ga0207652_10884763
983 Ga0207694_10024462
984 Ga0207694_10024835
985 Ga0207650_10075730
986 Ga0207650_11838699
987 Ga0207659_10037409
988 Ga0207687_10000630
989 Ga0207687_10524076
990 Ga0207700_10000010
991 Ga0207664_10139830
992 Ga0207664_10557791
993 Ga0207664_11293297
994 Ga0207644_10038842
995 Ga0207690_10005251
996 Ga0207690_10488113
997 Ga0207690_10990694
998 Ga0207690_11197064
999 Ga0207706_10054440
1000 Ga0207706_10149927
1001 Ga0207706_10164388
1002 Ga0207706_10193368
1003 Ga0207706_10322176
1004 Ga0207706_10511707
1005 Ga0207686_10118077
1006 Ga0207709_10000559
1007 Ga0207709_10054419
1008 Ga0207670_10295137
1009 Ga0207669_10007122
1010 Ga0207669_10030323
1011 Ga0207669_10075287
1012 Ga0207669_10368726
1013 Ga0207704_10000003
1014 Ga0207665_10068241
1015 Ga0207691_10635356
1016 Ga0207711_10003531
1017 Ga0207689_10000902
1018 Ga0207689_10042195
1019 Ga0207661_10328151
1020 Ga0207679_10010875
1021 Ga0207679_10448083
1022 Ga0207667_10000004
1023 Ga0207667_10015103
1024 Ga0207667_11077190
1025 Ga0207651_10000003
1026 Ga0207651_10468289
1027 Ga0207712_10262389
1028 Ga0207712_10270123
1029 Ga0207712_11089260
1030 Ga0207712_11256606
1031 Ga0207668_10053279
1032 Ga0207668_10768782
1033 Ga0207640_10040644
1034 Ga0207640_10180225
1035 Ga0207640_10575504
1036 Ga0207640_11581357
1037 Ga0207658_10015737
1038 Ga0207658_10123214
1039 Ga0207658_10816493
1040 Ga0207677_10001594
1041 Ga0207677_10018061
1042 Ga0207703_10026304
1043 Ga0207703_10075327
1044 Ga0207703_10390377
1045 Ga0207639_10003721
1046 Ga0207639_10005181
1047 Ga0207639_10020706
1048 Ga0207639_10022742
1049 Ga0207639_10048349
1050 Ga0207678_10010779
1051 Ga0207678_10047148
1052 Ga0207678_10534700
1053 Ga0207678_10611672
1054 Ga0207702_10000013
1055 Ga0207702_10004616
1056 Ga0207702_10006371
1057 Ga0207702_10166628
1058 Ga0207702_11555621
1059 Ga0207641_10164174
1060 Ga0207641_10819329
1061 Ga0207648_10000167
1062 Ga0207676_10008047
1063 Ga0207676_10012153
1064 Ga0207676_10410519
1065 Ga0207674_10000026
1066 Ga0207674_10010304
1067 Ga0207674_10034630
1068 Ga0207674_10144725
1069 Ga0207675_100007671
1070 Ga0207675_100378548
1071 Ga0207675_100859047
1072 Ga0207698_10021357
1073 Ga0207698_10126914
1074 Ga0209974_10043266
1075 Ga0209974_10137574
1076 Ga0268266_10313300
1077 Ga0268266_12307907
1078 Ga0268265_10000153
1079 Ga0268265_10025993
1080 Ga0268265_11407328
1081 Ga0268264_10014717
1082 Ga0268264_10028095
1083 Ga0268264_10861685
1084 Ga0268264_11812292
1085 Ga0307517_10006462
1086 Ga0307517_10045984
1087 Ga0307515_10034784
1088 Ga0307515_10059602
1089 Ga0265324_10072272
1090 Ga0307513_10003303
1091 Ga0307513_10896333
1092 Ga0307408_100015823
1093 Ga0307408_100021977
1094 Ga0307408_100290228
1095 Ga0307405_10157252
1096 Ga0307413_10010199
1097 Ga0307413_10236426
1098 Ga0307410_10022349
1099 Ga0307410_10040923
1100 Ga0307410_11342682
1101 Ga0307406_10013635
1102 Ga0307407_10216063
1103 Ga0307412_10018297
1104 Ga0307412_10038411
1105 Ga0307412_11557221
1106 Ga0307409_100017678
1107 Ga0307416_100003578
1108 Ga0307416_100170609
1109 Ga0307416_101447736
1110 Ga0307414_10008735
1111 Ga0307411_10106008
1112 Ga0307415_100046251
1113 Ga0307415_101274798
1114 Ga0373948_0156661
1115 Ga0373928_0048416
1116 Ga0373934_0061868
1117 Ga0373923_0055969
1118 Ga0373939_0166023
1119 Ga0373957_0019875
1120 Ga0373960_0020816
1121 Ga0373955_0166741
1122 Ga0373962_0099782
1123 Ga0373931_0083837
1124 Ga0373935_0911862
1125 Ga0373933_0008594
1126 Ga0373937_0056121
1127 Ga0373937_0134307
1128 Ga0395899_0032108
1129 Ga0395900_0142865
1130 Ga0395900_0518752
1131 Ga0395900_0821723
1132 Ga0395898_0068188
1133 Ga0395905_0017198
1134 Ga0395905_0077486
1135 Ga0395905_0080184
1136 Ga0395905_0120833
1137 Ga0395905_0198169
1138 Ga0395905_1196849
1139 Ga0436364_1151089
1140 Ga0436364_1397285
1141 Ga0395901_0088447
1142 Ga0395901_0161633
1143 Ga0395901_0268407
1144 Ga0395901_0374843
1145 Ga0436365_0015882
1146 Ga0436360_0414090
1147 Ga0451789_0713449
1148 Ga0451791_1579288
1149 Ga0451841_0680867
1150 Ga0451853_0717586
1151 Ga0439445_0257184
1152 Ga0439448_0000428
1153 Ga0439448_0003827
1154 Ga0439448_0255340
1155 Ga0439455_0005118
1156 Ga0439455_0005797
1157 Ga0439458_0000904
1158 Ga0466963_0014492
1159 Ga0466964_0072238
1160 Ga0466971_0027351
1161 Ga0466957_0031267
1162 Ga0466957_0087299
1163 Ga0466957_0810444
1164 Ga0466958_0084845
1165 Ga0466958_0560958
1166 Ga0466967_0011214
1167 Ga0466967_0209811
1168 Ga0466967_0222416
1169 Ga0495617_022285
1170 Ga0495627_000796
1171 Ga0495590_0001368
1172 Ga0495629_0243275
1173 Ga0495638_0171061
1174 Ga0495650_0000340
1175 Ga0495650_0059221
1176 Ga0495580_0015858
1177 Ga0495664_0076559
1178 Ga0495664_0774756
1179 Ga0495585_0245635
1180 Ga0495594_0241449
1181 Ga0495596_0117607
1182 Ga0495583_0002670
1183 Ga0495606_0156159
1184 Ga0495610_0003009
1185 Ga0495610_0010756
1186 Ga0495631_0337896
1187 Ga0495631_0345893
1188 Ga0495643_0001839
1189 Ga0495643_0086240
1190 Ga0495648_0029031
1191 Ga0495642_0078679
1192 Ga0495654_0079282
1193 Ga0495609_0224741
1194 Ga0495597_0036536
1195 Ga0495597_0134591
1196 Ga0495597_0207605
1197 Ga0495597_0217674
1198 Ga0495645_0144017
1199 Ga0495622_0111362
1200 Ga0495633_0008539
1201 Ga0495633_0034488
1202 Ga0495668_0000007
1203 Ga0495611_0080656
1204 Ga0495625_0000051
1205 Ga0495625_0000546
1206 Ga0495625_0020378
1207 Ga0495625_0116682
1208 Ga0495635_1026954
1209 Ga0495623_0460801
1210 Ga0495669_0000005
1211 Ga0495669_0146064
1212 Ga0495670_0065300
1213 Ga0495670_0218821
1214 Ga0495670_0450655
1215 Ga0495670_0507531
1216 Ga0495670_0684165
1217 Ga0495671_0042565
1218 Ga0495649_0066874
1219 Ga0495649_0116640
1220 Ga0495589_0011963
1221 Ga0495600_0009913
1222 Ga0495600_0570162
1223 Ga0495674_0012050
1224 Ga0495672_0002240
1225 Ga0495676_0180787
1226 Ga0495680_0082363
1227 Ga0495680_0770837
1228 Ga0495687_001752
1229 Ga0495687_040799
1230 Ga0495677_0041618
1231 Ga0495681_0110208
1232 Ga0495684_1065290
1233 Ga0495686_0000650
1234 Ga0495686_0002725
1235 Ga0495686_0017646
1236 Ga0495686_0194377
1237 Ga0495686_0354932
1238 Ga0495602_0323497
1239 Ga0495602_1144723
1240 Ga0496100_0018037
1241 Ga0496101_0041017
1242 Ga0496101_1423137
1243 Ga0496103_0665512
1244 Ga0496104_0040545
1245 Ga0496104_1182596
1246 Ga0496106_0008898
1247 Ga0496106_0441387
1248 Ga0496107_0004151
1249 Ga0496107_0231189
1250 Ga0496107_0237688
1251 Ga0496108_0019431
1252 Ga0496109_0009979
1253 Ga0496109_0051212
1254 Ga0496109_0373356
1255 Ga0496110_0004905
1256 Ga0496110_0206446
1257 Ga0496110_0898788
1258 Ga0496110_0973885
1259 Ga0496112_0376286
1260 Ga0496115_0309404
1261 Ga0496116_0166919
1262 Ga0496117_0063816
1263 Ga0496120_0025766
1264 Ga0496121_0007846
1265 Ga0496122_0064194
1266 Ga0496124_0423793
1267 Ga0496126_0897732
1268 Ga0495678_001535
1269 Ga0501047_0682871
1270 Ga0501071_0371805
1271 Ga0501202_106395
1272 Ga0501240_094884
1273 Ga0501249_142165
1274 Ga0501267_051452
1275 Ga0501044_0479513
1276 nmdc:mga03683_464672_c1
1277 nmdc:mga00v17_540907_c1
1278 nmdc:mga0yw44_56241_c1
1279 nmdc:mga0k408_154027_c1
1280 nmdc:mga0k408_356373_c1
1281 nmdc:mga0k408_71709_c1
1282 nmdc:mga06z11_436324_c1
1283 nmdc:mga06z11_461318_c1
1284 nmdc:mga07m45_268035_c1
1285 nmdc:mga09592_161628_c1
1286 nmdc:mga0n895_128911_c1
1287 nmdc:mga0rr50_89935_c1
1288 nmdc:mga0rr50_999895_c1
1289 nmdc:mga08x19_205461_c1
1290 nmdc:mga08x19_95_c1
1291 Ga0495601_0004621
1292 Ga0495601_0090950
1293 Ga0495601_0289570
1294 Ga0495612_0001956
1295 Ga0495655_0266501
1296 Ga0495619_0015256
1297 Ga0495619_0060638
1298 Ga0500578_0000004
1299 Ga0500643_000252
1300 Ga0500643_004223
1301 Ga0500643_008423
1302 Ga0500643_018580
1303 Ga0500643_111679
1304 Ga0500643_145797
1305 Ga0500644_0002781
1306 Ga0500644_0182817
1307 Ga0500646_0069388
1308 Ga0500646_0214585
1309 Ga0500651_0384163
1310 Ga0500566_0478474
1311 Ga0500641_0000218
1312 Ga0500641_0000613
1313 Ga0500650_0000065
1314 Ga0500650_0472540
1315 Ga0500555_087709
1316 Ga0500556_0008066
1317 Ga0500556_0061187
1318 Ga0500557_102987
1319 Ga0500562_006019
1320 Ga0500562_034712
1321 Ga0500562_103296
1322 Ga0500592_010915
1323 Ga0500594_0000204
1324 Ga0500595_001019
1325 Ga0500595_001397
1326 Ga0500595_033821
1327 Ga0500607_233126
1328 Ga0500655_048044
1329 Ga0500559_0090999
1330 Ga0500568_0000145
1331 Ga0500568_0048239
1332 Ga0500573_0251956
1333 Ga0500577_0001343
1334 Ga0500588_0035766
1335 Ga0500604_0032611
1336 Ga0500616_0000080
1337 Ga0500616_0008437
1338 Ga0500616_0014413
1339 Ga0500616_0298469
1340 Ga0500622_0001052
1341 Ga0500622_0088499
1342 Ga0500636_0022842
1343 Ga0500645_001100
1344 Ga0500645_011652
1345 Ga0500552_096353
1346 Ga0500596_001380
1347 Ga0466962_0031561
1348 2511124830
1349 2585146382
1350 2600204244
1351 2643922380
1352 2643998385
1353 2644086754
1354 2644341708
1355 2644367995
1356 2753767541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c5q-assembly1.cif.gz_B crystal structure of yeast yer010cp 0.6725 48 98
8ddj-assembly1.cif.gz_A open mscs in pc14.1 nanodiscs 0.5075 22 115
6vvo-assembly1.cif.gz_D structure of the human clamp loader (replication factor c, rfc) bound to the sliding clamp (proliferating cell nuclear antigen, pcna) 0.4981 43 102
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.4654 9 102
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.4397 2 102
ID Description Score Start End Superfamily
af_Q2FUQ7_4_112_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.798 6 110 1.10.10.1740
af_Q2FUQ6_7_117_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.785 6 108 1.10.10.1740
af_Q2FUQ7_4_112_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7674 6 110 1.10.10.1740
af_Q2FUQ6_7_117_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7304 6 108 1.10.10.1740
af_P0C0S1_27_128_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6921 57 115 1.10.287.1260
ID Description Score Start End GO Terms
AF-A0A3S0R4L8-F1-model_v4 DUF3147 family protein 0.9988 1 116 GO:0016020
AF-A0A2D8D3J3-F1-model_v4 Peptide ABC transporter permease 0.9914 1 116 GO:0016020
AF-B0T6A3-F1-model_v4 Peptide ABC transporter permease 0.9912 1 116 GO:0016020
AF-A0A1V1V2P5-F1-model_v4 DUF3147 family protein 0.986 1 116 GO:0016020
AF-A0A6J4SSN5-F1-model_v4 DUF3147 family protein 0.9818 1 116 GO:0016020

Map