F474692

General Info

Members Datasets Scaffolds Average Seq Length
678 314 1356 369

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2885427238|2885427557
Length 462
Sequence LKMPALSPTMEEGTLAKWLIKEGDTVASGDILAEIETDKATMEFEAVDEGKVLKILVAEGSDGVKVGTPIAMIGEEGEEGGVAGAATAPAQAPAPADTDKEQPSPGQPAAGGSYAPTAAPPAPGGGETPTAPASPAQSGGGDGDTGYRPPPIPKGEPAARANDSARIKASPLARRLAEAQGIDLSTITGSGPGGRIVRADLGDKGGGRPSQVQPAAAPAPALQPQASQVDPGEIPHEAVKLSNMRKTIARRLTESKQQVPHIYLTVDVQLDRLLKLRAELNDGLASRGVKLSVNDMLIKALALALIEVPECNVSFAGDTLIKYSRADISVAVSIPGGLITPIIAGANDKTLSKISTEMGELAGRAKEGKLQPHEYQGGTASLSNMGMFGIKQFEAVINPPQGMIMAIGAGEKRPFVIADSLQIATVMSATGSFDHRAIDGADGARLMQAFRALCERPMGLVA

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
191 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
192 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
193 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
194 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
229 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
267 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
268 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
269 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
270 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
271 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
272 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
273 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
274 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
275 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
276 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
277 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
278 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
279 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
280 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
283 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
284 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
287 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
288 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
289 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
290 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
291 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
292 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
293 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
294 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
295 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
296 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
297 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
298 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
299 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
300 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
301 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
302 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
303 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
304 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
305 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
306 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
307 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
308 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
309 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
310 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
311 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
312 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
313 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
314 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.87
Metatranscriptomes 0
Isolates 4.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9
Nodule 0
Rhizoplane 5.01
Rhizosphere 78.02
Stem 0
Stem Tuber 0.15
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001126 3300001904 Bacteria 4898
2 JGI24741J21665_1000819 3300001915 Bacteria 9353
3 JGI24740J21852_10006234 3300001979 Bacteria 4962
4 JGI24740J21852_10009346 3300001979 Bacteria 3846
5 JGI24739J22299_10004115 3300001989 Bacteria 5563
6 JGI24737J22298_10001056 3300001990 Bacteria 9731
7 JGI24744J21845_10001869 3300002077 Bacteria 4226
8 JGI25165J46597_1000023 3300003214 Bacteria 338873
9 JGI25165J46597_1000095 3300003214 Bacteria 163883
10 JGI25153J46596_10000010 3300003215 Bacteria 337769
11 JGI25153J46596_10000031 3300003215 Bacteria 196926
12 Ga0055525_1000012 3300003759 Bacteria 486564
13 Ga0055542_1000322 3300003762 Bacteria 51124
14 Ga0055529_1000014 3300003763 Bacteria 367283
15 Ga0055536_1000422 3300003781 Bacteria 30230
16 Ga0055534_1004498 3300003784 Bacteria 4020
17 Ga0055530_10000013 3300003791 Bacteria 153390
18 Ga0055531_10000449 3300003794 Bacteria 38308
19 Ga0055531_10005592 3300003794 Bacteria 7320
20 Ga0065165_1003177 3300005262 Bacteria 12034
21 Ga0065704_10081931 3300005289 Bacteria 3681
22 Ga0070658_10000536 3300005327 Bacteria 32936
23 Ga0070658_10001914 3300005327 Bacteria 17560
24 Ga0070658_10002770 3300005327 Bacteria 14576
25 Ga0070658_10023150 3300005327 Bacteria 4987
26 Ga0070658_10070918 3300005327 Bacteria 2853
27 Ga0070658_10112917 3300005327 Bacteria 2252
28 Ga0070658_10145987 3300005327 Bacteria 1978
29 Ga0070676_10000031 3300005328 Bacteria 42113
30 Ga0070683_100012146 3300005329 Bacteria 7474
31 Ga0070683_100096732 3300005329 Bacteria 2777
32 Ga0070670_100000344 3300005331 Bacteria 39044
33 Ga0070670_100001938 3300005331 Bacteria 16935
34 Ga0070670_100005554 3300005331 Bacteria 10638
35 Ga0070670_100005597 3300005331 Bacteria 10598
36 Ga0070670_100007510 3300005331 Bacteria 9256
37 Ga0070670_100019126 3300005331 Bacteria 5873
38 Ga0070670_100057317 3300005331 Bacteria 3345
39 Ga0070670_100216764 3300005331 Bacteria 1665
40 Ga0070666_10000160 3300005335 Bacteria 46166
41 Ga0070666_10006279 3300005335 Bacteria 7308
42 Ga0070666_10012951 3300005335 Bacteria 5278
43 Ga0070666_10041785 3300005335 Bacteria 3065
44 Ga0070680_100006780 3300005336 Bacteria 8725
45 Ga0070680_100081701 3300005336 Bacteria 2666
46 Ga0070680_100121595 3300005336 Bacteria 2180
47 Ga0068868_100000403 3300005338 Bacteria 29340
48 Ga0068868_100039288 3300005338 Bacteria 3677
49 Ga0070660_100000700 3300005339 Bacteria 22233
50 Ga0070660_100004814 3300005339 Bacteria 9338
51 Ga0070660_100035146 3300005339 Bacteria 3792
52 Ga0070660_100035906 3300005339 Bacteria 3752
53 Ga0070660_100037408 3300005339 Bacteria 3679
54 Ga0070660_100043991 3300005339 Bacteria 3413
55 Ga0070660_100072829 3300005339 Bacteria 2685
56 Ga0070660_100101908 3300005339 Bacteria 2275
57 Ga0070661_100000130 3300005344 Bacteria 62986
58 Ga0070661_100004468 3300005344 Bacteria 9646
59 Ga0070661_100005092 3300005344 Bacteria 9069
60 Ga0070661_100023171 3300005344 Bacteria 4449
61 Ga0070661_100039939 3300005344 Bacteria 3420
62 Ga0070661_100042155 3300005344 Bacteria 3331
63 Ga0070661_100055001 3300005344 Bacteria 2915
64 Ga0070668_100000028 3300005347 Bacteria 89707
65 Ga0070668_100000049 3300005347 Bacteria 74953
66 Ga0070668_100034913 3300005347 Bacteria 3833
67 Ga0070669_100000013 3300005353 Bacteria 210577
68 Ga0070669_100000715 3300005353 Bacteria 24287
69 Ga0070669_100028017 3300005353 Bacteria 4056
70 Ga0070675_100002284 3300005354 Bacteria 14214
71 Ga0070675_100090365 3300005354 Bacteria 2565
72 Ga0070671_100000009 3300005355 Bacteria 206508
73 Ga0070671_100000269 3300005355 Bacteria 35055
74 Ga0070671_100002542 3300005355 Bacteria 14135
75 Ga0070671_100003648 3300005355 Bacteria 12059
76 Ga0070671_100007269 3300005355 Bacteria 8850
77 Ga0070671_100073908 3300005355 Bacteria 2847
78 Ga0070674_100057051 3300005356 Bacteria 2710
79 Ga0070673_100000022 3300005364 Bacteria 92156
80 Ga0070659_100013393 3300005366 Bacteria 6102
81 Ga0070659_100030333 3300005366 Bacteria 4185
82 Ga0070659_100032663 3300005366 Bacteria 4038
83 Ga0070667_100000009 3300005367 Bacteria 281488
84 Ga0070667_100004908 3300005367 Bacteria 11207
85 Ga0070667_100013603 3300005367 Bacteria 6723
86 Ga0070667_100061234 3300005367 Bacteria 3186
87 Ga0070705_100008071 3300005440 Bacteria 5206
88 Ga0070663_100001359 3300005455 Bacteria 13373
89 Ga0070663_100022084 3300005455 Bacteria 4247
90 Ga0070663_100064573 3300005455 Bacteria 2646
91 Ga0070678_100000060 3300005456 Bacteria 39901
92 Ga0070678_100097180 3300005456 Bacteria 2274
93 Ga0070662_100040801 3300005457 Bacteria 3307
94 Ga0070662_100101657 3300005457 Bacteria 2176
95 Ga0070681_10002429 3300005458 Bacteria 17046
96 Ga0068867_100000023 3300005459 Bacteria 92322
97 Ga0068867_100003900 3300005459 Bacteria 10494
98 Ga0068867_100046955 3300005459 Bacteria 3173
99 Ga0070679_100000021 3300005530 Bacteria 124652
100 Ga0070679_100016861 3300005530 Bacteria 7060
101 Ga0070679_100023181 3300005530 Bacteria 6075
102 Ga0068853_100009284 3300005539 Bacteria 7932
103 Ga0068853_100147801 3300005539 Bacteria 2113
104 Ga0070672_100219300 3300005543 Bacteria 1595
105 Ga0070686_100047865 3300005544 Bacteria 2706
106 Ga0070696_100015568 3300005546 Bacteria 5109
107 Ga0070665_100000115 3300005548 Bacteria 151164
108 Ga0070665_100002028 3300005548 Bacteria 22780
109 Ga0070665_100007685 3300005548 Bacteria 10951
110 Ga0070665_100272455 3300005548 Bacteria 1694
111 Ga0068855_100040917 3300005563 Bacteria 5497
112 Ga0068855_100230639 3300005563 Bacteria 2073
113 Ga0070664_100005447 3300005564 Bacteria 10217
114 Ga0070664_100101878 3300005564 Bacteria 2497
115 Ga0068857_100015874 3300005577 Bacteria 6591
116 Ga0068857_100025761 3300005577 Bacteria 5178
117 Ga0068854_100011704 3300005578 Bacteria 5721
118 Ga0068854_100014036 3300005578 Bacteria 5273
119 Ga0068854_100026006 3300005578 Bacteria 4018
120 Ga0068856_100004367 3300005614 Bacteria 14088
121 Ga0068856_100252040 3300005614 Bacteria 1780
122 Ga0068852_100091189 3300005616 Bacteria 2727
123 Ga0068859_100000202 3300005617 Bacteria 58573
124 Ga0068859_100141010 3300005617 Bacteria 2484
125 Ga0068859_100235364 3300005617 Bacteria 1920
126 Ga0068864_100001677 3300005618 Bacteria 18219
127 Ga0068864_100002974 3300005618 Bacteria 14012
128 Ga0068864_100143016 3300005618 Bacteria 2160
129 Ga0068851_10008051 3300005834 Bacteria 4864
130 Ga0068851_10024511 3300005834 Bacteria 2954
131 Ga0068863_100000092 3300005841 Bacteria 97076
132 Ga0068863_100006027 3300005841 Bacteria 11892
133 Ga0068863_100027707 3300005841 Bacteria 5406
134 Ga0068863_100030672 3300005841 Bacteria 5133
135 Ga0068863_100053836 3300005841 Bacteria 3815
136 Ga0068863_100071078 3300005841 Bacteria 3292
137 Ga0068858_100000261 3300005842 Bacteria 56197
138 Ga0068858_100000380 3300005842 Bacteria 46520
139 Ga0068858_100001609 3300005842 Bacteria 23039
140 Ga0068858_100042830 3300005842 Bacteria 4197
141 Ga0068858_100058043 3300005842 Bacteria 3577
142 Ga0068860_100000042 3300005843 Bacteria 227404
143 Ga0068860_100064458 3300005843 Bacteria 3480
144 Ga0068862_100000411 3300005844 Bacteria 46404
145 Ga0068862_100008302 3300005844 Bacteria 8594
146 Ga0068862_100010722 3300005844 Bacteria 7567
147 Ga0081539_10066829 3300005985 Bacteria 1947
148 Ga0075369_10025086 3300006186 Bacteria 2477
149 Ga0075366_10063596 3300006195 Bacteria 2193
150 Ga0068865_100000031 3300006881 Bacteria 88580
151 Ga0097620_100000202 3300006931 Bacteria 58573
152 Ga0097620_100141005 3300006931 Bacteria 2484
153 Ga0097620_100235363 3300006931 Bacteria 1920
154 Ga0075435_100013014 3300007076 Bacteria 6176
155 Ga0105240_10009242 3300009093 Bacteria 13982
156 Ga0105240_10021138 3300009093 Bacteria 8663
157 Ga0105240_10390038 3300009093 Bacteria 1571
158 Ga0105245_10002151 3300009098 Bacteria 17853
159 Ga0105245_10013418 3300009098 Bacteria 7137
160 Ga0105243_10000156 3300009148 Bacteria 78467
161 Ga0105243_10001186 3300009148 Bacteria 23513
162 Ga0105241_10209037 3300009174 Bacteria 1634
163 Ga0105242_10004742 3300009176 Bacteria 10529
164 Ga0105248_10001787 3300009177 Bacteria 23901
165 Ga0105248_10005414 3300009177 Bacteria 14027
166 Ga0105248_10016331 3300009177 Bacteria 8171
167 Ga0105248_10054516 3300009177 Bacteria 4484
168 Ga0105237_10005078 3300009545 Bacteria 14953
169 Ga0105237_10170457 3300009545 Bacteria 2176
170 Ga0105238_10112091 3300009551 Bacteria 2707
171 Ga0105249_10001604 3300009553 Bacteria 19800
172 Ga0105249_10004663 3300009553 Bacteria 11838
173 Ga0105249_10031092 3300009553 Bacteria 4827
174 Ga0105249_10125159 3300009553 Bacteria 2447
175 Ga0105246_10000157 3300011119 Bacteria 32454
176 Ga0157373_10019332 3300013100 Bacteria 4961
177 Ga0157373_10105584 3300013100 Bacteria 1981
178 Ga0157371_10000193 3300013102 Bacteria 90182
179 Ga0157371_10014561 3300013102 Bacteria 5931
180 Ga0157371_10130838 3300013102 Bacteria 1785
181 Ga0157370_10007287 3300013104 Bacteria 12070
182 Ga0157370_10028708 3300013104 Bacteria 5469
183 Ga0157369_10005353 3300013105 Bacteria 14954
184 Ga0157369_10056253 3300013105 Bacteria 4245
185 Ga0157369_10062188 3300013105 Bacteria 4024
186 Ga0157369_10091370 3300013105 Bacteria 3250
187 Ga0157369_10215604 3300013105 Bacteria 2011
188 Ga0157369_10264064 3300013105 Bacteria 1795
189 Ga0157374_10000656 3300013296 Bacteria 30436
190 Ga0157374_10002399 3300013296 Bacteria 15803
191 Ga0157378_10000504 3300013297 Bacteria 37070
192 Ga0163162_10017961 3300013306 Bacteria 6921
193 Ga0163162_10113135 3300013306 Bacteria 2813
194 Ga0163162_10132014 3300013306 Bacteria 2606
195 Ga0157372_10030188 3300013307 Bacteria 5927
196 Ga0157372_10060288 3300013307 Bacteria 4246
197 Ga0157375_10003473 3300013308 Bacteria 13661
198 Ga0157375_10104117 3300013308 Bacteria 2926
199 Ga0157375_10278903 3300013308 Bacteria 1834
200 Ga0163163_10136381 3300014325 Bacteria 2495
201 Ga0157380_10004583 3300014326 Bacteria 9594
202 Ga0157377_10003378 3300014745 Bacteria 7219
203 Ga0157379_10005137 3300014968 Bacteria 11231
204 Ga0157379_10224012 3300014968 Bacteria 1704
205 Ga0157376_10000124 3300014969 Bacteria 53299
206 Ga0213876_10003188 3300021384 Bacteria 9435
207 Ga0213875_10007292 3300021388 Bacteria 5723
208 Ga0209563_100030 3300025230 Bacteria 489259
209 Ga0209437_103045 3300025233 Bacteria 3099
210 Ga0209026_1002932 3300025250 Bacteria 5962
211 Ga0209677_107247 3300025253 Bacteria 2404
212 Ga0209148_1000011 3300025254 Bacteria 1196503
213 Ga0209148_1000059 3300025254 Bacteria 350224
214 Ga0209233_1000003 3300025261 Bacteria 1607366
215 Ga0209233_1000052 3300025261 Bacteria 445813
216 Ga0209455_1000006 3300025272 Bacteria 1196503
217 Ga0209675_1000025 3300025291 Bacteria 294102
218 Ga0209676_1000221 3300025292 Bacteria 124715
219 Ga0209676_1000483 3300025292 Bacteria 65133
220 Ga0209025_1010313 3300025294 Bacteria 6346
221 Ga0209758_1000001 3300025297 Bacteria 1981790
222 Ga0209758_1000033 3300025297 Bacteria 469998
223 Ga0209050_1000042 3300025298 Bacteria 402842
224 Ga0209050_1001210 3300025298 Bacteria 30282
225 Ga0209257_1000135 3300025304 Bacteria 205668
226 Ga0209257_1000532 3300025304 Bacteria 66089
227 Ga0209257_1015531 3300025304 Bacteria 3161
228 Ga0207697_10019384 3300025315 Bacteria 2786
229 Ga0207697_10033709 3300025315 Bacteria 2095
230 Ga0207656_10002880 3300025321 Bacteria 5865
231 Ga0207656_10004383 3300025321 Bacteria 4925
232 Ga0207696_1014662 3300025711 Bacteria 2681
233 Ga0207682_10002218 3300025893 Bacteria 8762
234 Ga0207680_10001079 3300025903 Bacteria 12871
235 Ga0207680_10004576 3300025903 Bacteria 6568
236 Ga0207647_10000038 3300025904 Bacteria 94897
237 Ga0207647_10024022 3300025904 Bacteria 4022
238 Ga0207647_10040387 3300025904 Bacteria 2939
239 Ga0207645_10028697 3300025907 Bacteria 3591
240 Ga0207705_10000059 3300025909 Bacteria 155683
241 Ga0207705_10000178 3300025909 Bacteria 67084
242 Ga0207705_10000237 3300025909 Bacteria 54736
243 Ga0207705_10000511 3300025909 Bacteria 33036
244 Ga0207705_10002823 3300025909 Bacteria 13285
245 Ga0207705_10014106 3300025909 Bacteria 5757
246 Ga0207705_10021462 3300025909 Bacteria 4609
247 Ga0207654_10000227 3300025911 Bacteria 34512
248 Ga0207654_10048133 3300025911 Bacteria 2439
249 Ga0207707_10034592 3300025912 Bacteria 4421
250 Ga0207695_10015591 3300025913 Bacteria 8939
251 Ga0207695_10025115 3300025913 Bacteria 6683
252 Ga0207695_10051267 3300025913 Bacteria 4335
253 Ga0207695_10080646 3300025913 Bacteria 3295
254 Ga0207671_10002570 3300025914 Bacteria 19248
255 Ga0207671_10004432 3300025914 Bacteria 13437
256 Ga0207671_10009213 3300025914 Bacteria 8280
257 Ga0207660_10003328 3300025917 Bacteria 10490
258 Ga0207660_10036415 3300025917 Bacteria 3421
259 Ga0207657_10000289 3300025919 Bacteria 53536
260 Ga0207657_10001241 3300025919 Bacteria 27265
261 Ga0207657_10001372 3300025919 Bacteria 25957
262 Ga0207657_10011870 3300025919 Bacteria 8623
263 Ga0207657_10026062 3300025919 Bacteria 5379
264 Ga0207657_10071295 3300025919 Bacteria 2942
265 Ga0207657_10077725 3300025919 Bacteria 2796
266 Ga0207657_10115251 3300025919 Bacteria 2215
267 Ga0207649_10000134 3300025920 Bacteria 63335
268 Ga0207649_10003792 3300025920 Bacteria 8244
269 Ga0207649_10004660 3300025920 Bacteria 7421
270 Ga0207649_10012897 3300025920 Bacteria 4654
271 Ga0207649_10131843 3300025920 Bacteria 1699
272 Ga0207652_10000047 3300025921 Bacteria 125286
273 Ga0207652_10005457 3300025921 Bacteria 10320
274 Ga0207652_10015360 3300025921 Bacteria 6218
275 Ga0207652_10044682 3300025921 Bacteria 3775
276 Ga0207681_10000008 3300025923 Bacteria 414329
277 Ga0207681_10002989 3300025923 Bacteria 10627
278 Ga0207681_10048215 3300025923 Bacteria 2874
279 Ga0207694_10000683 3300025924 Bacteria 30452
280 Ga0207650_10001881 3300025925 Bacteria 14819
281 Ga0207650_10018173 3300025925 Bacteria 4931
282 Ga0207650_10101789 3300025925 Bacteria 2212
283 Ga0207650_10136167 3300025925 Bacteria 1927
284 Ga0207659_10021352 3300025926 Bacteria 4296
285 Ga0207687_10000798 3300025927 Bacteria 21269
286 Ga0207664_10028396 3300025929 Bacteria 4251
287 Ga0207644_10000006 3300025931 Bacteria 408793
288 Ga0207644_10000088 3300025931 Bacteria 65977
289 Ga0207644_10000094 3300025931 Bacteria 64592
290 Ga0207644_10003333 3300025931 Bacteria 10365
291 Ga0207644_10048321 3300025931 Bacteria 3041
292 Ga0207644_10074058 3300025931 Bacteria 2498
293 Ga0207690_10001226 3300025932 Bacteria 16188
294 Ga0207690_10031664 3300025932 Bacteria 3387
295 Ga0207690_10068645 3300025932 Bacteria 2436
296 Ga0207706_10001712 3300025933 Bacteria 21630
297 Ga0207706_10053046 3300025933 Bacteria 3580
298 Ga0207686_10001385 3300025934 Bacteria 13769
299 Ga0207709_10000246 3300025935 Bacteria 66685
300 Ga0207709_10000447 3300025935 Bacteria 38701
301 Ga0207669_10000030 3300025937 Bacteria 88341
302 Ga0207669_10000989 3300025937 Bacteria 12093
303 Ga0207669_10039652 3300025937 Bacteria 2724
304 Ga0207669_10057738 3300025937 Bacteria 2364
305 Ga0207704_10000008 3300025938 Bacteria 204682
306 Ga0207691_10023274 3300025940 Bacteria 5832
307 Ga0207691_10062142 3300025940 Bacteria 3391
308 Ga0207691_10085922 3300025940 Bacteria 2823
309 Ga0207691_10287244 3300025940 Bacteria 1415
310 Ga0207711_10000946 3300025941 Bacteria 27905
311 Ga0207711_10001082 3300025941 Bacteria 26041
312 Ga0207711_10006078 3300025941 Bacteria 10202
313 Ga0207689_10000701 3300025942 Bacteria 32104
314 Ga0207689_10025288 3300025942 Bacteria 4975
315 Ga0207661_10015224 3300025944 Bacteria 5656
316 Ga0207661_10128219 3300025944 Bacteria 2169
317 Ga0207679_10028352 3300025945 Bacteria 3884
318 Ga0207679_10062649 3300025945 Bacteria 2772
319 Ga0207679_10153505 3300025945 Bacteria 1877
320 Ga0207667_10000002 3300025949 Bacteria 895662
321 Ga0207667_10006208 3300025949 Bacteria 14505
322 Ga0207667_10027810 3300025949 Bacteria 6150
323 Ga0207667_10034843 3300025949 Bacteria 5403
324 Ga0207667_10064884 3300025949 Bacteria 3810
325 Ga0207667_10161261 3300025949 Bacteria 2306
326 Ga0207667_10178536 3300025949 Bacteria 2181
327 Ga0207651_10000008 3300025960 Bacteria 204538
328 Ga0207712_10008250 3300025961 Bacteria 6584
329 Ga0207712_10033435 3300025961 Bacteria 3476
330 Ga0207668_10000076 3300025972 Bacteria 75056
331 Ga0207668_10000731 3300025972 Bacteria 20103
332 Ga0207668_10189232 3300025972 Bacteria 1630
333 Ga0207640_10002626 3300025981 Bacteria 9629
334 Ga0207640_10006133 3300025981 Bacteria 6575
335 Ga0207640_10022315 3300025981 Bacteria 3786
336 Ga0207640_10081303 3300025981 Bacteria 2215
337 Ga0207658_10000002 3300025986 Bacteria 1364188
338 Ga0207658_10001246 3300025986 Bacteria 20116
339 Ga0207658_10008943 3300025986 Bacteria 6793
340 Ga0207658_10009111 3300025986 Bacteria 6733
341 Ga0207677_10000091 3300026023 Bacteria 74163
342 Ga0207677_10010628 3300026023 Bacteria 5214
343 Ga0207703_10000253 3300026035 Bacteria 60255
344 Ga0207703_10000847 3300026035 Bacteria 30021
345 Ga0207703_10000896 3300026035 Bacteria 29159
346 Ga0207703_10001312 3300026035 Bacteria 23010
347 Ga0207703_10022154 3300026035 Bacteria 4980
348 Ga0207639_10012330 3300026041 Bacteria 5952
349 Ga0207639_10027739 3300026041 Bacteria 4128
350 Ga0207639_10061676 3300026041 Bacteria 2897
351 Ga0207639_10266005 3300026041 Bacteria 1502
352 Ga0207678_10001389 3300026067 Bacteria 22281
353 Ga0207678_10002781 3300026067 Bacteria 15861
354 Ga0207678_10079085 3300026067 Bacteria 2816
355 Ga0207702_10011067 3300026078 Bacteria 7531
356 Ga0207702_10034470 3300026078 Bacteria 4232
357 Ga0207702_10115054 3300026078 Bacteria 2398
358 Ga0207702_10150367 3300026078 Bacteria 2117
359 Ga0207702_10213199 3300026078 Bacteria 1796
360 Ga0207641_10000004 3300026088 Bacteria 481088
361 Ga0207641_10001025 3300026088 Bacteria 28336
362 Ga0207641_10004732 3300026088 Bacteria 11737
363 Ga0207641_10006197 3300026088 Bacteria 10119
364 Ga0207641_10007148 3300026088 Bacteria 9321
365 Ga0207641_10032708 3300026088 Bacteria 4319
366 Ga0207648_10000009 3300026089 Bacteria 204229
367 Ga0207648_10016823 3300026089 Bacteria 6668
368 Ga0207648_10032807 3300026089 Bacteria 4582
369 Ga0207676_10001115 3300026095 Bacteria 20336
370 Ga0207676_10012257 3300026095 Bacteria 6136
371 Ga0207676_10068907 3300026095 Bacteria 2831
372 Ga0207674_10003055 3300026116 Bacteria 20711
373 Ga0207674_10012450 3300026116 Bacteria 9506
374 Ga0207674_10023243 3300026116 Bacteria 6641
375 Ga0207674_10024567 3300026116 Bacteria 6435
376 Ga0207674_10060765 3300026116 Bacteria 3821
377 Ga0207675_100006088 3300026118 Bacteria 11475
378 Ga0207675_100031426 3300026118 Bacteria 4946
379 Ga0207683_10000075 3300026121 Bacteria 77829
380 Ga0207683_10014781 3300026121 Bacteria 6644
381 Ga0207683_10019752 3300026121 Bacteria 5755
382 Ga0207683_10127463 3300026121 Bacteria 2288
383 Ga0207683_10143593 3300026121 Bacteria 2151
384 Ga0207683_10177557 3300026121 Bacteria 1930
385 Ga0207683_10303379 3300026121 Bacteria 1461
386 Ga0207698_10008427 3300026142 Bacteria 6521
387 Ga0268266_10000015 3300028379 Bacteria 630629
388 Ga0268266_10005032 3300028379 Bacteria 12478
389 Ga0268266_10030749 3300028379 Bacteria 4561
390 Ga0268266_10037453 3300028379 Bacteria 4132
391 Ga0268265_10000392 3300028380 Bacteria 46740
392 Ga0268265_10000582 3300028380 Bacteria 36910
393 Ga0268265_10028903 3300028380 Bacteria 3974
394 Ga0268265_10070971 3300028380 Bacteria 2710
395 Ga0268265_10103527 3300028380 Bacteria 2305
396 Ga0268264_10000001 3300028381 Bacteria 1221000
397 Ga0268264_10000310 3300028381 Bacteria 78142
398 Ga0268264_10004774 3300028381 Bacteria 11499
399 Ga0307517_10074308 3300028786 Bacteria 2999
400 Ga0307515_10259608 3300028794 Bacteria 1476
401 Ga0265320_10082223 3300031240 Bacteria 1502
402 Ga0307513_10008420 3300031456 Bacteria 13207
403 Ga0307513_10043231 3300031456 Bacteria 4952
404 Ga0307408_100006783 3300031548 Bacteria 7590
405 Ga0307408_100011783 3300031548 Bacteria 5783
406 Ga0307408_100023154 3300031548 Bacteria 4228
407 Ga0307408_100046549 3300031548 Bacteria 3103
408 Ga0307508_10000317 3300031616 Bacteria 58176
409 Ga0307405_10021699 3300031731 Bacteria 3615
410 Ga0307405_10118278 3300031731 Bacteria 1808
411 Ga0307405_10151293 3300031731 Bacteria 1632
412 Ga0307413_10010952 3300031824 Bacteria 4430
413 Ga0307413_10034949 3300031824 Bacteria 2878
414 Ga0307413_10120854 3300031824 Bacteria 1774
415 Ga0307410_10003471 3300031852 Bacteria 7910
416 Ga0307410_10055511 3300031852 Bacteria 2689
417 Ga0307410_10065496 3300031852 Bacteria 2499
418 Ga0307410_10075957 3300031852 Bacteria 2344
419 Ga0307410_10089542 3300031852 Bacteria 2181
420 Ga0307410_10124425 3300031852 Bacteria 1885
421 Ga0307406_10022142 3300031901 Bacteria 3768
422 Ga0307406_10088807 3300031901 Bacteria 2075
423 Ga0307406_10124168 3300031901 Bacteria 1800
424 Ga0307407_10053599 3300031903 Bacteria 2321
425 Ga0307407_10079225 3300031903 Bacteria 1981
426 Ga0307412_10000557 3300031911 Bacteria 22165
427 Ga0307412_10001749 3300031911 Bacteria 12005
428 Ga0307412_10005086 3300031911 Bacteria 7355
429 Ga0307412_10027029 3300031911 Bacteria 3573
430 Ga0307412_10083568 3300031911 Bacteria 2214
431 Ga0307412_10093027 3300031911 Bacteria 2114
432 Ga0307412_10123685 3300031911 Bacteria 1867
433 Ga0307409_100010084 3300031995 Bacteria 5847
434 Ga0307409_100028665 3300031995 Bacteria 3971
435 Ga0307409_100037418 3300031995 Bacteria 3578
436 Ga0307409_100052098 3300031995 Bacteria 3136
437 Ga0307409_100139807 3300031995 Bacteria 2084
438 Ga0307409_100183054 3300031995 Bacteria 1857
439 Ga0307416_100016486 3300032002 Bacteria 5139
440 Ga0307416_100087366 3300032002 Bacteria 2661
441 Ga0307416_100251629 3300032002 Bacteria 1720
442 Ga0307414_10000288 3300032004 Bacteria 29634
443 Ga0307414_10006350 3300032004 Bacteria 6585
444 Ga0307414_10015729 3300032004 Bacteria 4576
445 Ga0307414_10018174 3300032004 Bacteria 4320
446 Ga0307414_10070228 3300032004 Bacteria 2521
447 Ga0307414_10081531 3300032004 Bacteria 2369
448 Ga0307414_10085284 3300032004 Bacteria 2326
449 Ga0307414_10170380 3300032004 Bacteria 1740
450 Ga0307411_10005369 3300032005 Bacteria 6285
451 Ga0307411_10005662 3300032005 Bacteria 6165
452 Ga0307411_10008930 3300032005 Bacteria 5231
453 Ga0307411_10009704 3300032005 Bacteria 5082
454 Ga0307411_10043799 3300032005 Bacteria 2865
455 Ga0307411_10059278 3300032005 Bacteria 2537
456 Ga0307411_10084853 3300032005 Bacteria 2192
457 Ga0307411_10198859 3300032005 Bacteria 1537
458 Ga0307415_100007272 3300032126 Bacteria 6047
459 Ga0307415_100018321 3300032126 Bacteria 4225
460 Ga0307415_100216765 3300032126 Bacteria 1531
461 Ga0316583_10003553 3300032133 Bacteria 5502
462 Ga0307510_10005954 3300033180 Bacteria 14551
463 Ga0316584_0129385 3300036712 Bacteria 1886
464 Ga0395899_0000406 3300037312 Bacteria 50248
465 Ga0395899_0065327 3300037312 Bacteria 2674
466 Ga0395899_0091624 3300037312 Bacteria 2202
467 Ga0395899_0188444 3300037312 Bacteria 1444
468 Ga0395900_0004543 3300037418 Bacteria 14685
469 Ga0395900_0009343 3300037418 Bacteria 10053
470 Ga0395900_0009895 3300037418 Bacteria 9765
471 Ga0395900_0012195 3300037418 Bacteria 8786
472 Ga0395900_0033345 3300037418 Bacteria 5299
473 Ga0395900_0055176 3300037418 Bacteria 4091
474 Ga0395898_0001585 3300037466 Bacteria 31078
475 Ga0395898_0023344 3300037466 Bacteria 6251
476 Ga0395898_0047627 3300037466 Bacteria 4206
477 Ga0395905_0000089 3300037471 Bacteria 152196
478 Ga0395905_0000412 3300037471 Bacteria 60157
479 Ga0395905_0002105 3300037471 Bacteria 22623
480 Ga0395905_0014350 3300037471 Bacteria 7570
481 Ga0395905_0020721 3300037471 Bacteria 6225
482 Ga0395905_0025055 3300037471 Bacteria 5626
483 Ga0395905_0053079 3300037471 Bacteria 3795
484 Ga0395905_0083023 3300037471 Bacteria 3002
485 Ga0395905_0101480 3300037471 Bacteria 2701
486 Ga0436364_1247405 3300037853 Bacteria 1652
487 Ga0436364_1473539 3300037853 Bacteria 7661
488 Ga0395901_0005879 3300038443 Bacteria 12416
489 Ga0395901_0089589 3300038443 Bacteria 3219
490 Ga0436365_1311515 3300039437 Bacteria 11736
491 Ga0436365_1658932 3300039437 Bacteria 3238
492 Ga0436363_1537430 3300039450 Bacteria 2076
493 Ga0439461_0000051 3300041410 Bacteria 14159
494 Ga0439465_0001873 3300041413 Bacteria 6876
495 Ga0439431_0000131 3300041997 Bacteria 13310
496 Ga0439432_016384 3300042006 Bacteria 2495
497 Ga0439452_021228 3300042010 Bacteria 1695
498 Ga0439462_0002208 3300042015 Bacteria 4491
499 Ga0450905_003187 3300042142 Bacteria 2151
500 Ga0439434_0002140 3300042435 Bacteria 5719
501 Ga0466969_0002077 3300044656 Bacteria 10693
502 Ga0466966_0000003 3300044684 Bacteria 233677
503 Ga0466966_0029684 3300044684 Bacteria 3555
504 Ga0466961_0009726 3300044693 Bacteria 6120
505 Ga0466961_0064150 3300044693 Bacteria 2334
506 Ga0466971_0036363 3300044719 Bacteria 2208
507 Ga0466970_0022735 3300044765 Bacteria 3271
508 Ga0466957_0000273 3300044842 Bacteria 25062
509 Ga0466959_0005743 3300045049 Bacteria 8536
510 Ga0466959_0038923 3300045049 Bacteria 3513
511 Ga0451576_0000007 3300045051 Bacteria 782228
512 Ga0466958_0013352 3300045836 Bacteria 4674
513 Ga0466958_0074798 3300045836 Bacteria 2077
514 Ga0495638_0000128 3300046460 Bacteria 123567
515 Ga0495650_0000259 3300046471 Bacteria 102151
516 Ga0495585_0005032 3300046492 Bacteria 8431
517 Ga0495596_0000053 3300046500 Bacteria 84061
518 Ga0495596_0006657 3300046500 Bacteria 5290
519 Ga0495583_0001674 3300046506 Bacteria 21461
520 Ga0495583_0026464 3300046506 Bacteria 2875
521 Ga0495606_0000029 3300046507 Bacteria 250473
522 Ga0495616_0000140 3300046513 Bacteria 63080
523 Ga0495643_0002012 3300046522 Bacteria 16962
524 Ga0495643_0002280 3300046522 Bacteria 15503
525 Ga0495643_0023318 3300046522 Bacteria 3519
526 Ga0495648_0001484 3300046524 Bacteria 22938
527 Ga0495648_0099235 3300046524 Bacteria 1611
528 Ga0495663_0003305 3300046525 Bacteria 4670
529 Ga0495598_0000495 3300046537 Bacteria 7257
530 Ga0495609_0016952 3300046538 Bacteria 3389
531 Ga0495621_0000055 3300046539 Bacteria 21830
532 Ga0495621_0042758 3300046539 Bacteria 1596
533 Ga0495597_0024651 3300046542 Bacteria 2775
534 Ga0495633_0001942 3300046558 Bacteria 15031
535 Ga0495633_0003568 3300046558 Bacteria 10287
536 Ga0495668_0000016 3300046616 Bacteria 438197
537 Ga0495625_0000092 3300046660 Bacteria 146172
538 Ga0495625_0033599 3300046660 Bacteria 3791
539 Ga0495625_0072697 3300046660 Bacteria 2411
540 Ga0495659_0030286 3300046664 Bacteria 1883
541 Ga0495669_0000039 3300046684 Bacteria 92973
542 Ga0495670_0000015 3300046691 Bacteria 131137
543 Ga0495670_0000771 3300046691 Bacteria 15356
544 Ga0495671_0023659 3300046692 Bacteria 3208
545 Ga0495649_0032522 3300046694 Bacteria 2872
546 Ga0495600_0008265 3300046809 Bacteria 6388
547 Ga0495683_0008020 3300047323 Bacteria 5670
548 Ga0495683_0028132 3300047323 Bacteria 2874
549 Ga0495687_000471 3300047443 Bacteria 48815
550 Ga0495687_001946 3300047443 Bacteria 17689
551 Ga0495677_0004870 3300047445 Bacteria 5119
552 Ga0495677_0007290 3300047445 Bacteria 4137
553 Ga0495686_0000486 3300047472 Bacteria 58640
554 Ga0496101_0010489 3300048904 Bacteria 6120
555 Ga0496101_0020877 3300048904 Bacteria 4492
556 Ga0496102_0000961 3300048905 Bacteria 27087
557 Ga0496102_0013728 3300048905 Bacteria 7024
558 Ga0496102_0101584 3300048905 Bacteria 2672
559 Ga0496103_0000038 3300048906 Bacteria 178822
560 Ga0496103_0000145 3300048906 Bacteria 74388
561 Ga0496104_0000123 3300048907 Bacteria 71754
562 Ga0496104_0014613 3300048907 Bacteria 7092
563 Ga0496105_0000165 3300048908 Bacteria 43988
564 Ga0496105_0000218 3300048908 Bacteria 38487
565 Ga0496106_0004503 3300048909 Bacteria 10324
566 Ga0496107_0012337 3300048910 Bacteria 5966
567 Ga0496107_0106512 3300048910 Bacteria 2059
568 Ga0496108_0035205 3300048911 Bacteria 4162
569 Ga0496109_0010877 3300048912 Bacteria 7791
570 Ga0496109_0013659 3300048912 Bacteria 7053
571 Ga0496109_0026058 3300048912 Bacteria 5211
572 Ga0496109_0264400 3300048912 Bacteria 1621
573 Ga0496110_0013061 3300048913 Bacteria 6852
574 Ga0496110_0015697 3300048913 Bacteria 6310
575 Ga0496110_0026321 3300048913 Bacteria 4976
576 Ga0496112_0002145 3300048915 Bacteria 15663
577 Ga0496112_0008161 3300048915 Bacteria 9358
578 Ga0496112_0045754 3300048915 Bacteria 4290
579 Ga0496113_0009075 3300048916 Bacteria 6516
580 Ga0496113_0056657 3300048916 Bacteria 2943
581 Ga0496113_0095054 3300048916 Bacteria 2303
582 Ga0496114_0002180 3300048917 Bacteria 14904
583 Ga0496114_0002905 3300048917 Bacteria 13135
584 Ga0496114_0025594 3300048917 Bacteria 4825
585 Ga0496115_0001038 3300048918 Bacteria 20173
586 Ga0496116_0001809 3300048919 Bacteria 23171
587 Ga0496116_0012660 3300048919 Bacteria 6868
588 Ga0496117_0000910 3300048920 Bacteria 45331
589 Ga0496117_0018333 3300048920 Bacteria 5803
590 Ga0496118_0000091 3300048921 Bacteria 173092
591 Ga0496118_0009440 3300048921 Bacteria 9847
592 Ga0496119_0001044 3300048922 Bacteria 35405
593 Ga0496120_0001555 3300048923 Bacteria 26843
594 Ga0496121_0000105 3300048924 Bacteria 191437
595 Ga0496121_0000168 3300048924 Bacteria 144896
596 Ga0496121_0000429 3300048924 Bacteria 82577
597 Ga0496121_0016537 3300048924 Bacteria 7609
598 Ga0496121_0033641 3300048924 Bacteria 4634
599 Ga0496122_0001814 3300048925 Bacteria 32677
600 Ga0496122_0029994 3300048925 Bacteria 4569
601 Ga0496123_0003740 3300048926 Bacteria 16680
602 Ga0496124_0000375 3300048927 Bacteria 81352
603 Ga0496124_0000414 3300048927 Bacteria 76734
604 Ga0496124_0005478 3300048927 Bacteria 14255
605 Ga0496124_0062935 3300048927 Bacteria 3102
606 Ga0496125_0001376 3300048928 Bacteria 35709
607 Ga0496125_0003787 3300048928 Bacteria 17978
608 Ga0496125_0005261 3300048928 Bacteria 14490
609 Ga0496125_0056100 3300048928 Bacteria 3202
610 Ga0496125_0098343 3300048928 Bacteria 2165
611 Ga0496126_0000066 3300048929 Bacteria 252188
612 Ga0496126_0000443 3300048929 Bacteria 82811
613 Ga0501032_0228635 3300049569 Bacteria 1210
614 Ga0501034_0202814 3300049571 Bacteria 1941
615 Ga0501038_0032224 3300049574 Bacteria 4626
616 Ga0501047_0153998 3300049581 Bacteria 2173
617 Ga0501073_0020655 3300049589 Bacteria 4750
618 Ga0501076_0012864 3300049592 Bacteria 6262
619 Ga0501076_0249211 3300049592 Bacteria 1453
620 Ga0501083_0074086 3300049744 Bacteria 2262
621 Ga0501044_0310278 3300049823 Bacteria 1504
622 nmdc:mga0rr50_9616_c1 3300050513 Bacteria 6090
623 Ga0500610_0000231 3300053079 Bacteria 16928
624 Ga0500643_000030 3300053087 Bacteria 206784
625 Ga0500643_000465 3300053087 Bacteria 29876
626 Ga0500643_007628 3300053087 Bacteria 4336
627 Ga0500651_0019900 3300053093 Bacteria 4176
628 Ga0500556_0000014 3300053104 Bacteria 232989
629 Ga0500592_003087 3300053116 Bacteria 2662
630 Ga0500594_0003951 3300053118 Bacteria 3267
631 Ga0500595_001729 3300053119 Bacteria 11391
632 Ga0500595_004099 3300053119 Bacteria 6607
633 Ga0500608_000280 3300053122 Bacteria 19747
634 Ga0500642_0000001 3300053130 Bacteria 1468402
635 Ga0500642_0000596 3300053130 Bacteria 10818
636 Ga0500642_0013317 3300053130 Bacteria 3018
637 Ga0500658_0008056 3300053134 Bacteria 3894
638 Ga0500559_0062643 3300053136 Bacteria 1661
639 Ga0500564_000953 3300053138 Bacteria 9400
640 Ga0500573_0000271 3300053140 Bacteria 21909
641 Ga0500588_0001660 3300053146 Bacteria 4308
642 Ga0500604_0000027 3300053151 Bacteria 62112
643 Ga0500604_0000984 3300053151 Bacteria 7930
644 Ga0500616_0000730 3300053153 Bacteria 38013
645 Ga0500636_0000462 3300053177 Bacteria 22121
646 Ga0500567_000811 3300053723 Bacteria 11764
647 Ga0500625_000006 3300053729 Bacteria 206258
648 Ga0500645_000002 3300053730 Bacteria 388892
649 Ga0500645_000315 3300053730 Bacteria 34548
650 Ga0466962_0004869 3300061719 Bacteria 6457
651 2885427557 2885427238 Bacteria 2291351
652 2511126951 2510917021 Bacteria 5705459
653 2600201473 2599185354 Bacteria 4398675
654 2600228219 2599185359 Bacteria 4772316
655 2738711740 2738541275 Bacteria 4830863
656 2738850165 2738541301 Bacteria 4834102
657 2738865894 2738541304 Bacteria 4833665
658 2739298412 2738543022 Bacteria 4835059
659 2739360090 2738543033 Bacteria 4833336
660 2739649952 2739367664 Bacteria 4114334
661 2740028425 2739367865 Bacteria 4114482
662 2753763459 2751185897 Bacteria 5322941
663 2778124221 2775507255 Bacteria 3945731
664 2809064667 2808606401 Bacteria 4586670
665 2819716264 2818991466 Bacteria 4748179
666 2830077289 2830075706 Bacteria 3855215
667 2848299877 2848297114 Bacteria 3608511
668 2852655352 2852653556 Bacteria 4050083
669 2879163976 2879163058 Bacteria 4223965
670 2896184842 2896184354 Bacteria 3258548
671 2896431140 2896429255 Bacteria 2557483
672 2919139912 2919138771 Bacteria 5281312
673 2928101607 2928100450 Bacteria 4837635
674 2928528933 2928526807 Bacteria 4760224
675 2928959698 2928959182 Bacteria 4725774
676 2928970484 2928968154 Bacteria 4633371
677 2946787760 2946787523 Bacteria 4366789
678 3000866064 3000865235 Bacteria 3106258
679 JGI24736J21556_1001126
680 JGI24741J21665_1000819
681 JGI24740J21852_10006234
682 JGI24740J21852_10009346
683 JGI24739J22299_10004115
684 JGI24737J22298_10001056
685 JGI24744J21845_10001869
686 JGI25165J46597_1000023
687 JGI25165J46597_1000095
688 JGI25153J46596_10000010
689 JGI25153J46596_10000031
690 Ga0055525_1000012
691 Ga0055542_1000322
692 Ga0055529_1000014
693 Ga0055536_1000422
694 Ga0055534_1004498
695 Ga0055530_10000013
696 Ga0055531_10000449
697 Ga0055531_10005592
698 Ga0065165_1003177
699 Ga0065704_10081931
700 Ga0070658_10000536
701 Ga0070658_10001914
702 Ga0070658_10002770
703 Ga0070658_10023150
704 Ga0070658_10070918
705 Ga0070658_10112917
706 Ga0070658_10145987
707 Ga0070676_10000031
708 Ga0070683_100012146
709 Ga0070683_100096732
710 Ga0070670_100000344
711 Ga0070670_100001938
712 Ga0070670_100005554
713 Ga0070670_100005597
714 Ga0070670_100007510
715 Ga0070670_100019126
716 Ga0070670_100057317
717 Ga0070670_100216764
718 Ga0070666_10000160
719 Ga0070666_10006279
720 Ga0070666_10012951
721 Ga0070666_10041785
722 Ga0070680_100006780
723 Ga0070680_100081701
724 Ga0070680_100121595
725 Ga0068868_100000403
726 Ga0068868_100039288
727 Ga0070660_100000700
728 Ga0070660_100004814
729 Ga0070660_100035146
730 Ga0070660_100035906
731 Ga0070660_100037408
732 Ga0070660_100043991
733 Ga0070660_100072829
734 Ga0070660_100101908
735 Ga0070661_100000130
736 Ga0070661_100004468
737 Ga0070661_100005092
738 Ga0070661_100023171
739 Ga0070661_100039939
740 Ga0070661_100042155
741 Ga0070661_100055001
742 Ga0070668_100000028
743 Ga0070668_100000049
744 Ga0070668_100034913
745 Ga0070669_100000013
746 Ga0070669_100000715
747 Ga0070669_100028017
748 Ga0070675_100002284
749 Ga0070675_100090365
750 Ga0070671_100000009
751 Ga0070671_100000269
752 Ga0070671_100002542
753 Ga0070671_100003648
754 Ga0070671_100007269
755 Ga0070671_100073908
756 Ga0070674_100057051
757 Ga0070673_100000022
758 Ga0070659_100013393
759 Ga0070659_100030333
760 Ga0070659_100032663
761 Ga0070667_100000009
762 Ga0070667_100004908
763 Ga0070667_100013603
764 Ga0070667_100061234
765 Ga0070705_100008071
766 Ga0070663_100001359
767 Ga0070663_100022084
768 Ga0070663_100064573
769 Ga0070678_100000060
770 Ga0070678_100097180
771 Ga0070662_100040801
772 Ga0070662_100101657
773 Ga0070681_10002429
774 Ga0068867_100000023
775 Ga0068867_100003900
776 Ga0068867_100046955
777 Ga0070679_100000021
778 Ga0070679_100016861
779 Ga0070679_100023181
780 Ga0068853_100009284
781 Ga0068853_100147801
782 Ga0070672_100219300
783 Ga0070686_100047865
784 Ga0070696_100015568
785 Ga0070665_100000115
786 Ga0070665_100002028
787 Ga0070665_100007685
788 Ga0070665_100272455
789 Ga0068855_100040917
790 Ga0068855_100230639
791 Ga0070664_100005447
792 Ga0070664_100101878
793 Ga0068857_100015874
794 Ga0068857_100025761
795 Ga0068854_100011704
796 Ga0068854_100014036
797 Ga0068854_100026006
798 Ga0068856_100004367
799 Ga0068856_100252040
800 Ga0068852_100091189
801 Ga0068859_100000202
802 Ga0068859_100141010
803 Ga0068859_100235364
804 Ga0068864_100001677
805 Ga0068864_100002974
806 Ga0068864_100143016
807 Ga0068851_10008051
808 Ga0068851_10024511
809 Ga0068863_100000092
810 Ga0068863_100006027
811 Ga0068863_100027707
812 Ga0068863_100030672
813 Ga0068863_100053836
814 Ga0068863_100071078
815 Ga0068858_100000261
816 Ga0068858_100000380
817 Ga0068858_100001609
818 Ga0068858_100042830
819 Ga0068858_100058043
820 Ga0068860_100000042
821 Ga0068860_100064458
822 Ga0068862_100000411
823 Ga0068862_100008302
824 Ga0068862_100010722
825 Ga0081539_10066829
826 Ga0075369_10025086
827 Ga0075366_10063596
828 Ga0068865_100000031
829 Ga0097620_100000202
830 Ga0097620_100141005
831 Ga0097620_100235363
832 Ga0075435_100013014
833 Ga0105240_10009242
834 Ga0105240_10021138
835 Ga0105240_10390038
836 Ga0105245_10002151
837 Ga0105245_10013418
838 Ga0105243_10000156
839 Ga0105243_10001186
840 Ga0105241_10209037
841 Ga0105242_10004742
842 Ga0105248_10001787
843 Ga0105248_10005414
844 Ga0105248_10016331
845 Ga0105248_10054516
846 Ga0105237_10005078
847 Ga0105237_10170457
848 Ga0105238_10112091
849 Ga0105249_10001604
850 Ga0105249_10004663
851 Ga0105249_10031092
852 Ga0105249_10125159
853 Ga0105246_10000157
854 Ga0157373_10019332
855 Ga0157373_10105584
856 Ga0157371_10000193
857 Ga0157371_10014561
858 Ga0157371_10130838
859 Ga0157370_10007287
860 Ga0157370_10028708
861 Ga0157369_10005353
862 Ga0157369_10056253
863 Ga0157369_10062188
864 Ga0157369_10091370
865 Ga0157369_10215604
866 Ga0157369_10264064
867 Ga0157374_10000656
868 Ga0157374_10002399
869 Ga0157378_10000504
870 Ga0163162_10017961
871 Ga0163162_10113135
872 Ga0163162_10132014
873 Ga0157372_10030188
874 Ga0157372_10060288
875 Ga0157375_10003473
876 Ga0157375_10104117
877 Ga0157375_10278903
878 Ga0163163_10136381
879 Ga0157380_10004583
880 Ga0157377_10003378
881 Ga0157379_10005137
882 Ga0157379_10224012
883 Ga0157376_10000124
884 Ga0213876_10003188
885 Ga0213875_10007292
886 Ga0209563_100030
887 Ga0209437_103045
888 Ga0209026_1002932
889 Ga0209677_107247
890 Ga0209148_1000011
891 Ga0209148_1000059
892 Ga0209233_1000003
893 Ga0209233_1000052
894 Ga0209455_1000006
895 Ga0209675_1000025
896 Ga0209676_1000221
897 Ga0209676_1000483
898 Ga0209025_1010313
899 Ga0209758_1000001
900 Ga0209758_1000033
901 Ga0209050_1000042
902 Ga0209050_1001210
903 Ga0209257_1000135
904 Ga0209257_1000532
905 Ga0209257_1015531
906 Ga0207697_10019384
907 Ga0207697_10033709
908 Ga0207656_10002880
909 Ga0207656_10004383
910 Ga0207696_1014662
911 Ga0207682_10002218
912 Ga0207680_10001079
913 Ga0207680_10004576
914 Ga0207647_10000038
915 Ga0207647_10024022
916 Ga0207647_10040387
917 Ga0207645_10028697
918 Ga0207705_10000059
919 Ga0207705_10000178
920 Ga0207705_10000237
921 Ga0207705_10000511
922 Ga0207705_10002823
923 Ga0207705_10014106
924 Ga0207705_10021462
925 Ga0207654_10000227
926 Ga0207654_10048133
927 Ga0207707_10034592
928 Ga0207695_10015591
929 Ga0207695_10025115
930 Ga0207695_10051267
931 Ga0207695_10080646
932 Ga0207671_10002570
933 Ga0207671_10004432
934 Ga0207671_10009213
935 Ga0207660_10003328
936 Ga0207660_10036415
937 Ga0207657_10000289
938 Ga0207657_10001241
939 Ga0207657_10001372
940 Ga0207657_10011870
941 Ga0207657_10026062
942 Ga0207657_10071295
943 Ga0207657_10077725
944 Ga0207657_10115251
945 Ga0207649_10000134
946 Ga0207649_10003792
947 Ga0207649_10004660
948 Ga0207649_10012897
949 Ga0207649_10131843
950 Ga0207652_10000047
951 Ga0207652_10005457
952 Ga0207652_10015360
953 Ga0207652_10044682
954 Ga0207681_10000008
955 Ga0207681_10002989
956 Ga0207681_10048215
957 Ga0207694_10000683
958 Ga0207650_10001881
959 Ga0207650_10018173
960 Ga0207650_10101789
961 Ga0207650_10136167
962 Ga0207659_10021352
963 Ga0207687_10000798
964 Ga0207664_10028396
965 Ga0207644_10000006
966 Ga0207644_10000088
967 Ga0207644_10000094
968 Ga0207644_10003333
969 Ga0207644_10048321
970 Ga0207644_10074058
971 Ga0207690_10001226
972 Ga0207690_10031664
973 Ga0207690_10068645
974 Ga0207706_10001712
975 Ga0207706_10053046
976 Ga0207686_10001385
977 Ga0207709_10000246
978 Ga0207709_10000447
979 Ga0207669_10000030
980 Ga0207669_10000989
981 Ga0207669_10039652
982 Ga0207669_10057738
983 Ga0207704_10000008
984 Ga0207691_10023274
985 Ga0207691_10062142
986 Ga0207691_10085922
987 Ga0207691_10287244
988 Ga0207711_10000946
989 Ga0207711_10001082
990 Ga0207711_10006078
991 Ga0207689_10000701
992 Ga0207689_10025288
993 Ga0207661_10015224
994 Ga0207661_10128219
995 Ga0207679_10028352
996 Ga0207679_10062649
997 Ga0207679_10153505
998 Ga0207667_10000002
999 Ga0207667_10006208
1000 Ga0207667_10027810
1001 Ga0207667_10034843
1002 Ga0207667_10064884
1003 Ga0207667_10161261
1004 Ga0207667_10178536
1005 Ga0207651_10000008
1006 Ga0207712_10008250
1007 Ga0207712_10033435
1008 Ga0207668_10000076
1009 Ga0207668_10000731
1010 Ga0207668_10189232
1011 Ga0207640_10002626
1012 Ga0207640_10006133
1013 Ga0207640_10022315
1014 Ga0207640_10081303
1015 Ga0207658_10000002
1016 Ga0207658_10001246
1017 Ga0207658_10008943
1018 Ga0207658_10009111
1019 Ga0207677_10000091
1020 Ga0207677_10010628
1021 Ga0207703_10000253
1022 Ga0207703_10000847
1023 Ga0207703_10000896
1024 Ga0207703_10001312
1025 Ga0207703_10022154
1026 Ga0207639_10012330
1027 Ga0207639_10027739
1028 Ga0207639_10061676
1029 Ga0207639_10266005
1030 Ga0207678_10001389
1031 Ga0207678_10002781
1032 Ga0207678_10079085
1033 Ga0207702_10011067
1034 Ga0207702_10034470
1035 Ga0207702_10115054
1036 Ga0207702_10150367
1037 Ga0207702_10213199
1038 Ga0207641_10000004
1039 Ga0207641_10001025
1040 Ga0207641_10004732
1041 Ga0207641_10006197
1042 Ga0207641_10007148
1043 Ga0207641_10032708
1044 Ga0207648_10000009
1045 Ga0207648_10016823
1046 Ga0207648_10032807
1047 Ga0207676_10001115
1048 Ga0207676_10012257
1049 Ga0207676_10068907
1050 Ga0207674_10003055
1051 Ga0207674_10012450
1052 Ga0207674_10023243
1053 Ga0207674_10024567
1054 Ga0207674_10060765
1055 Ga0207675_100006088
1056 Ga0207675_100031426
1057 Ga0207683_10000075
1058 Ga0207683_10014781
1059 Ga0207683_10019752
1060 Ga0207683_10127463
1061 Ga0207683_10143593
1062 Ga0207683_10177557
1063 Ga0207683_10303379
1064 Ga0207698_10008427
1065 Ga0268266_10000015
1066 Ga0268266_10005032
1067 Ga0268266_10030749
1068 Ga0268266_10037453
1069 Ga0268265_10000392
1070 Ga0268265_10000582
1071 Ga0268265_10028903
1072 Ga0268265_10070971
1073 Ga0268265_10103527
1074 Ga0268264_10000001
1075 Ga0268264_10000310
1076 Ga0268264_10004774
1077 Ga0307517_10074308
1078 Ga0307515_10259608
1079 Ga0265320_10082223
1080 Ga0307513_10008420
1081 Ga0307513_10043231
1082 Ga0307408_100006783
1083 Ga0307408_100011783
1084 Ga0307408_100023154
1085 Ga0307408_100046549
1086 Ga0307508_10000317
1087 Ga0307405_10021699
1088 Ga0307405_10118278
1089 Ga0307405_10151293
1090 Ga0307413_10010952
1091 Ga0307413_10034949
1092 Ga0307413_10120854
1093 Ga0307410_10003471
1094 Ga0307410_10055511
1095 Ga0307410_10065496
1096 Ga0307410_10075957
1097 Ga0307410_10089542
1098 Ga0307410_10124425
1099 Ga0307406_10022142
1100 Ga0307406_10088807
1101 Ga0307406_10124168
1102 Ga0307407_10053599
1103 Ga0307407_10079225
1104 Ga0307412_10000557
1105 Ga0307412_10001749
1106 Ga0307412_10005086
1107 Ga0307412_10027029
1108 Ga0307412_10083568
1109 Ga0307412_10093027
1110 Ga0307412_10123685
1111 Ga0307409_100010084
1112 Ga0307409_100028665
1113 Ga0307409_100037418
1114 Ga0307409_100052098
1115 Ga0307409_100139807
1116 Ga0307409_100183054
1117 Ga0307416_100016486
1118 Ga0307416_100087366
1119 Ga0307416_100251629
1120 Ga0307414_10000288
1121 Ga0307414_10006350
1122 Ga0307414_10015729
1123 Ga0307414_10018174
1124 Ga0307414_10070228
1125 Ga0307414_10081531
1126 Ga0307414_10085284
1127 Ga0307414_10170380
1128 Ga0307411_10005369
1129 Ga0307411_10005662
1130 Ga0307411_10008930
1131 Ga0307411_10009704
1132 Ga0307411_10043799
1133 Ga0307411_10059278
1134 Ga0307411_10084853
1135 Ga0307411_10198859
1136 Ga0307415_100007272
1137 Ga0307415_100018321
1138 Ga0307415_100216765
1139 Ga0316583_10003553
1140 Ga0307510_10005954
1141 Ga0316584_0129385
1142 Ga0395899_0000406
1143 Ga0395899_0065327
1144 Ga0395899_0091624
1145 Ga0395899_0188444
1146 Ga0395900_0004543
1147 Ga0395900_0009343
1148 Ga0395900_0009895
1149 Ga0395900_0012195
1150 Ga0395900_0033345
1151 Ga0395900_0055176
1152 Ga0395898_0001585
1153 Ga0395898_0023344
1154 Ga0395898_0047627
1155 Ga0395905_0000089
1156 Ga0395905_0000412
1157 Ga0395905_0002105
1158 Ga0395905_0014350
1159 Ga0395905_0020721
1160 Ga0395905_0025055
1161 Ga0395905_0053079
1162 Ga0395905_0083023
1163 Ga0395905_0101480
1164 Ga0436364_1247405
1165 Ga0436364_1473539
1166 Ga0395901_0005879
1167 Ga0395901_0089589
1168 Ga0436365_1311515
1169 Ga0436365_1658932
1170 Ga0436363_1537430
1171 Ga0439461_0000051
1172 Ga0439465_0001873
1173 Ga0439431_0000131
1174 Ga0439432_016384
1175 Ga0439452_021228
1176 Ga0439462_0002208
1177 Ga0450905_003187
1178 Ga0439434_0002140
1179 Ga0466969_0002077
1180 Ga0466966_0000003
1181 Ga0466966_0029684
1182 Ga0466961_0009726
1183 Ga0466961_0064150
1184 Ga0466971_0036363
1185 Ga0466970_0022735
1186 Ga0466957_0000273
1187 Ga0466959_0005743
1188 Ga0466959_0038923
1189 Ga0451576_0000007
1190 Ga0466958_0013352
1191 Ga0466958_0074798
1192 Ga0495638_0000128
1193 Ga0495650_0000259
1194 Ga0495585_0005032
1195 Ga0495596_0000053
1196 Ga0495596_0006657
1197 Ga0495583_0001674
1198 Ga0495583_0026464
1199 Ga0495606_0000029
1200 Ga0495616_0000140
1201 Ga0495643_0002012
1202 Ga0495643_0002280
1203 Ga0495643_0023318
1204 Ga0495648_0001484
1205 Ga0495648_0099235
1206 Ga0495663_0003305
1207 Ga0495598_0000495
1208 Ga0495609_0016952
1209 Ga0495621_0000055
1210 Ga0495621_0042758
1211 Ga0495597_0024651
1212 Ga0495633_0001942
1213 Ga0495633_0003568
1214 Ga0495668_0000016
1215 Ga0495625_0000092
1216 Ga0495625_0033599
1217 Ga0495625_0072697
1218 Ga0495659_0030286
1219 Ga0495669_0000039
1220 Ga0495670_0000015
1221 Ga0495670_0000771
1222 Ga0495671_0023659
1223 Ga0495649_0032522
1224 Ga0495600_0008265
1225 Ga0495683_0008020
1226 Ga0495683_0028132
1227 Ga0495687_000471
1228 Ga0495687_001946
1229 Ga0495677_0004870
1230 Ga0495677_0007290
1231 Ga0495686_0000486
1232 Ga0496101_0010489
1233 Ga0496101_0020877
1234 Ga0496102_0000961
1235 Ga0496102_0013728
1236 Ga0496102_0101584
1237 Ga0496103_0000038
1238 Ga0496103_0000145
1239 Ga0496104_0000123
1240 Ga0496104_0014613
1241 Ga0496105_0000165
1242 Ga0496105_0000218
1243 Ga0496106_0004503
1244 Ga0496107_0012337
1245 Ga0496107_0106512
1246 Ga0496108_0035205
1247 Ga0496109_0010877
1248 Ga0496109_0013659
1249 Ga0496109_0026058
1250 Ga0496109_0264400
1251 Ga0496110_0013061
1252 Ga0496110_0015697
1253 Ga0496110_0026321
1254 Ga0496112_0002145
1255 Ga0496112_0008161
1256 Ga0496112_0045754
1257 Ga0496113_0009075
1258 Ga0496113_0056657
1259 Ga0496113_0095054
1260 Ga0496114_0002180
1261 Ga0496114_0002905
1262 Ga0496114_0025594
1263 Ga0496115_0001038
1264 Ga0496116_0001809
1265 Ga0496116_0012660
1266 Ga0496117_0000910
1267 Ga0496117_0018333
1268 Ga0496118_0000091
1269 Ga0496118_0009440
1270 Ga0496119_0001044
1271 Ga0496120_0001555
1272 Ga0496121_0000105
1273 Ga0496121_0000168
1274 Ga0496121_0000429
1275 Ga0496121_0016537
1276 Ga0496121_0033641
1277 Ga0496122_0001814
1278 Ga0496122_0029994
1279 Ga0496123_0003740
1280 Ga0496124_0000375
1281 Ga0496124_0000414
1282 Ga0496124_0005478
1283 Ga0496124_0062935
1284 Ga0496125_0001376
1285 Ga0496125_0003787
1286 Ga0496125_0005261
1287 Ga0496125_0056100
1288 Ga0496125_0098343
1289 Ga0496126_0000066
1290 Ga0496126_0000443
1291 Ga0501032_0228635
1292 Ga0501034_0202814
1293 Ga0501038_0032224
1294 Ga0501047_0153998
1295 Ga0501073_0020655
1296 Ga0501076_0012864
1297 Ga0501076_0249211
1298 Ga0501083_0074086
1299 Ga0501044_0310278
1300 nmdc:mga0rr50_9616_c1
1301 Ga0500610_0000231
1302 Ga0500643_000030
1303 Ga0500643_000465
1304 Ga0500643_007628
1305 Ga0500651_0019900
1306 Ga0500556_0000014
1307 Ga0500592_003087
1308 Ga0500594_0003951
1309 Ga0500595_001729
1310 Ga0500595_004099
1311 Ga0500608_000280
1312 Ga0500642_0000001
1313 Ga0500642_0000596
1314 Ga0500642_0013317
1315 Ga0500658_0008056
1316 Ga0500559_0062643
1317 Ga0500564_000953
1318 Ga0500573_0000271
1319 Ga0500588_0001660
1320 Ga0500604_0000027
1321 Ga0500604_0000984
1322 Ga0500616_0000730
1323 Ga0500636_0000462
1324 Ga0500567_000811
1325 Ga0500625_000006
1326 Ga0500645_000002
1327 Ga0500645_000315
1328 Ga0466962_0004869
1329 2885427557
1330 2511126951
1331 2600201473
1332 2600228219
1333 2738711740
1334 2738850165
1335 2738865894
1336 2739298412
1337 2739360090
1338 2739649952
1339 2740028425
1340 2753763459
1341 2778124221
1342 2809064667
1343 2819716264
1344 2830077289
1345 2848299877
1346 2852655352
1347 2879163976
1348 2896184842
1349 2896431140
1350 2919139912
1351 2928101607
1352 2928528933
1353 2928959698
1354 2928970484
1355 2946787760
1356 3000866064

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00198

2-oxoacid_dh

2-oxoacid dehydrogenases acyltransferase (catalytic domain)

233

462

0.98

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

1

73

0.98

PF02817

E3_binding

e3 binding domain

167

201

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bgj-assembly1.cif.gz_A c. thermophilum pyruvate dehydrogenase complex core 0.935 154 356
7bgj-assembly1.cif.gz_A c. thermophilum pyruvate dehydrogenase complex core 0.9092 154 356
7wta-assembly1.cif.gz_D cryo-em structure of human pyruvate carboxylase in apo state 0.9068 17 61
4qoy-assembly2.cif.gz_F novel binding motif and new flexibility revealed by structural analysis of a pyruvate dehydrogenase-dihydrolipoyl acetyltransferase sub-complex from the escherichia coli pyruvate dehydrogenase multi-enzyme complex 0.8998 79 113
1w85-assembly1.cif.gz_I the crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 0.8991 78 114
ID Description Score Start End Superfamily
af_Q54KE6_633_699_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.914 17 62 2.40.50.100
4qoyF00 Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain 0.8998 79 113 4.10.320.10
af_Q8II35_15_156_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8882 13 59 2.40.50.100
1w88J00 Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain 0.8869 78 114 4.10.320.10
af_Q58628_489_566_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8841 17 64 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A225X675-F1-model_v4 deleted 0.9704 164 355
AF-A0A3S4H414-F1-model_v4 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12) 0.9578 158 356 GO:0004742
GO:0006086
GO:0045254
AF-A0A7C5DAU7-F1-model_v4 2-oxoacid dehydrogenase acyltransferase catalytic domain-containing protein 0.9569 189 356 GO:0006086
GO:0016746
GO:0045254
AF-A0A2F0AGV1-F1-model_v4 Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase 0.9552 188 356 GO:0006086
GO:0016746
GO:0045254
AF-A0A6A0HCY1-F1-model_v4 2-oxoacid dehydrogenase acyltransferase catalytic domain-containing protein 0.9537 216 298 GO:0004742
GO:0006086
GO:0045254

Map