F474692
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 678 | 314 | 1356 | 369 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2885427238|2885427557 |
| Length | 462 |
| Sequence | LKMPALSPTMEEGTLAKWLIKEGDTVASGDILAEIETDKATMEFEAVDEGKVLKILVAEGSDGVKVGTPIAMIGEEGEEGGVAGAATAPAQAPAPADTDKEQPSPGQPAAGGSYAPTAAPPAPGGGETPTAPASPAQSGGGDGDTGYRPPPIPKGEPAARANDSARIKASPLARRLAEAQGIDLSTITGSGPGGRIVRADLGDKGGGRPSQVQPAAAPAPALQPQASQVDPGEIPHEAVKLSNMRKTIARRLTESKQQVPHIYLTVDVQLDRLLKLRAELNDGLASRGVKLSVNDMLIKALALALIEVPECNVSFAGDTLIKYSRADISVAVSIPGGLITPIIAGANDKTLSKISTEMGELAGRAKEGKLQPHEYQGGTASLSNMGMFGIKQFEAVINPPQGMIMAIGAGEKRPFVIADSLQIATVMSATGSFDHRAIDGADGARLMQAFRALCERPMGLVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 91 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 92 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 163 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 178 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 179 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 189 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 190 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 191 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 192 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 193 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 194 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 195 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 196 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 203 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 204 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 243 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 247 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 248 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 249 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 250 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 251 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 252 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 253 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 254 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 255 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 256 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 267 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 268 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 269 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 270 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 271 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 272 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 273 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 274 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 275 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 276 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 277 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 278 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 279 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 280 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 281 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 282 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 284 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 285 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 286 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 287 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 288 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 289 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 290 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 291 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 292 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 293 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 294 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 295 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 296 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 297 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 298 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 299 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 300 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 301 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 302 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 303 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 304 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 305 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 306 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 307 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 308 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 309 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 310 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 311 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 312 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 313 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 314 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.87 |
| Metatranscriptomes | 0 |
| Isolates | 4.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9 |
| Nodule | 0 |
| Rhizoplane | 5.01 |
| Rhizosphere | 78.02 |
| Stem | 0 |
| Stem Tuber | 0.15 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001126 | 3300001904 | Bacteria | 4898 |
| 2 | JGI24741J21665_1000819 | 3300001915 | Bacteria | 9353 |
| 3 | JGI24740J21852_10006234 | 3300001979 | Bacteria | 4962 |
| 4 | JGI24740J21852_10009346 | 3300001979 | Bacteria | 3846 |
| 5 | JGI24739J22299_10004115 | 3300001989 | Bacteria | 5563 |
| 6 | JGI24737J22298_10001056 | 3300001990 | Bacteria | 9731 |
| 7 | JGI24744J21845_10001869 | 3300002077 | Bacteria | 4226 |
| 8 | JGI25165J46597_1000023 | 3300003214 | Bacteria | 338873 |
| 9 | JGI25165J46597_1000095 | 3300003214 | Bacteria | 163883 |
| 10 | JGI25153J46596_10000010 | 3300003215 | Bacteria | 337769 |
| 11 | JGI25153J46596_10000031 | 3300003215 | Bacteria | 196926 |
| 12 | Ga0055525_1000012 | 3300003759 | Bacteria | 486564 |
| 13 | Ga0055542_1000322 | 3300003762 | Bacteria | 51124 |
| 14 | Ga0055529_1000014 | 3300003763 | Bacteria | 367283 |
| 15 | Ga0055536_1000422 | 3300003781 | Bacteria | 30230 |
| 16 | Ga0055534_1004498 | 3300003784 | Bacteria | 4020 |
| 17 | Ga0055530_10000013 | 3300003791 | Bacteria | 153390 |
| 18 | Ga0055531_10000449 | 3300003794 | Bacteria | 38308 |
| 19 | Ga0055531_10005592 | 3300003794 | Bacteria | 7320 |
| 20 | Ga0065165_1003177 | 3300005262 | Bacteria | 12034 |
| 21 | Ga0065704_10081931 | 3300005289 | Bacteria | 3681 |
| 22 | Ga0070658_10000536 | 3300005327 | Bacteria | 32936 |
| 23 | Ga0070658_10001914 | 3300005327 | Bacteria | 17560 |
| 24 | Ga0070658_10002770 | 3300005327 | Bacteria | 14576 |
| 25 | Ga0070658_10023150 | 3300005327 | Bacteria | 4987 |
| 26 | Ga0070658_10070918 | 3300005327 | Bacteria | 2853 |
| 27 | Ga0070658_10112917 | 3300005327 | Bacteria | 2252 |
| 28 | Ga0070658_10145987 | 3300005327 | Bacteria | 1978 |
| 29 | Ga0070676_10000031 | 3300005328 | Bacteria | 42113 |
| 30 | Ga0070683_100012146 | 3300005329 | Bacteria | 7474 |
| 31 | Ga0070683_100096732 | 3300005329 | Bacteria | 2777 |
| 32 | Ga0070670_100000344 | 3300005331 | Bacteria | 39044 |
| 33 | Ga0070670_100001938 | 3300005331 | Bacteria | 16935 |
| 34 | Ga0070670_100005554 | 3300005331 | Bacteria | 10638 |
| 35 | Ga0070670_100005597 | 3300005331 | Bacteria | 10598 |
| 36 | Ga0070670_100007510 | 3300005331 | Bacteria | 9256 |
| 37 | Ga0070670_100019126 | 3300005331 | Bacteria | 5873 |
| 38 | Ga0070670_100057317 | 3300005331 | Bacteria | 3345 |
| 39 | Ga0070670_100216764 | 3300005331 | Bacteria | 1665 |
| 40 | Ga0070666_10000160 | 3300005335 | Bacteria | 46166 |
| 41 | Ga0070666_10006279 | 3300005335 | Bacteria | 7308 |
| 42 | Ga0070666_10012951 | 3300005335 | Bacteria | 5278 |
| 43 | Ga0070666_10041785 | 3300005335 | Bacteria | 3065 |
| 44 | Ga0070680_100006780 | 3300005336 | Bacteria | 8725 |
| 45 | Ga0070680_100081701 | 3300005336 | Bacteria | 2666 |
| 46 | Ga0070680_100121595 | 3300005336 | Bacteria | 2180 |
| 47 | Ga0068868_100000403 | 3300005338 | Bacteria | 29340 |
| 48 | Ga0068868_100039288 | 3300005338 | Bacteria | 3677 |
| 49 | Ga0070660_100000700 | 3300005339 | Bacteria | 22233 |
| 50 | Ga0070660_100004814 | 3300005339 | Bacteria | 9338 |
| 51 | Ga0070660_100035146 | 3300005339 | Bacteria | 3792 |
| 52 | Ga0070660_100035906 | 3300005339 | Bacteria | 3752 |
| 53 | Ga0070660_100037408 | 3300005339 | Bacteria | 3679 |
| 54 | Ga0070660_100043991 | 3300005339 | Bacteria | 3413 |
| 55 | Ga0070660_100072829 | 3300005339 | Bacteria | 2685 |
| 56 | Ga0070660_100101908 | 3300005339 | Bacteria | 2275 |
| 57 | Ga0070661_100000130 | 3300005344 | Bacteria | 62986 |
| 58 | Ga0070661_100004468 | 3300005344 | Bacteria | 9646 |
| 59 | Ga0070661_100005092 | 3300005344 | Bacteria | 9069 |
| 60 | Ga0070661_100023171 | 3300005344 | Bacteria | 4449 |
| 61 | Ga0070661_100039939 | 3300005344 | Bacteria | 3420 |
| 62 | Ga0070661_100042155 | 3300005344 | Bacteria | 3331 |
| 63 | Ga0070661_100055001 | 3300005344 | Bacteria | 2915 |
| 64 | Ga0070668_100000028 | 3300005347 | Bacteria | 89707 |
| 65 | Ga0070668_100000049 | 3300005347 | Bacteria | 74953 |
| 66 | Ga0070668_100034913 | 3300005347 | Bacteria | 3833 |
| 67 | Ga0070669_100000013 | 3300005353 | Bacteria | 210577 |
| 68 | Ga0070669_100000715 | 3300005353 | Bacteria | 24287 |
| 69 | Ga0070669_100028017 | 3300005353 | Bacteria | 4056 |
| 70 | Ga0070675_100002284 | 3300005354 | Bacteria | 14214 |
| 71 | Ga0070675_100090365 | 3300005354 | Bacteria | 2565 |
| 72 | Ga0070671_100000009 | 3300005355 | Bacteria | 206508 |
| 73 | Ga0070671_100000269 | 3300005355 | Bacteria | 35055 |
| 74 | Ga0070671_100002542 | 3300005355 | Bacteria | 14135 |
| 75 | Ga0070671_100003648 | 3300005355 | Bacteria | 12059 |
| 76 | Ga0070671_100007269 | 3300005355 | Bacteria | 8850 |
| 77 | Ga0070671_100073908 | 3300005355 | Bacteria | 2847 |
| 78 | Ga0070674_100057051 | 3300005356 | Bacteria | 2710 |
| 79 | Ga0070673_100000022 | 3300005364 | Bacteria | 92156 |
| 80 | Ga0070659_100013393 | 3300005366 | Bacteria | 6102 |
| 81 | Ga0070659_100030333 | 3300005366 | Bacteria | 4185 |
| 82 | Ga0070659_100032663 | 3300005366 | Bacteria | 4038 |
| 83 | Ga0070667_100000009 | 3300005367 | Bacteria | 281488 |
| 84 | Ga0070667_100004908 | 3300005367 | Bacteria | 11207 |
| 85 | Ga0070667_100013603 | 3300005367 | Bacteria | 6723 |
| 86 | Ga0070667_100061234 | 3300005367 | Bacteria | 3186 |
| 87 | Ga0070705_100008071 | 3300005440 | Bacteria | 5206 |
| 88 | Ga0070663_100001359 | 3300005455 | Bacteria | 13373 |
| 89 | Ga0070663_100022084 | 3300005455 | Bacteria | 4247 |
| 90 | Ga0070663_100064573 | 3300005455 | Bacteria | 2646 |
| 91 | Ga0070678_100000060 | 3300005456 | Bacteria | 39901 |
| 92 | Ga0070678_100097180 | 3300005456 | Bacteria | 2274 |
| 93 | Ga0070662_100040801 | 3300005457 | Bacteria | 3307 |
| 94 | Ga0070662_100101657 | 3300005457 | Bacteria | 2176 |
| 95 | Ga0070681_10002429 | 3300005458 | Bacteria | 17046 |
| 96 | Ga0068867_100000023 | 3300005459 | Bacteria | 92322 |
| 97 | Ga0068867_100003900 | 3300005459 | Bacteria | 10494 |
| 98 | Ga0068867_100046955 | 3300005459 | Bacteria | 3173 |
| 99 | Ga0070679_100000021 | 3300005530 | Bacteria | 124652 |
| 100 | Ga0070679_100016861 | 3300005530 | Bacteria | 7060 |
| 101 | Ga0070679_100023181 | 3300005530 | Bacteria | 6075 |
| 102 | Ga0068853_100009284 | 3300005539 | Bacteria | 7932 |
| 103 | Ga0068853_100147801 | 3300005539 | Bacteria | 2113 |
| 104 | Ga0070672_100219300 | 3300005543 | Bacteria | 1595 |
| 105 | Ga0070686_100047865 | 3300005544 | Bacteria | 2706 |
| 106 | Ga0070696_100015568 | 3300005546 | Bacteria | 5109 |
| 107 | Ga0070665_100000115 | 3300005548 | Bacteria | 151164 |
| 108 | Ga0070665_100002028 | 3300005548 | Bacteria | 22780 |
| 109 | Ga0070665_100007685 | 3300005548 | Bacteria | 10951 |
| 110 | Ga0070665_100272455 | 3300005548 | Bacteria | 1694 |
| 111 | Ga0068855_100040917 | 3300005563 | Bacteria | 5497 |
| 112 | Ga0068855_100230639 | 3300005563 | Bacteria | 2073 |
| 113 | Ga0070664_100005447 | 3300005564 | Bacteria | 10217 |
| 114 | Ga0070664_100101878 | 3300005564 | Bacteria | 2497 |
| 115 | Ga0068857_100015874 | 3300005577 | Bacteria | 6591 |
| 116 | Ga0068857_100025761 | 3300005577 | Bacteria | 5178 |
| 117 | Ga0068854_100011704 | 3300005578 | Bacteria | 5721 |
| 118 | Ga0068854_100014036 | 3300005578 | Bacteria | 5273 |
| 119 | Ga0068854_100026006 | 3300005578 | Bacteria | 4018 |
| 120 | Ga0068856_100004367 | 3300005614 | Bacteria | 14088 |
| 121 | Ga0068856_100252040 | 3300005614 | Bacteria | 1780 |
| 122 | Ga0068852_100091189 | 3300005616 | Bacteria | 2727 |
| 123 | Ga0068859_100000202 | 3300005617 | Bacteria | 58573 |
| 124 | Ga0068859_100141010 | 3300005617 | Bacteria | 2484 |
| 125 | Ga0068859_100235364 | 3300005617 | Bacteria | 1920 |
| 126 | Ga0068864_100001677 | 3300005618 | Bacteria | 18219 |
| 127 | Ga0068864_100002974 | 3300005618 | Bacteria | 14012 |
| 128 | Ga0068864_100143016 | 3300005618 | Bacteria | 2160 |
| 129 | Ga0068851_10008051 | 3300005834 | Bacteria | 4864 |
| 130 | Ga0068851_10024511 | 3300005834 | Bacteria | 2954 |
| 131 | Ga0068863_100000092 | 3300005841 | Bacteria | 97076 |
| 132 | Ga0068863_100006027 | 3300005841 | Bacteria | 11892 |
| 133 | Ga0068863_100027707 | 3300005841 | Bacteria | 5406 |
| 134 | Ga0068863_100030672 | 3300005841 | Bacteria | 5133 |
| 135 | Ga0068863_100053836 | 3300005841 | Bacteria | 3815 |
| 136 | Ga0068863_100071078 | 3300005841 | Bacteria | 3292 |
| 137 | Ga0068858_100000261 | 3300005842 | Bacteria | 56197 |
| 138 | Ga0068858_100000380 | 3300005842 | Bacteria | 46520 |
| 139 | Ga0068858_100001609 | 3300005842 | Bacteria | 23039 |
| 140 | Ga0068858_100042830 | 3300005842 | Bacteria | 4197 |
| 141 | Ga0068858_100058043 | 3300005842 | Bacteria | 3577 |
| 142 | Ga0068860_100000042 | 3300005843 | Bacteria | 227404 |
| 143 | Ga0068860_100064458 | 3300005843 | Bacteria | 3480 |
| 144 | Ga0068862_100000411 | 3300005844 | Bacteria | 46404 |
| 145 | Ga0068862_100008302 | 3300005844 | Bacteria | 8594 |
| 146 | Ga0068862_100010722 | 3300005844 | Bacteria | 7567 |
| 147 | Ga0081539_10066829 | 3300005985 | Bacteria | 1947 |
| 148 | Ga0075369_10025086 | 3300006186 | Bacteria | 2477 |
| 149 | Ga0075366_10063596 | 3300006195 | Bacteria | 2193 |
| 150 | Ga0068865_100000031 | 3300006881 | Bacteria | 88580 |
| 151 | Ga0097620_100000202 | 3300006931 | Bacteria | 58573 |
| 152 | Ga0097620_100141005 | 3300006931 | Bacteria | 2484 |
| 153 | Ga0097620_100235363 | 3300006931 | Bacteria | 1920 |
| 154 | Ga0075435_100013014 | 3300007076 | Bacteria | 6176 |
| 155 | Ga0105240_10009242 | 3300009093 | Bacteria | 13982 |
| 156 | Ga0105240_10021138 | 3300009093 | Bacteria | 8663 |
| 157 | Ga0105240_10390038 | 3300009093 | Bacteria | 1571 |
| 158 | Ga0105245_10002151 | 3300009098 | Bacteria | 17853 |
| 159 | Ga0105245_10013418 | 3300009098 | Bacteria | 7137 |
| 160 | Ga0105243_10000156 | 3300009148 | Bacteria | 78467 |
| 161 | Ga0105243_10001186 | 3300009148 | Bacteria | 23513 |
| 162 | Ga0105241_10209037 | 3300009174 | Bacteria | 1634 |
| 163 | Ga0105242_10004742 | 3300009176 | Bacteria | 10529 |
| 164 | Ga0105248_10001787 | 3300009177 | Bacteria | 23901 |
| 165 | Ga0105248_10005414 | 3300009177 | Bacteria | 14027 |
| 166 | Ga0105248_10016331 | 3300009177 | Bacteria | 8171 |
| 167 | Ga0105248_10054516 | 3300009177 | Bacteria | 4484 |
| 168 | Ga0105237_10005078 | 3300009545 | Bacteria | 14953 |
| 169 | Ga0105237_10170457 | 3300009545 | Bacteria | 2176 |
| 170 | Ga0105238_10112091 | 3300009551 | Bacteria | 2707 |
| 171 | Ga0105249_10001604 | 3300009553 | Bacteria | 19800 |
| 172 | Ga0105249_10004663 | 3300009553 | Bacteria | 11838 |
| 173 | Ga0105249_10031092 | 3300009553 | Bacteria | 4827 |
| 174 | Ga0105249_10125159 | 3300009553 | Bacteria | 2447 |
| 175 | Ga0105246_10000157 | 3300011119 | Bacteria | 32454 |
| 176 | Ga0157373_10019332 | 3300013100 | Bacteria | 4961 |
| 177 | Ga0157373_10105584 | 3300013100 | Bacteria | 1981 |
| 178 | Ga0157371_10000193 | 3300013102 | Bacteria | 90182 |
| 179 | Ga0157371_10014561 | 3300013102 | Bacteria | 5931 |
| 180 | Ga0157371_10130838 | 3300013102 | Bacteria | 1785 |
| 181 | Ga0157370_10007287 | 3300013104 | Bacteria | 12070 |
| 182 | Ga0157370_10028708 | 3300013104 | Bacteria | 5469 |
| 183 | Ga0157369_10005353 | 3300013105 | Bacteria | 14954 |
| 184 | Ga0157369_10056253 | 3300013105 | Bacteria | 4245 |
| 185 | Ga0157369_10062188 | 3300013105 | Bacteria | 4024 |
| 186 | Ga0157369_10091370 | 3300013105 | Bacteria | 3250 |
| 187 | Ga0157369_10215604 | 3300013105 | Bacteria | 2011 |
| 188 | Ga0157369_10264064 | 3300013105 | Bacteria | 1795 |
| 189 | Ga0157374_10000656 | 3300013296 | Bacteria | 30436 |
| 190 | Ga0157374_10002399 | 3300013296 | Bacteria | 15803 |
| 191 | Ga0157378_10000504 | 3300013297 | Bacteria | 37070 |
| 192 | Ga0163162_10017961 | 3300013306 | Bacteria | 6921 |
| 193 | Ga0163162_10113135 | 3300013306 | Bacteria | 2813 |
| 194 | Ga0163162_10132014 | 3300013306 | Bacteria | 2606 |
| 195 | Ga0157372_10030188 | 3300013307 | Bacteria | 5927 |
| 196 | Ga0157372_10060288 | 3300013307 | Bacteria | 4246 |
| 197 | Ga0157375_10003473 | 3300013308 | Bacteria | 13661 |
| 198 | Ga0157375_10104117 | 3300013308 | Bacteria | 2926 |
| 199 | Ga0157375_10278903 | 3300013308 | Bacteria | 1834 |
| 200 | Ga0163163_10136381 | 3300014325 | Bacteria | 2495 |
| 201 | Ga0157380_10004583 | 3300014326 | Bacteria | 9594 |
| 202 | Ga0157377_10003378 | 3300014745 | Bacteria | 7219 |
| 203 | Ga0157379_10005137 | 3300014968 | Bacteria | 11231 |
| 204 | Ga0157379_10224012 | 3300014968 | Bacteria | 1704 |
| 205 | Ga0157376_10000124 | 3300014969 | Bacteria | 53299 |
| 206 | Ga0213876_10003188 | 3300021384 | Bacteria | 9435 |
| 207 | Ga0213875_10007292 | 3300021388 | Bacteria | 5723 |
| 208 | Ga0209563_100030 | 3300025230 | Bacteria | 489259 |
| 209 | Ga0209437_103045 | 3300025233 | Bacteria | 3099 |
| 210 | Ga0209026_1002932 | 3300025250 | Bacteria | 5962 |
| 211 | Ga0209677_107247 | 3300025253 | Bacteria | 2404 |
| 212 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 213 | Ga0209148_1000059 | 3300025254 | Bacteria | 350224 |
| 214 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 215 | Ga0209233_1000052 | 3300025261 | Bacteria | 445813 |
| 216 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 217 | Ga0209675_1000025 | 3300025291 | Bacteria | 294102 |
| 218 | Ga0209676_1000221 | 3300025292 | Bacteria | 124715 |
| 219 | Ga0209676_1000483 | 3300025292 | Bacteria | 65133 |
| 220 | Ga0209025_1010313 | 3300025294 | Bacteria | 6346 |
| 221 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 222 | Ga0209758_1000033 | 3300025297 | Bacteria | 469998 |
| 223 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 224 | Ga0209050_1001210 | 3300025298 | Bacteria | 30282 |
| 225 | Ga0209257_1000135 | 3300025304 | Bacteria | 205668 |
| 226 | Ga0209257_1000532 | 3300025304 | Bacteria | 66089 |
| 227 | Ga0209257_1015531 | 3300025304 | Bacteria | 3161 |
| 228 | Ga0207697_10019384 | 3300025315 | Bacteria | 2786 |
| 229 | Ga0207697_10033709 | 3300025315 | Bacteria | 2095 |
| 230 | Ga0207656_10002880 | 3300025321 | Bacteria | 5865 |
| 231 | Ga0207656_10004383 | 3300025321 | Bacteria | 4925 |
| 232 | Ga0207696_1014662 | 3300025711 | Bacteria | 2681 |
| 233 | Ga0207682_10002218 | 3300025893 | Bacteria | 8762 |
| 234 | Ga0207680_10001079 | 3300025903 | Bacteria | 12871 |
| 235 | Ga0207680_10004576 | 3300025903 | Bacteria | 6568 |
| 236 | Ga0207647_10000038 | 3300025904 | Bacteria | 94897 |
| 237 | Ga0207647_10024022 | 3300025904 | Bacteria | 4022 |
| 238 | Ga0207647_10040387 | 3300025904 | Bacteria | 2939 |
| 239 | Ga0207645_10028697 | 3300025907 | Bacteria | 3591 |
| 240 | Ga0207705_10000059 | 3300025909 | Bacteria | 155683 |
| 241 | Ga0207705_10000178 | 3300025909 | Bacteria | 67084 |
| 242 | Ga0207705_10000237 | 3300025909 | Bacteria | 54736 |
| 243 | Ga0207705_10000511 | 3300025909 | Bacteria | 33036 |
| 244 | Ga0207705_10002823 | 3300025909 | Bacteria | 13285 |
| 245 | Ga0207705_10014106 | 3300025909 | Bacteria | 5757 |
| 246 | Ga0207705_10021462 | 3300025909 | Bacteria | 4609 |
| 247 | Ga0207654_10000227 | 3300025911 | Bacteria | 34512 |
| 248 | Ga0207654_10048133 | 3300025911 | Bacteria | 2439 |
| 249 | Ga0207707_10034592 | 3300025912 | Bacteria | 4421 |
| 250 | Ga0207695_10015591 | 3300025913 | Bacteria | 8939 |
| 251 | Ga0207695_10025115 | 3300025913 | Bacteria | 6683 |
| 252 | Ga0207695_10051267 | 3300025913 | Bacteria | 4335 |
| 253 | Ga0207695_10080646 | 3300025913 | Bacteria | 3295 |
| 254 | Ga0207671_10002570 | 3300025914 | Bacteria | 19248 |
| 255 | Ga0207671_10004432 | 3300025914 | Bacteria | 13437 |
| 256 | Ga0207671_10009213 | 3300025914 | Bacteria | 8280 |
| 257 | Ga0207660_10003328 | 3300025917 | Bacteria | 10490 |
| 258 | Ga0207660_10036415 | 3300025917 | Bacteria | 3421 |
| 259 | Ga0207657_10000289 | 3300025919 | Bacteria | 53536 |
| 260 | Ga0207657_10001241 | 3300025919 | Bacteria | 27265 |
| 261 | Ga0207657_10001372 | 3300025919 | Bacteria | 25957 |
| 262 | Ga0207657_10011870 | 3300025919 | Bacteria | 8623 |
| 263 | Ga0207657_10026062 | 3300025919 | Bacteria | 5379 |
| 264 | Ga0207657_10071295 | 3300025919 | Bacteria | 2942 |
| 265 | Ga0207657_10077725 | 3300025919 | Bacteria | 2796 |
| 266 | Ga0207657_10115251 | 3300025919 | Bacteria | 2215 |
| 267 | Ga0207649_10000134 | 3300025920 | Bacteria | 63335 |
| 268 | Ga0207649_10003792 | 3300025920 | Bacteria | 8244 |
| 269 | Ga0207649_10004660 | 3300025920 | Bacteria | 7421 |
| 270 | Ga0207649_10012897 | 3300025920 | Bacteria | 4654 |
| 271 | Ga0207649_10131843 | 3300025920 | Bacteria | 1699 |
| 272 | Ga0207652_10000047 | 3300025921 | Bacteria | 125286 |
| 273 | Ga0207652_10005457 | 3300025921 | Bacteria | 10320 |
| 274 | Ga0207652_10015360 | 3300025921 | Bacteria | 6218 |
| 275 | Ga0207652_10044682 | 3300025921 | Bacteria | 3775 |
| 276 | Ga0207681_10000008 | 3300025923 | Bacteria | 414329 |
| 277 | Ga0207681_10002989 | 3300025923 | Bacteria | 10627 |
| 278 | Ga0207681_10048215 | 3300025923 | Bacteria | 2874 |
| 279 | Ga0207694_10000683 | 3300025924 | Bacteria | 30452 |
| 280 | Ga0207650_10001881 | 3300025925 | Bacteria | 14819 |
| 281 | Ga0207650_10018173 | 3300025925 | Bacteria | 4931 |
| 282 | Ga0207650_10101789 | 3300025925 | Bacteria | 2212 |
| 283 | Ga0207650_10136167 | 3300025925 | Bacteria | 1927 |
| 284 | Ga0207659_10021352 | 3300025926 | Bacteria | 4296 |
| 285 | Ga0207687_10000798 | 3300025927 | Bacteria | 21269 |
| 286 | Ga0207664_10028396 | 3300025929 | Bacteria | 4251 |
| 287 | Ga0207644_10000006 | 3300025931 | Bacteria | 408793 |
| 288 | Ga0207644_10000088 | 3300025931 | Bacteria | 65977 |
| 289 | Ga0207644_10000094 | 3300025931 | Bacteria | 64592 |
| 290 | Ga0207644_10003333 | 3300025931 | Bacteria | 10365 |
| 291 | Ga0207644_10048321 | 3300025931 | Bacteria | 3041 |
| 292 | Ga0207644_10074058 | 3300025931 | Bacteria | 2498 |
| 293 | Ga0207690_10001226 | 3300025932 | Bacteria | 16188 |
| 294 | Ga0207690_10031664 | 3300025932 | Bacteria | 3387 |
| 295 | Ga0207690_10068645 | 3300025932 | Bacteria | 2436 |
| 296 | Ga0207706_10001712 | 3300025933 | Bacteria | 21630 |
| 297 | Ga0207706_10053046 | 3300025933 | Bacteria | 3580 |
| 298 | Ga0207686_10001385 | 3300025934 | Bacteria | 13769 |
| 299 | Ga0207709_10000246 | 3300025935 | Bacteria | 66685 |
| 300 | Ga0207709_10000447 | 3300025935 | Bacteria | 38701 |
| 301 | Ga0207669_10000030 | 3300025937 | Bacteria | 88341 |
| 302 | Ga0207669_10000989 | 3300025937 | Bacteria | 12093 |
| 303 | Ga0207669_10039652 | 3300025937 | Bacteria | 2724 |
| 304 | Ga0207669_10057738 | 3300025937 | Bacteria | 2364 |
| 305 | Ga0207704_10000008 | 3300025938 | Bacteria | 204682 |
| 306 | Ga0207691_10023274 | 3300025940 | Bacteria | 5832 |
| 307 | Ga0207691_10062142 | 3300025940 | Bacteria | 3391 |
| 308 | Ga0207691_10085922 | 3300025940 | Bacteria | 2823 |
| 309 | Ga0207691_10287244 | 3300025940 | Bacteria | 1415 |
| 310 | Ga0207711_10000946 | 3300025941 | Bacteria | 27905 |
| 311 | Ga0207711_10001082 | 3300025941 | Bacteria | 26041 |
| 312 | Ga0207711_10006078 | 3300025941 | Bacteria | 10202 |
| 313 | Ga0207689_10000701 | 3300025942 | Bacteria | 32104 |
| 314 | Ga0207689_10025288 | 3300025942 | Bacteria | 4975 |
| 315 | Ga0207661_10015224 | 3300025944 | Bacteria | 5656 |
| 316 | Ga0207661_10128219 | 3300025944 | Bacteria | 2169 |
| 317 | Ga0207679_10028352 | 3300025945 | Bacteria | 3884 |
| 318 | Ga0207679_10062649 | 3300025945 | Bacteria | 2772 |
| 319 | Ga0207679_10153505 | 3300025945 | Bacteria | 1877 |
| 320 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 321 | Ga0207667_10006208 | 3300025949 | Bacteria | 14505 |
| 322 | Ga0207667_10027810 | 3300025949 | Bacteria | 6150 |
| 323 | Ga0207667_10034843 | 3300025949 | Bacteria | 5403 |
| 324 | Ga0207667_10064884 | 3300025949 | Bacteria | 3810 |
| 325 | Ga0207667_10161261 | 3300025949 | Bacteria | 2306 |
| 326 | Ga0207667_10178536 | 3300025949 | Bacteria | 2181 |
| 327 | Ga0207651_10000008 | 3300025960 | Bacteria | 204538 |
| 328 | Ga0207712_10008250 | 3300025961 | Bacteria | 6584 |
| 329 | Ga0207712_10033435 | 3300025961 | Bacteria | 3476 |
| 330 | Ga0207668_10000076 | 3300025972 | Bacteria | 75056 |
| 331 | Ga0207668_10000731 | 3300025972 | Bacteria | 20103 |
| 332 | Ga0207668_10189232 | 3300025972 | Bacteria | 1630 |
| 333 | Ga0207640_10002626 | 3300025981 | Bacteria | 9629 |
| 334 | Ga0207640_10006133 | 3300025981 | Bacteria | 6575 |
| 335 | Ga0207640_10022315 | 3300025981 | Bacteria | 3786 |
| 336 | Ga0207640_10081303 | 3300025981 | Bacteria | 2215 |
| 337 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 338 | Ga0207658_10001246 | 3300025986 | Bacteria | 20116 |
| 339 | Ga0207658_10008943 | 3300025986 | Bacteria | 6793 |
| 340 | Ga0207658_10009111 | 3300025986 | Bacteria | 6733 |
| 341 | Ga0207677_10000091 | 3300026023 | Bacteria | 74163 |
| 342 | Ga0207677_10010628 | 3300026023 | Bacteria | 5214 |
| 343 | Ga0207703_10000253 | 3300026035 | Bacteria | 60255 |
| 344 | Ga0207703_10000847 | 3300026035 | Bacteria | 30021 |
| 345 | Ga0207703_10000896 | 3300026035 | Bacteria | 29159 |
| 346 | Ga0207703_10001312 | 3300026035 | Bacteria | 23010 |
| 347 | Ga0207703_10022154 | 3300026035 | Bacteria | 4980 |
| 348 | Ga0207639_10012330 | 3300026041 | Bacteria | 5952 |
| 349 | Ga0207639_10027739 | 3300026041 | Bacteria | 4128 |
| 350 | Ga0207639_10061676 | 3300026041 | Bacteria | 2897 |
| 351 | Ga0207639_10266005 | 3300026041 | Bacteria | 1502 |
| 352 | Ga0207678_10001389 | 3300026067 | Bacteria | 22281 |
| 353 | Ga0207678_10002781 | 3300026067 | Bacteria | 15861 |
| 354 | Ga0207678_10079085 | 3300026067 | Bacteria | 2816 |
| 355 | Ga0207702_10011067 | 3300026078 | Bacteria | 7531 |
| 356 | Ga0207702_10034470 | 3300026078 | Bacteria | 4232 |
| 357 | Ga0207702_10115054 | 3300026078 | Bacteria | 2398 |
| 358 | Ga0207702_10150367 | 3300026078 | Bacteria | 2117 |
| 359 | Ga0207702_10213199 | 3300026078 | Bacteria | 1796 |
| 360 | Ga0207641_10000004 | 3300026088 | Bacteria | 481088 |
| 361 | Ga0207641_10001025 | 3300026088 | Bacteria | 28336 |
| 362 | Ga0207641_10004732 | 3300026088 | Bacteria | 11737 |
| 363 | Ga0207641_10006197 | 3300026088 | Bacteria | 10119 |
| 364 | Ga0207641_10007148 | 3300026088 | Bacteria | 9321 |
| 365 | Ga0207641_10032708 | 3300026088 | Bacteria | 4319 |
| 366 | Ga0207648_10000009 | 3300026089 | Bacteria | 204229 |
| 367 | Ga0207648_10016823 | 3300026089 | Bacteria | 6668 |
| 368 | Ga0207648_10032807 | 3300026089 | Bacteria | 4582 |
| 369 | Ga0207676_10001115 | 3300026095 | Bacteria | 20336 |
| 370 | Ga0207676_10012257 | 3300026095 | Bacteria | 6136 |
| 371 | Ga0207676_10068907 | 3300026095 | Bacteria | 2831 |
| 372 | Ga0207674_10003055 | 3300026116 | Bacteria | 20711 |
| 373 | Ga0207674_10012450 | 3300026116 | Bacteria | 9506 |
| 374 | Ga0207674_10023243 | 3300026116 | Bacteria | 6641 |
| 375 | Ga0207674_10024567 | 3300026116 | Bacteria | 6435 |
| 376 | Ga0207674_10060765 | 3300026116 | Bacteria | 3821 |
| 377 | Ga0207675_100006088 | 3300026118 | Bacteria | 11475 |
| 378 | Ga0207675_100031426 | 3300026118 | Bacteria | 4946 |
| 379 | Ga0207683_10000075 | 3300026121 | Bacteria | 77829 |
| 380 | Ga0207683_10014781 | 3300026121 | Bacteria | 6644 |
| 381 | Ga0207683_10019752 | 3300026121 | Bacteria | 5755 |
| 382 | Ga0207683_10127463 | 3300026121 | Bacteria | 2288 |
| 383 | Ga0207683_10143593 | 3300026121 | Bacteria | 2151 |
| 384 | Ga0207683_10177557 | 3300026121 | Bacteria | 1930 |
| 385 | Ga0207683_10303379 | 3300026121 | Bacteria | 1461 |
| 386 | Ga0207698_10008427 | 3300026142 | Bacteria | 6521 |
| 387 | Ga0268266_10000015 | 3300028379 | Bacteria | 630629 |
| 388 | Ga0268266_10005032 | 3300028379 | Bacteria | 12478 |
| 389 | Ga0268266_10030749 | 3300028379 | Bacteria | 4561 |
| 390 | Ga0268266_10037453 | 3300028379 | Bacteria | 4132 |
| 391 | Ga0268265_10000392 | 3300028380 | Bacteria | 46740 |
| 392 | Ga0268265_10000582 | 3300028380 | Bacteria | 36910 |
| 393 | Ga0268265_10028903 | 3300028380 | Bacteria | 3974 |
| 394 | Ga0268265_10070971 | 3300028380 | Bacteria | 2710 |
| 395 | Ga0268265_10103527 | 3300028380 | Bacteria | 2305 |
| 396 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 397 | Ga0268264_10000310 | 3300028381 | Bacteria | 78142 |
| 398 | Ga0268264_10004774 | 3300028381 | Bacteria | 11499 |
| 399 | Ga0307517_10074308 | 3300028786 | Bacteria | 2999 |
| 400 | Ga0307515_10259608 | 3300028794 | Bacteria | 1476 |
| 401 | Ga0265320_10082223 | 3300031240 | Bacteria | 1502 |
| 402 | Ga0307513_10008420 | 3300031456 | Bacteria | 13207 |
| 403 | Ga0307513_10043231 | 3300031456 | Bacteria | 4952 |
| 404 | Ga0307408_100006783 | 3300031548 | Bacteria | 7590 |
| 405 | Ga0307408_100011783 | 3300031548 | Bacteria | 5783 |
| 406 | Ga0307408_100023154 | 3300031548 | Bacteria | 4228 |
| 407 | Ga0307408_100046549 | 3300031548 | Bacteria | 3103 |
| 408 | Ga0307508_10000317 | 3300031616 | Bacteria | 58176 |
| 409 | Ga0307405_10021699 | 3300031731 | Bacteria | 3615 |
| 410 | Ga0307405_10118278 | 3300031731 | Bacteria | 1808 |
| 411 | Ga0307405_10151293 | 3300031731 | Bacteria | 1632 |
| 412 | Ga0307413_10010952 | 3300031824 | Bacteria | 4430 |
| 413 | Ga0307413_10034949 | 3300031824 | Bacteria | 2878 |
| 414 | Ga0307413_10120854 | 3300031824 | Bacteria | 1774 |
| 415 | Ga0307410_10003471 | 3300031852 | Bacteria | 7910 |
| 416 | Ga0307410_10055511 | 3300031852 | Bacteria | 2689 |
| 417 | Ga0307410_10065496 | 3300031852 | Bacteria | 2499 |
| 418 | Ga0307410_10075957 | 3300031852 | Bacteria | 2344 |
| 419 | Ga0307410_10089542 | 3300031852 | Bacteria | 2181 |
| 420 | Ga0307410_10124425 | 3300031852 | Bacteria | 1885 |
| 421 | Ga0307406_10022142 | 3300031901 | Bacteria | 3768 |
| 422 | Ga0307406_10088807 | 3300031901 | Bacteria | 2075 |
| 423 | Ga0307406_10124168 | 3300031901 | Bacteria | 1800 |
| 424 | Ga0307407_10053599 | 3300031903 | Bacteria | 2321 |
| 425 | Ga0307407_10079225 | 3300031903 | Bacteria | 1981 |
| 426 | Ga0307412_10000557 | 3300031911 | Bacteria | 22165 |
| 427 | Ga0307412_10001749 | 3300031911 | Bacteria | 12005 |
| 428 | Ga0307412_10005086 | 3300031911 | Bacteria | 7355 |
| 429 | Ga0307412_10027029 | 3300031911 | Bacteria | 3573 |
| 430 | Ga0307412_10083568 | 3300031911 | Bacteria | 2214 |
| 431 | Ga0307412_10093027 | 3300031911 | Bacteria | 2114 |
| 432 | Ga0307412_10123685 | 3300031911 | Bacteria | 1867 |
| 433 | Ga0307409_100010084 | 3300031995 | Bacteria | 5847 |
| 434 | Ga0307409_100028665 | 3300031995 | Bacteria | 3971 |
| 435 | Ga0307409_100037418 | 3300031995 | Bacteria | 3578 |
| 436 | Ga0307409_100052098 | 3300031995 | Bacteria | 3136 |
| 437 | Ga0307409_100139807 | 3300031995 | Bacteria | 2084 |
| 438 | Ga0307409_100183054 | 3300031995 | Bacteria | 1857 |
| 439 | Ga0307416_100016486 | 3300032002 | Bacteria | 5139 |
| 440 | Ga0307416_100087366 | 3300032002 | Bacteria | 2661 |
| 441 | Ga0307416_100251629 | 3300032002 | Bacteria | 1720 |
| 442 | Ga0307414_10000288 | 3300032004 | Bacteria | 29634 |
| 443 | Ga0307414_10006350 | 3300032004 | Bacteria | 6585 |
| 444 | Ga0307414_10015729 | 3300032004 | Bacteria | 4576 |
| 445 | Ga0307414_10018174 | 3300032004 | Bacteria | 4320 |
| 446 | Ga0307414_10070228 | 3300032004 | Bacteria | 2521 |
| 447 | Ga0307414_10081531 | 3300032004 | Bacteria | 2369 |
| 448 | Ga0307414_10085284 | 3300032004 | Bacteria | 2326 |
| 449 | Ga0307414_10170380 | 3300032004 | Bacteria | 1740 |
| 450 | Ga0307411_10005369 | 3300032005 | Bacteria | 6285 |
| 451 | Ga0307411_10005662 | 3300032005 | Bacteria | 6165 |
| 452 | Ga0307411_10008930 | 3300032005 | Bacteria | 5231 |
| 453 | Ga0307411_10009704 | 3300032005 | Bacteria | 5082 |
| 454 | Ga0307411_10043799 | 3300032005 | Bacteria | 2865 |
| 455 | Ga0307411_10059278 | 3300032005 | Bacteria | 2537 |
| 456 | Ga0307411_10084853 | 3300032005 | Bacteria | 2192 |
| 457 | Ga0307411_10198859 | 3300032005 | Bacteria | 1537 |
| 458 | Ga0307415_100007272 | 3300032126 | Bacteria | 6047 |
| 459 | Ga0307415_100018321 | 3300032126 | Bacteria | 4225 |
| 460 | Ga0307415_100216765 | 3300032126 | Bacteria | 1531 |
| 461 | Ga0316583_10003553 | 3300032133 | Bacteria | 5502 |
| 462 | Ga0307510_10005954 | 3300033180 | Bacteria | 14551 |
| 463 | Ga0316584_0129385 | 3300036712 | Bacteria | 1886 |
| 464 | Ga0395899_0000406 | 3300037312 | Bacteria | 50248 |
| 465 | Ga0395899_0065327 | 3300037312 | Bacteria | 2674 |
| 466 | Ga0395899_0091624 | 3300037312 | Bacteria | 2202 |
| 467 | Ga0395899_0188444 | 3300037312 | Bacteria | 1444 |
| 468 | Ga0395900_0004543 | 3300037418 | Bacteria | 14685 |
| 469 | Ga0395900_0009343 | 3300037418 | Bacteria | 10053 |
| 470 | Ga0395900_0009895 | 3300037418 | Bacteria | 9765 |
| 471 | Ga0395900_0012195 | 3300037418 | Bacteria | 8786 |
| 472 | Ga0395900_0033345 | 3300037418 | Bacteria | 5299 |
| 473 | Ga0395900_0055176 | 3300037418 | Bacteria | 4091 |
| 474 | Ga0395898_0001585 | 3300037466 | Bacteria | 31078 |
| 475 | Ga0395898_0023344 | 3300037466 | Bacteria | 6251 |
| 476 | Ga0395898_0047627 | 3300037466 | Bacteria | 4206 |
| 477 | Ga0395905_0000089 | 3300037471 | Bacteria | 152196 |
| 478 | Ga0395905_0000412 | 3300037471 | Bacteria | 60157 |
| 479 | Ga0395905_0002105 | 3300037471 | Bacteria | 22623 |
| 480 | Ga0395905_0014350 | 3300037471 | Bacteria | 7570 |
| 481 | Ga0395905_0020721 | 3300037471 | Bacteria | 6225 |
| 482 | Ga0395905_0025055 | 3300037471 | Bacteria | 5626 |
| 483 | Ga0395905_0053079 | 3300037471 | Bacteria | 3795 |
| 484 | Ga0395905_0083023 | 3300037471 | Bacteria | 3002 |
| 485 | Ga0395905_0101480 | 3300037471 | Bacteria | 2701 |
| 486 | Ga0436364_1247405 | 3300037853 | Bacteria | 1652 |
| 487 | Ga0436364_1473539 | 3300037853 | Bacteria | 7661 |
| 488 | Ga0395901_0005879 | 3300038443 | Bacteria | 12416 |
| 489 | Ga0395901_0089589 | 3300038443 | Bacteria | 3219 |
| 490 | Ga0436365_1311515 | 3300039437 | Bacteria | 11736 |
| 491 | Ga0436365_1658932 | 3300039437 | Bacteria | 3238 |
| 492 | Ga0436363_1537430 | 3300039450 | Bacteria | 2076 |
| 493 | Ga0439461_0000051 | 3300041410 | Bacteria | 14159 |
| 494 | Ga0439465_0001873 | 3300041413 | Bacteria | 6876 |
| 495 | Ga0439431_0000131 | 3300041997 | Bacteria | 13310 |
| 496 | Ga0439432_016384 | 3300042006 | Bacteria | 2495 |
| 497 | Ga0439452_021228 | 3300042010 | Bacteria | 1695 |
| 498 | Ga0439462_0002208 | 3300042015 | Bacteria | 4491 |
| 499 | Ga0450905_003187 | 3300042142 | Bacteria | 2151 |
| 500 | Ga0439434_0002140 | 3300042435 | Bacteria | 5719 |
| 501 | Ga0466969_0002077 | 3300044656 | Bacteria | 10693 |
| 502 | Ga0466966_0000003 | 3300044684 | Bacteria | 233677 |
| 503 | Ga0466966_0029684 | 3300044684 | Bacteria | 3555 |
| 504 | Ga0466961_0009726 | 3300044693 | Bacteria | 6120 |
| 505 | Ga0466961_0064150 | 3300044693 | Bacteria | 2334 |
| 506 | Ga0466971_0036363 | 3300044719 | Bacteria | 2208 |
| 507 | Ga0466970_0022735 | 3300044765 | Bacteria | 3271 |
| 508 | Ga0466957_0000273 | 3300044842 | Bacteria | 25062 |
| 509 | Ga0466959_0005743 | 3300045049 | Bacteria | 8536 |
| 510 | Ga0466959_0038923 | 3300045049 | Bacteria | 3513 |
| 511 | Ga0451576_0000007 | 3300045051 | Bacteria | 782228 |
| 512 | Ga0466958_0013352 | 3300045836 | Bacteria | 4674 |
| 513 | Ga0466958_0074798 | 3300045836 | Bacteria | 2077 |
| 514 | Ga0495638_0000128 | 3300046460 | Bacteria | 123567 |
| 515 | Ga0495650_0000259 | 3300046471 | Bacteria | 102151 |
| 516 | Ga0495585_0005032 | 3300046492 | Bacteria | 8431 |
| 517 | Ga0495596_0000053 | 3300046500 | Bacteria | 84061 |
| 518 | Ga0495596_0006657 | 3300046500 | Bacteria | 5290 |
| 519 | Ga0495583_0001674 | 3300046506 | Bacteria | 21461 |
| 520 | Ga0495583_0026464 | 3300046506 | Bacteria | 2875 |
| 521 | Ga0495606_0000029 | 3300046507 | Bacteria | 250473 |
| 522 | Ga0495616_0000140 | 3300046513 | Bacteria | 63080 |
| 523 | Ga0495643_0002012 | 3300046522 | Bacteria | 16962 |
| 524 | Ga0495643_0002280 | 3300046522 | Bacteria | 15503 |
| 525 | Ga0495643_0023318 | 3300046522 | Bacteria | 3519 |
| 526 | Ga0495648_0001484 | 3300046524 | Bacteria | 22938 |
| 527 | Ga0495648_0099235 | 3300046524 | Bacteria | 1611 |
| 528 | Ga0495663_0003305 | 3300046525 | Bacteria | 4670 |
| 529 | Ga0495598_0000495 | 3300046537 | Bacteria | 7257 |
| 530 | Ga0495609_0016952 | 3300046538 | Bacteria | 3389 |
| 531 | Ga0495621_0000055 | 3300046539 | Bacteria | 21830 |
| 532 | Ga0495621_0042758 | 3300046539 | Bacteria | 1596 |
| 533 | Ga0495597_0024651 | 3300046542 | Bacteria | 2775 |
| 534 | Ga0495633_0001942 | 3300046558 | Bacteria | 15031 |
| 535 | Ga0495633_0003568 | 3300046558 | Bacteria | 10287 |
| 536 | Ga0495668_0000016 | 3300046616 | Bacteria | 438197 |
| 537 | Ga0495625_0000092 | 3300046660 | Bacteria | 146172 |
| 538 | Ga0495625_0033599 | 3300046660 | Bacteria | 3791 |
| 539 | Ga0495625_0072697 | 3300046660 | Bacteria | 2411 |
| 540 | Ga0495659_0030286 | 3300046664 | Bacteria | 1883 |
| 541 | Ga0495669_0000039 | 3300046684 | Bacteria | 92973 |
| 542 | Ga0495670_0000015 | 3300046691 | Bacteria | 131137 |
| 543 | Ga0495670_0000771 | 3300046691 | Bacteria | 15356 |
| 544 | Ga0495671_0023659 | 3300046692 | Bacteria | 3208 |
| 545 | Ga0495649_0032522 | 3300046694 | Bacteria | 2872 |
| 546 | Ga0495600_0008265 | 3300046809 | Bacteria | 6388 |
| 547 | Ga0495683_0008020 | 3300047323 | Bacteria | 5670 |
| 548 | Ga0495683_0028132 | 3300047323 | Bacteria | 2874 |
| 549 | Ga0495687_000471 | 3300047443 | Bacteria | 48815 |
| 550 | Ga0495687_001946 | 3300047443 | Bacteria | 17689 |
| 551 | Ga0495677_0004870 | 3300047445 | Bacteria | 5119 |
| 552 | Ga0495677_0007290 | 3300047445 | Bacteria | 4137 |
| 553 | Ga0495686_0000486 | 3300047472 | Bacteria | 58640 |
| 554 | Ga0496101_0010489 | 3300048904 | Bacteria | 6120 |
| 555 | Ga0496101_0020877 | 3300048904 | Bacteria | 4492 |
| 556 | Ga0496102_0000961 | 3300048905 | Bacteria | 27087 |
| 557 | Ga0496102_0013728 | 3300048905 | Bacteria | 7024 |
| 558 | Ga0496102_0101584 | 3300048905 | Bacteria | 2672 |
| 559 | Ga0496103_0000038 | 3300048906 | Bacteria | 178822 |
| 560 | Ga0496103_0000145 | 3300048906 | Bacteria | 74388 |
| 561 | Ga0496104_0000123 | 3300048907 | Bacteria | 71754 |
| 562 | Ga0496104_0014613 | 3300048907 | Bacteria | 7092 |
| 563 | Ga0496105_0000165 | 3300048908 | Bacteria | 43988 |
| 564 | Ga0496105_0000218 | 3300048908 | Bacteria | 38487 |
| 565 | Ga0496106_0004503 | 3300048909 | Bacteria | 10324 |
| 566 | Ga0496107_0012337 | 3300048910 | Bacteria | 5966 |
| 567 | Ga0496107_0106512 | 3300048910 | Bacteria | 2059 |
| 568 | Ga0496108_0035205 | 3300048911 | Bacteria | 4162 |
| 569 | Ga0496109_0010877 | 3300048912 | Bacteria | 7791 |
| 570 | Ga0496109_0013659 | 3300048912 | Bacteria | 7053 |
| 571 | Ga0496109_0026058 | 3300048912 | Bacteria | 5211 |
| 572 | Ga0496109_0264400 | 3300048912 | Bacteria | 1621 |
| 573 | Ga0496110_0013061 | 3300048913 | Bacteria | 6852 |
| 574 | Ga0496110_0015697 | 3300048913 | Bacteria | 6310 |
| 575 | Ga0496110_0026321 | 3300048913 | Bacteria | 4976 |
| 576 | Ga0496112_0002145 | 3300048915 | Bacteria | 15663 |
| 577 | Ga0496112_0008161 | 3300048915 | Bacteria | 9358 |
| 578 | Ga0496112_0045754 | 3300048915 | Bacteria | 4290 |
| 579 | Ga0496113_0009075 | 3300048916 | Bacteria | 6516 |
| 580 | Ga0496113_0056657 | 3300048916 | Bacteria | 2943 |
| 581 | Ga0496113_0095054 | 3300048916 | Bacteria | 2303 |
| 582 | Ga0496114_0002180 | 3300048917 | Bacteria | 14904 |
| 583 | Ga0496114_0002905 | 3300048917 | Bacteria | 13135 |
| 584 | Ga0496114_0025594 | 3300048917 | Bacteria | 4825 |
| 585 | Ga0496115_0001038 | 3300048918 | Bacteria | 20173 |
| 586 | Ga0496116_0001809 | 3300048919 | Bacteria | 23171 |
| 587 | Ga0496116_0012660 | 3300048919 | Bacteria | 6868 |
| 588 | Ga0496117_0000910 | 3300048920 | Bacteria | 45331 |
| 589 | Ga0496117_0018333 | 3300048920 | Bacteria | 5803 |
| 590 | Ga0496118_0000091 | 3300048921 | Bacteria | 173092 |
| 591 | Ga0496118_0009440 | 3300048921 | Bacteria | 9847 |
| 592 | Ga0496119_0001044 | 3300048922 | Bacteria | 35405 |
| 593 | Ga0496120_0001555 | 3300048923 | Bacteria | 26843 |
| 594 | Ga0496121_0000105 | 3300048924 | Bacteria | 191437 |
| 595 | Ga0496121_0000168 | 3300048924 | Bacteria | 144896 |
| 596 | Ga0496121_0000429 | 3300048924 | Bacteria | 82577 |
| 597 | Ga0496121_0016537 | 3300048924 | Bacteria | 7609 |
| 598 | Ga0496121_0033641 | 3300048924 | Bacteria | 4634 |
| 599 | Ga0496122_0001814 | 3300048925 | Bacteria | 32677 |
| 600 | Ga0496122_0029994 | 3300048925 | Bacteria | 4569 |
| 601 | Ga0496123_0003740 | 3300048926 | Bacteria | 16680 |
| 602 | Ga0496124_0000375 | 3300048927 | Bacteria | 81352 |
| 603 | Ga0496124_0000414 | 3300048927 | Bacteria | 76734 |
| 604 | Ga0496124_0005478 | 3300048927 | Bacteria | 14255 |
| 605 | Ga0496124_0062935 | 3300048927 | Bacteria | 3102 |
| 606 | Ga0496125_0001376 | 3300048928 | Bacteria | 35709 |
| 607 | Ga0496125_0003787 | 3300048928 | Bacteria | 17978 |
| 608 | Ga0496125_0005261 | 3300048928 | Bacteria | 14490 |
| 609 | Ga0496125_0056100 | 3300048928 | Bacteria | 3202 |
| 610 | Ga0496125_0098343 | 3300048928 | Bacteria | 2165 |
| 611 | Ga0496126_0000066 | 3300048929 | Bacteria | 252188 |
| 612 | Ga0496126_0000443 | 3300048929 | Bacteria | 82811 |
| 613 | Ga0501032_0228635 | 3300049569 | Bacteria | 1210 |
| 614 | Ga0501034_0202814 | 3300049571 | Bacteria | 1941 |
| 615 | Ga0501038_0032224 | 3300049574 | Bacteria | 4626 |
| 616 | Ga0501047_0153998 | 3300049581 | Bacteria | 2173 |
| 617 | Ga0501073_0020655 | 3300049589 | Bacteria | 4750 |
| 618 | Ga0501076_0012864 | 3300049592 | Bacteria | 6262 |
| 619 | Ga0501076_0249211 | 3300049592 | Bacteria | 1453 |
| 620 | Ga0501083_0074086 | 3300049744 | Bacteria | 2262 |
| 621 | Ga0501044_0310278 | 3300049823 | Bacteria | 1504 |
| 622 | nmdc:mga0rr50_9616_c1 | 3300050513 | Bacteria | 6090 |
| 623 | Ga0500610_0000231 | 3300053079 | Bacteria | 16928 |
| 624 | Ga0500643_000030 | 3300053087 | Bacteria | 206784 |
| 625 | Ga0500643_000465 | 3300053087 | Bacteria | 29876 |
| 626 | Ga0500643_007628 | 3300053087 | Bacteria | 4336 |
| 627 | Ga0500651_0019900 | 3300053093 | Bacteria | 4176 |
| 628 | Ga0500556_0000014 | 3300053104 | Bacteria | 232989 |
| 629 | Ga0500592_003087 | 3300053116 | Bacteria | 2662 |
| 630 | Ga0500594_0003951 | 3300053118 | Bacteria | 3267 |
| 631 | Ga0500595_001729 | 3300053119 | Bacteria | 11391 |
| 632 | Ga0500595_004099 | 3300053119 | Bacteria | 6607 |
| 633 | Ga0500608_000280 | 3300053122 | Bacteria | 19747 |
| 634 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 635 | Ga0500642_0000596 | 3300053130 | Bacteria | 10818 |
| 636 | Ga0500642_0013317 | 3300053130 | Bacteria | 3018 |
| 637 | Ga0500658_0008056 | 3300053134 | Bacteria | 3894 |
| 638 | Ga0500559_0062643 | 3300053136 | Bacteria | 1661 |
| 639 | Ga0500564_000953 | 3300053138 | Bacteria | 9400 |
| 640 | Ga0500573_0000271 | 3300053140 | Bacteria | 21909 |
| 641 | Ga0500588_0001660 | 3300053146 | Bacteria | 4308 |
| 642 | Ga0500604_0000027 | 3300053151 | Bacteria | 62112 |
| 643 | Ga0500604_0000984 | 3300053151 | Bacteria | 7930 |
| 644 | Ga0500616_0000730 | 3300053153 | Bacteria | 38013 |
| 645 | Ga0500636_0000462 | 3300053177 | Bacteria | 22121 |
| 646 | Ga0500567_000811 | 3300053723 | Bacteria | 11764 |
| 647 | Ga0500625_000006 | 3300053729 | Bacteria | 206258 |
| 648 | Ga0500645_000002 | 3300053730 | Bacteria | 388892 |
| 649 | Ga0500645_000315 | 3300053730 | Bacteria | 34548 |
| 650 | Ga0466962_0004869 | 3300061719 | Bacteria | 6457 |
| 651 | 2885427557 | 2885427238 | Bacteria | 2291351 |
| 652 | 2511126951 | 2510917021 | Bacteria | 5705459 |
| 653 | 2600201473 | 2599185354 | Bacteria | 4398675 |
| 654 | 2600228219 | 2599185359 | Bacteria | 4772316 |
| 655 | 2738711740 | 2738541275 | Bacteria | 4830863 |
| 656 | 2738850165 | 2738541301 | Bacteria | 4834102 |
| 657 | 2738865894 | 2738541304 | Bacteria | 4833665 |
| 658 | 2739298412 | 2738543022 | Bacteria | 4835059 |
| 659 | 2739360090 | 2738543033 | Bacteria | 4833336 |
| 660 | 2739649952 | 2739367664 | Bacteria | 4114334 |
| 661 | 2740028425 | 2739367865 | Bacteria | 4114482 |
| 662 | 2753763459 | 2751185897 | Bacteria | 5322941 |
| 663 | 2778124221 | 2775507255 | Bacteria | 3945731 |
| 664 | 2809064667 | 2808606401 | Bacteria | 4586670 |
| 665 | 2819716264 | 2818991466 | Bacteria | 4748179 |
| 666 | 2830077289 | 2830075706 | Bacteria | 3855215 |
| 667 | 2848299877 | 2848297114 | Bacteria | 3608511 |
| 668 | 2852655352 | 2852653556 | Bacteria | 4050083 |
| 669 | 2879163976 | 2879163058 | Bacteria | 4223965 |
| 670 | 2896184842 | 2896184354 | Bacteria | 3258548 |
| 671 | 2896431140 | 2896429255 | Bacteria | 2557483 |
| 672 | 2919139912 | 2919138771 | Bacteria | 5281312 |
| 673 | 2928101607 | 2928100450 | Bacteria | 4837635 |
| 674 | 2928528933 | 2928526807 | Bacteria | 4760224 |
| 675 | 2928959698 | 2928959182 | Bacteria | 4725774 |
| 676 | 2928970484 | 2928968154 | Bacteria | 4633371 |
| 677 | 2946787760 | 2946787523 | Bacteria | 4366789 |
| 678 | 3000866064 | 3000865235 | Bacteria | 3106258 |
| 679 | JGI24736J21556_1001126 | |||
| 680 | JGI24741J21665_1000819 | |||
| 681 | JGI24740J21852_10006234 | |||
| 682 | JGI24740J21852_10009346 | |||
| 683 | JGI24739J22299_10004115 | |||
| 684 | JGI24737J22298_10001056 | |||
| 685 | JGI24744J21845_10001869 | |||
| 686 | JGI25165J46597_1000023 | |||
| 687 | JGI25165J46597_1000095 | |||
| 688 | JGI25153J46596_10000010 | |||
| 689 | JGI25153J46596_10000031 | |||
| 690 | Ga0055525_1000012 | |||
| 691 | Ga0055542_1000322 | |||
| 692 | Ga0055529_1000014 | |||
| 693 | Ga0055536_1000422 | |||
| 694 | Ga0055534_1004498 | |||
| 695 | Ga0055530_10000013 | |||
| 696 | Ga0055531_10000449 | |||
| 697 | Ga0055531_10005592 | |||
| 698 | Ga0065165_1003177 | |||
| 699 | Ga0065704_10081931 | |||
| 700 | Ga0070658_10000536 | |||
| 701 | Ga0070658_10001914 | |||
| 702 | Ga0070658_10002770 | |||
| 703 | Ga0070658_10023150 | |||
| 704 | Ga0070658_10070918 | |||
| 705 | Ga0070658_10112917 | |||
| 706 | Ga0070658_10145987 | |||
| 707 | Ga0070676_10000031 | |||
| 708 | Ga0070683_100012146 | |||
| 709 | Ga0070683_100096732 | |||
| 710 | Ga0070670_100000344 | |||
| 711 | Ga0070670_100001938 | |||
| 712 | Ga0070670_100005554 | |||
| 713 | Ga0070670_100005597 | |||
| 714 | Ga0070670_100007510 | |||
| 715 | Ga0070670_100019126 | |||
| 716 | Ga0070670_100057317 | |||
| 717 | Ga0070670_100216764 | |||
| 718 | Ga0070666_10000160 | |||
| 719 | Ga0070666_10006279 | |||
| 720 | Ga0070666_10012951 | |||
| 721 | Ga0070666_10041785 | |||
| 722 | Ga0070680_100006780 | |||
| 723 | Ga0070680_100081701 | |||
| 724 | Ga0070680_100121595 | |||
| 725 | Ga0068868_100000403 | |||
| 726 | Ga0068868_100039288 | |||
| 727 | Ga0070660_100000700 | |||
| 728 | Ga0070660_100004814 | |||
| 729 | Ga0070660_100035146 | |||
| 730 | Ga0070660_100035906 | |||
| 731 | Ga0070660_100037408 | |||
| 732 | Ga0070660_100043991 | |||
| 733 | Ga0070660_100072829 | |||
| 734 | Ga0070660_100101908 | |||
| 735 | Ga0070661_100000130 | |||
| 736 | Ga0070661_100004468 | |||
| 737 | Ga0070661_100005092 | |||
| 738 | Ga0070661_100023171 | |||
| 739 | Ga0070661_100039939 | |||
| 740 | Ga0070661_100042155 | |||
| 741 | Ga0070661_100055001 | |||
| 742 | Ga0070668_100000028 | |||
| 743 | Ga0070668_100000049 | |||
| 744 | Ga0070668_100034913 | |||
| 745 | Ga0070669_100000013 | |||
| 746 | Ga0070669_100000715 | |||
| 747 | Ga0070669_100028017 | |||
| 748 | Ga0070675_100002284 | |||
| 749 | Ga0070675_100090365 | |||
| 750 | Ga0070671_100000009 | |||
| 751 | Ga0070671_100000269 | |||
| 752 | Ga0070671_100002542 | |||
| 753 | Ga0070671_100003648 | |||
| 754 | Ga0070671_100007269 | |||
| 755 | Ga0070671_100073908 | |||
| 756 | Ga0070674_100057051 | |||
| 757 | Ga0070673_100000022 | |||
| 758 | Ga0070659_100013393 | |||
| 759 | Ga0070659_100030333 | |||
| 760 | Ga0070659_100032663 | |||
| 761 | Ga0070667_100000009 | |||
| 762 | Ga0070667_100004908 | |||
| 763 | Ga0070667_100013603 | |||
| 764 | Ga0070667_100061234 | |||
| 765 | Ga0070705_100008071 | |||
| 766 | Ga0070663_100001359 | |||
| 767 | Ga0070663_100022084 | |||
| 768 | Ga0070663_100064573 | |||
| 769 | Ga0070678_100000060 | |||
| 770 | Ga0070678_100097180 | |||
| 771 | Ga0070662_100040801 | |||
| 772 | Ga0070662_100101657 | |||
| 773 | Ga0070681_10002429 | |||
| 774 | Ga0068867_100000023 | |||
| 775 | Ga0068867_100003900 | |||
| 776 | Ga0068867_100046955 | |||
| 777 | Ga0070679_100000021 | |||
| 778 | Ga0070679_100016861 | |||
| 779 | Ga0070679_100023181 | |||
| 780 | Ga0068853_100009284 | |||
| 781 | Ga0068853_100147801 | |||
| 782 | Ga0070672_100219300 | |||
| 783 | Ga0070686_100047865 | |||
| 784 | Ga0070696_100015568 | |||
| 785 | Ga0070665_100000115 | |||
| 786 | Ga0070665_100002028 | |||
| 787 | Ga0070665_100007685 | |||
| 788 | Ga0070665_100272455 | |||
| 789 | Ga0068855_100040917 | |||
| 790 | Ga0068855_100230639 | |||
| 791 | Ga0070664_100005447 | |||
| 792 | Ga0070664_100101878 | |||
| 793 | Ga0068857_100015874 | |||
| 794 | Ga0068857_100025761 | |||
| 795 | Ga0068854_100011704 | |||
| 796 | Ga0068854_100014036 | |||
| 797 | Ga0068854_100026006 | |||
| 798 | Ga0068856_100004367 | |||
| 799 | Ga0068856_100252040 | |||
| 800 | Ga0068852_100091189 | |||
| 801 | Ga0068859_100000202 | |||
| 802 | Ga0068859_100141010 | |||
| 803 | Ga0068859_100235364 | |||
| 804 | Ga0068864_100001677 | |||
| 805 | Ga0068864_100002974 | |||
| 806 | Ga0068864_100143016 | |||
| 807 | Ga0068851_10008051 | |||
| 808 | Ga0068851_10024511 | |||
| 809 | Ga0068863_100000092 | |||
| 810 | Ga0068863_100006027 | |||
| 811 | Ga0068863_100027707 | |||
| 812 | Ga0068863_100030672 | |||
| 813 | Ga0068863_100053836 | |||
| 814 | Ga0068863_100071078 | |||
| 815 | Ga0068858_100000261 | |||
| 816 | Ga0068858_100000380 | |||
| 817 | Ga0068858_100001609 | |||
| 818 | Ga0068858_100042830 | |||
| 819 | Ga0068858_100058043 | |||
| 820 | Ga0068860_100000042 | |||
| 821 | Ga0068860_100064458 | |||
| 822 | Ga0068862_100000411 | |||
| 823 | Ga0068862_100008302 | |||
| 824 | Ga0068862_100010722 | |||
| 825 | Ga0081539_10066829 | |||
| 826 | Ga0075369_10025086 | |||
| 827 | Ga0075366_10063596 | |||
| 828 | Ga0068865_100000031 | |||
| 829 | Ga0097620_100000202 | |||
| 830 | Ga0097620_100141005 | |||
| 831 | Ga0097620_100235363 | |||
| 832 | Ga0075435_100013014 | |||
| 833 | Ga0105240_10009242 | |||
| 834 | Ga0105240_10021138 | |||
| 835 | Ga0105240_10390038 | |||
| 836 | Ga0105245_10002151 | |||
| 837 | Ga0105245_10013418 | |||
| 838 | Ga0105243_10000156 | |||
| 839 | Ga0105243_10001186 | |||
| 840 | Ga0105241_10209037 | |||
| 841 | Ga0105242_10004742 | |||
| 842 | Ga0105248_10001787 | |||
| 843 | Ga0105248_10005414 | |||
| 844 | Ga0105248_10016331 | |||
| 845 | Ga0105248_10054516 | |||
| 846 | Ga0105237_10005078 | |||
| 847 | Ga0105237_10170457 | |||
| 848 | Ga0105238_10112091 | |||
| 849 | Ga0105249_10001604 | |||
| 850 | Ga0105249_10004663 | |||
| 851 | Ga0105249_10031092 | |||
| 852 | Ga0105249_10125159 | |||
| 853 | Ga0105246_10000157 | |||
| 854 | Ga0157373_10019332 | |||
| 855 | Ga0157373_10105584 | |||
| 856 | Ga0157371_10000193 | |||
| 857 | Ga0157371_10014561 | |||
| 858 | Ga0157371_10130838 | |||
| 859 | Ga0157370_10007287 | |||
| 860 | Ga0157370_10028708 | |||
| 861 | Ga0157369_10005353 | |||
| 862 | Ga0157369_10056253 | |||
| 863 | Ga0157369_10062188 | |||
| 864 | Ga0157369_10091370 | |||
| 865 | Ga0157369_10215604 | |||
| 866 | Ga0157369_10264064 | |||
| 867 | Ga0157374_10000656 | |||
| 868 | Ga0157374_10002399 | |||
| 869 | Ga0157378_10000504 | |||
| 870 | Ga0163162_10017961 | |||
| 871 | Ga0163162_10113135 | |||
| 872 | Ga0163162_10132014 | |||
| 873 | Ga0157372_10030188 | |||
| 874 | Ga0157372_10060288 | |||
| 875 | Ga0157375_10003473 | |||
| 876 | Ga0157375_10104117 | |||
| 877 | Ga0157375_10278903 | |||
| 878 | Ga0163163_10136381 | |||
| 879 | Ga0157380_10004583 | |||
| 880 | Ga0157377_10003378 | |||
| 881 | Ga0157379_10005137 | |||
| 882 | Ga0157379_10224012 | |||
| 883 | Ga0157376_10000124 | |||
| 884 | Ga0213876_10003188 | |||
| 885 | Ga0213875_10007292 | |||
| 886 | Ga0209563_100030 | |||
| 887 | Ga0209437_103045 | |||
| 888 | Ga0209026_1002932 | |||
| 889 | Ga0209677_107247 | |||
| 890 | Ga0209148_1000011 | |||
| 891 | Ga0209148_1000059 | |||
| 892 | Ga0209233_1000003 | |||
| 893 | Ga0209233_1000052 | |||
| 894 | Ga0209455_1000006 | |||
| 895 | Ga0209675_1000025 | |||
| 896 | Ga0209676_1000221 | |||
| 897 | Ga0209676_1000483 | |||
| 898 | Ga0209025_1010313 | |||
| 899 | Ga0209758_1000001 | |||
| 900 | Ga0209758_1000033 | |||
| 901 | Ga0209050_1000042 | |||
| 902 | Ga0209050_1001210 | |||
| 903 | Ga0209257_1000135 | |||
| 904 | Ga0209257_1000532 | |||
| 905 | Ga0209257_1015531 | |||
| 906 | Ga0207697_10019384 | |||
| 907 | Ga0207697_10033709 | |||
| 908 | Ga0207656_10002880 | |||
| 909 | Ga0207656_10004383 | |||
| 910 | Ga0207696_1014662 | |||
| 911 | Ga0207682_10002218 | |||
| 912 | Ga0207680_10001079 | |||
| 913 | Ga0207680_10004576 | |||
| 914 | Ga0207647_10000038 | |||
| 915 | Ga0207647_10024022 | |||
| 916 | Ga0207647_10040387 | |||
| 917 | Ga0207645_10028697 | |||
| 918 | Ga0207705_10000059 | |||
| 919 | Ga0207705_10000178 | |||
| 920 | Ga0207705_10000237 | |||
| 921 | Ga0207705_10000511 | |||
| 922 | Ga0207705_10002823 | |||
| 923 | Ga0207705_10014106 | |||
| 924 | Ga0207705_10021462 | |||
| 925 | Ga0207654_10000227 | |||
| 926 | Ga0207654_10048133 | |||
| 927 | Ga0207707_10034592 | |||
| 928 | Ga0207695_10015591 | |||
| 929 | Ga0207695_10025115 | |||
| 930 | Ga0207695_10051267 | |||
| 931 | Ga0207695_10080646 | |||
| 932 | Ga0207671_10002570 | |||
| 933 | Ga0207671_10004432 | |||
| 934 | Ga0207671_10009213 | |||
| 935 | Ga0207660_10003328 | |||
| 936 | Ga0207660_10036415 | |||
| 937 | Ga0207657_10000289 | |||
| 938 | Ga0207657_10001241 | |||
| 939 | Ga0207657_10001372 | |||
| 940 | Ga0207657_10011870 | |||
| 941 | Ga0207657_10026062 | |||
| 942 | Ga0207657_10071295 | |||
| 943 | Ga0207657_10077725 | |||
| 944 | Ga0207657_10115251 | |||
| 945 | Ga0207649_10000134 | |||
| 946 | Ga0207649_10003792 | |||
| 947 | Ga0207649_10004660 | |||
| 948 | Ga0207649_10012897 | |||
| 949 | Ga0207649_10131843 | |||
| 950 | Ga0207652_10000047 | |||
| 951 | Ga0207652_10005457 | |||
| 952 | Ga0207652_10015360 | |||
| 953 | Ga0207652_10044682 | |||
| 954 | Ga0207681_10000008 | |||
| 955 | Ga0207681_10002989 | |||
| 956 | Ga0207681_10048215 | |||
| 957 | Ga0207694_10000683 | |||
| 958 | Ga0207650_10001881 | |||
| 959 | Ga0207650_10018173 | |||
| 960 | Ga0207650_10101789 | |||
| 961 | Ga0207650_10136167 | |||
| 962 | Ga0207659_10021352 | |||
| 963 | Ga0207687_10000798 | |||
| 964 | Ga0207664_10028396 | |||
| 965 | Ga0207644_10000006 | |||
| 966 | Ga0207644_10000088 | |||
| 967 | Ga0207644_10000094 | |||
| 968 | Ga0207644_10003333 | |||
| 969 | Ga0207644_10048321 | |||
| 970 | Ga0207644_10074058 | |||
| 971 | Ga0207690_10001226 | |||
| 972 | Ga0207690_10031664 | |||
| 973 | Ga0207690_10068645 | |||
| 974 | Ga0207706_10001712 | |||
| 975 | Ga0207706_10053046 | |||
| 976 | Ga0207686_10001385 | |||
| 977 | Ga0207709_10000246 | |||
| 978 | Ga0207709_10000447 | |||
| 979 | Ga0207669_10000030 | |||
| 980 | Ga0207669_10000989 | |||
| 981 | Ga0207669_10039652 | |||
| 982 | Ga0207669_10057738 | |||
| 983 | Ga0207704_10000008 | |||
| 984 | Ga0207691_10023274 | |||
| 985 | Ga0207691_10062142 | |||
| 986 | Ga0207691_10085922 | |||
| 987 | Ga0207691_10287244 | |||
| 988 | Ga0207711_10000946 | |||
| 989 | Ga0207711_10001082 | |||
| 990 | Ga0207711_10006078 | |||
| 991 | Ga0207689_10000701 | |||
| 992 | Ga0207689_10025288 | |||
| 993 | Ga0207661_10015224 | |||
| 994 | Ga0207661_10128219 | |||
| 995 | Ga0207679_10028352 | |||
| 996 | Ga0207679_10062649 | |||
| 997 | Ga0207679_10153505 | |||
| 998 | Ga0207667_10000002 | |||
| 999 | Ga0207667_10006208 | |||
| 1000 | Ga0207667_10027810 | |||
| 1001 | Ga0207667_10034843 | |||
| 1002 | Ga0207667_10064884 | |||
| 1003 | Ga0207667_10161261 | |||
| 1004 | Ga0207667_10178536 | |||
| 1005 | Ga0207651_10000008 | |||
| 1006 | Ga0207712_10008250 | |||
| 1007 | Ga0207712_10033435 | |||
| 1008 | Ga0207668_10000076 | |||
| 1009 | Ga0207668_10000731 | |||
| 1010 | Ga0207668_10189232 | |||
| 1011 | Ga0207640_10002626 | |||
| 1012 | Ga0207640_10006133 | |||
| 1013 | Ga0207640_10022315 | |||
| 1014 | Ga0207640_10081303 | |||
| 1015 | Ga0207658_10000002 | |||
| 1016 | Ga0207658_10001246 | |||
| 1017 | Ga0207658_10008943 | |||
| 1018 | Ga0207658_10009111 | |||
| 1019 | Ga0207677_10000091 | |||
| 1020 | Ga0207677_10010628 | |||
| 1021 | Ga0207703_10000253 | |||
| 1022 | Ga0207703_10000847 | |||
| 1023 | Ga0207703_10000896 | |||
| 1024 | Ga0207703_10001312 | |||
| 1025 | Ga0207703_10022154 | |||
| 1026 | Ga0207639_10012330 | |||
| 1027 | Ga0207639_10027739 | |||
| 1028 | Ga0207639_10061676 | |||
| 1029 | Ga0207639_10266005 | |||
| 1030 | Ga0207678_10001389 | |||
| 1031 | Ga0207678_10002781 | |||
| 1032 | Ga0207678_10079085 | |||
| 1033 | Ga0207702_10011067 | |||
| 1034 | Ga0207702_10034470 | |||
| 1035 | Ga0207702_10115054 | |||
| 1036 | Ga0207702_10150367 | |||
| 1037 | Ga0207702_10213199 | |||
| 1038 | Ga0207641_10000004 | |||
| 1039 | Ga0207641_10001025 | |||
| 1040 | Ga0207641_10004732 | |||
| 1041 | Ga0207641_10006197 | |||
| 1042 | Ga0207641_10007148 | |||
| 1043 | Ga0207641_10032708 | |||
| 1044 | Ga0207648_10000009 | |||
| 1045 | Ga0207648_10016823 | |||
| 1046 | Ga0207648_10032807 | |||
| 1047 | Ga0207676_10001115 | |||
| 1048 | Ga0207676_10012257 | |||
| 1049 | Ga0207676_10068907 | |||
| 1050 | Ga0207674_10003055 | |||
| 1051 | Ga0207674_10012450 | |||
| 1052 | Ga0207674_10023243 | |||
| 1053 | Ga0207674_10024567 | |||
| 1054 | Ga0207674_10060765 | |||
| 1055 | Ga0207675_100006088 | |||
| 1056 | Ga0207675_100031426 | |||
| 1057 | Ga0207683_10000075 | |||
| 1058 | Ga0207683_10014781 | |||
| 1059 | Ga0207683_10019752 | |||
| 1060 | Ga0207683_10127463 | |||
| 1061 | Ga0207683_10143593 | |||
| 1062 | Ga0207683_10177557 | |||
| 1063 | Ga0207683_10303379 | |||
| 1064 | Ga0207698_10008427 | |||
| 1065 | Ga0268266_10000015 | |||
| 1066 | Ga0268266_10005032 | |||
| 1067 | Ga0268266_10030749 | |||
| 1068 | Ga0268266_10037453 | |||
| 1069 | Ga0268265_10000392 | |||
| 1070 | Ga0268265_10000582 | |||
| 1071 | Ga0268265_10028903 | |||
| 1072 | Ga0268265_10070971 | |||
| 1073 | Ga0268265_10103527 | |||
| 1074 | Ga0268264_10000001 | |||
| 1075 | Ga0268264_10000310 | |||
| 1076 | Ga0268264_10004774 | |||
| 1077 | Ga0307517_10074308 | |||
| 1078 | Ga0307515_10259608 | |||
| 1079 | Ga0265320_10082223 | |||
| 1080 | Ga0307513_10008420 | |||
| 1081 | Ga0307513_10043231 | |||
| 1082 | Ga0307408_100006783 | |||
| 1083 | Ga0307408_100011783 | |||
| 1084 | Ga0307408_100023154 | |||
| 1085 | Ga0307408_100046549 | |||
| 1086 | Ga0307508_10000317 | |||
| 1087 | Ga0307405_10021699 | |||
| 1088 | Ga0307405_10118278 | |||
| 1089 | Ga0307405_10151293 | |||
| 1090 | Ga0307413_10010952 | |||
| 1091 | Ga0307413_10034949 | |||
| 1092 | Ga0307413_10120854 | |||
| 1093 | Ga0307410_10003471 | |||
| 1094 | Ga0307410_10055511 | |||
| 1095 | Ga0307410_10065496 | |||
| 1096 | Ga0307410_10075957 | |||
| 1097 | Ga0307410_10089542 | |||
| 1098 | Ga0307410_10124425 | |||
| 1099 | Ga0307406_10022142 | |||
| 1100 | Ga0307406_10088807 | |||
| 1101 | Ga0307406_10124168 | |||
| 1102 | Ga0307407_10053599 | |||
| 1103 | Ga0307407_10079225 | |||
| 1104 | Ga0307412_10000557 | |||
| 1105 | Ga0307412_10001749 | |||
| 1106 | Ga0307412_10005086 | |||
| 1107 | Ga0307412_10027029 | |||
| 1108 | Ga0307412_10083568 | |||
| 1109 | Ga0307412_10093027 | |||
| 1110 | Ga0307412_10123685 | |||
| 1111 | Ga0307409_100010084 | |||
| 1112 | Ga0307409_100028665 | |||
| 1113 | Ga0307409_100037418 | |||
| 1114 | Ga0307409_100052098 | |||
| 1115 | Ga0307409_100139807 | |||
| 1116 | Ga0307409_100183054 | |||
| 1117 | Ga0307416_100016486 | |||
| 1118 | Ga0307416_100087366 | |||
| 1119 | Ga0307416_100251629 | |||
| 1120 | Ga0307414_10000288 | |||
| 1121 | Ga0307414_10006350 | |||
| 1122 | Ga0307414_10015729 | |||
| 1123 | Ga0307414_10018174 | |||
| 1124 | Ga0307414_10070228 | |||
| 1125 | Ga0307414_10081531 | |||
| 1126 | Ga0307414_10085284 | |||
| 1127 | Ga0307414_10170380 | |||
| 1128 | Ga0307411_10005369 | |||
| 1129 | Ga0307411_10005662 | |||
| 1130 | Ga0307411_10008930 | |||
| 1131 | Ga0307411_10009704 | |||
| 1132 | Ga0307411_10043799 | |||
| 1133 | Ga0307411_10059278 | |||
| 1134 | Ga0307411_10084853 | |||
| 1135 | Ga0307411_10198859 | |||
| 1136 | Ga0307415_100007272 | |||
| 1137 | Ga0307415_100018321 | |||
| 1138 | Ga0307415_100216765 | |||
| 1139 | Ga0316583_10003553 | |||
| 1140 | Ga0307510_10005954 | |||
| 1141 | Ga0316584_0129385 | |||
| 1142 | Ga0395899_0000406 | |||
| 1143 | Ga0395899_0065327 | |||
| 1144 | Ga0395899_0091624 | |||
| 1145 | Ga0395899_0188444 | |||
| 1146 | Ga0395900_0004543 | |||
| 1147 | Ga0395900_0009343 | |||
| 1148 | Ga0395900_0009895 | |||
| 1149 | Ga0395900_0012195 | |||
| 1150 | Ga0395900_0033345 | |||
| 1151 | Ga0395900_0055176 | |||
| 1152 | Ga0395898_0001585 | |||
| 1153 | Ga0395898_0023344 | |||
| 1154 | Ga0395898_0047627 | |||
| 1155 | Ga0395905_0000089 | |||
| 1156 | Ga0395905_0000412 | |||
| 1157 | Ga0395905_0002105 | |||
| 1158 | Ga0395905_0014350 | |||
| 1159 | Ga0395905_0020721 | |||
| 1160 | Ga0395905_0025055 | |||
| 1161 | Ga0395905_0053079 | |||
| 1162 | Ga0395905_0083023 | |||
| 1163 | Ga0395905_0101480 | |||
| 1164 | Ga0436364_1247405 | |||
| 1165 | Ga0436364_1473539 | |||
| 1166 | Ga0395901_0005879 | |||
| 1167 | Ga0395901_0089589 | |||
| 1168 | Ga0436365_1311515 | |||
| 1169 | Ga0436365_1658932 | |||
| 1170 | Ga0436363_1537430 | |||
| 1171 | Ga0439461_0000051 | |||
| 1172 | Ga0439465_0001873 | |||
| 1173 | Ga0439431_0000131 | |||
| 1174 | Ga0439432_016384 | |||
| 1175 | Ga0439452_021228 | |||
| 1176 | Ga0439462_0002208 | |||
| 1177 | Ga0450905_003187 | |||
| 1178 | Ga0439434_0002140 | |||
| 1179 | Ga0466969_0002077 | |||
| 1180 | Ga0466966_0000003 | |||
| 1181 | Ga0466966_0029684 | |||
| 1182 | Ga0466961_0009726 | |||
| 1183 | Ga0466961_0064150 | |||
| 1184 | Ga0466971_0036363 | |||
| 1185 | Ga0466970_0022735 | |||
| 1186 | Ga0466957_0000273 | |||
| 1187 | Ga0466959_0005743 | |||
| 1188 | Ga0466959_0038923 | |||
| 1189 | Ga0451576_0000007 | |||
| 1190 | Ga0466958_0013352 | |||
| 1191 | Ga0466958_0074798 | |||
| 1192 | Ga0495638_0000128 | |||
| 1193 | Ga0495650_0000259 | |||
| 1194 | Ga0495585_0005032 | |||
| 1195 | Ga0495596_0000053 | |||
| 1196 | Ga0495596_0006657 | |||
| 1197 | Ga0495583_0001674 | |||
| 1198 | Ga0495583_0026464 | |||
| 1199 | Ga0495606_0000029 | |||
| 1200 | Ga0495616_0000140 | |||
| 1201 | Ga0495643_0002012 | |||
| 1202 | Ga0495643_0002280 | |||
| 1203 | Ga0495643_0023318 | |||
| 1204 | Ga0495648_0001484 | |||
| 1205 | Ga0495648_0099235 | |||
| 1206 | Ga0495663_0003305 | |||
| 1207 | Ga0495598_0000495 | |||
| 1208 | Ga0495609_0016952 | |||
| 1209 | Ga0495621_0000055 | |||
| 1210 | Ga0495621_0042758 | |||
| 1211 | Ga0495597_0024651 | |||
| 1212 | Ga0495633_0001942 | |||
| 1213 | Ga0495633_0003568 | |||
| 1214 | Ga0495668_0000016 | |||
| 1215 | Ga0495625_0000092 | |||
| 1216 | Ga0495625_0033599 | |||
| 1217 | Ga0495625_0072697 | |||
| 1218 | Ga0495659_0030286 | |||
| 1219 | Ga0495669_0000039 | |||
| 1220 | Ga0495670_0000015 | |||
| 1221 | Ga0495670_0000771 | |||
| 1222 | Ga0495671_0023659 | |||
| 1223 | Ga0495649_0032522 | |||
| 1224 | Ga0495600_0008265 | |||
| 1225 | Ga0495683_0008020 | |||
| 1226 | Ga0495683_0028132 | |||
| 1227 | Ga0495687_000471 | |||
| 1228 | Ga0495687_001946 | |||
| 1229 | Ga0495677_0004870 | |||
| 1230 | Ga0495677_0007290 | |||
| 1231 | Ga0495686_0000486 | |||
| 1232 | Ga0496101_0010489 | |||
| 1233 | Ga0496101_0020877 | |||
| 1234 | Ga0496102_0000961 | |||
| 1235 | Ga0496102_0013728 | |||
| 1236 | Ga0496102_0101584 | |||
| 1237 | Ga0496103_0000038 | |||
| 1238 | Ga0496103_0000145 | |||
| 1239 | Ga0496104_0000123 | |||
| 1240 | Ga0496104_0014613 | |||
| 1241 | Ga0496105_0000165 | |||
| 1242 | Ga0496105_0000218 | |||
| 1243 | Ga0496106_0004503 | |||
| 1244 | Ga0496107_0012337 | |||
| 1245 | Ga0496107_0106512 | |||
| 1246 | Ga0496108_0035205 | |||
| 1247 | Ga0496109_0010877 | |||
| 1248 | Ga0496109_0013659 | |||
| 1249 | Ga0496109_0026058 | |||
| 1250 | Ga0496109_0264400 | |||
| 1251 | Ga0496110_0013061 | |||
| 1252 | Ga0496110_0015697 | |||
| 1253 | Ga0496110_0026321 | |||
| 1254 | Ga0496112_0002145 | |||
| 1255 | Ga0496112_0008161 | |||
| 1256 | Ga0496112_0045754 | |||
| 1257 | Ga0496113_0009075 | |||
| 1258 | Ga0496113_0056657 | |||
| 1259 | Ga0496113_0095054 | |||
| 1260 | Ga0496114_0002180 | |||
| 1261 | Ga0496114_0002905 | |||
| 1262 | Ga0496114_0025594 | |||
| 1263 | Ga0496115_0001038 | |||
| 1264 | Ga0496116_0001809 | |||
| 1265 | Ga0496116_0012660 | |||
| 1266 | Ga0496117_0000910 | |||
| 1267 | Ga0496117_0018333 | |||
| 1268 | Ga0496118_0000091 | |||
| 1269 | Ga0496118_0009440 | |||
| 1270 | Ga0496119_0001044 | |||
| 1271 | Ga0496120_0001555 | |||
| 1272 | Ga0496121_0000105 | |||
| 1273 | Ga0496121_0000168 | |||
| 1274 | Ga0496121_0000429 | |||
| 1275 | Ga0496121_0016537 | |||
| 1276 | Ga0496121_0033641 | |||
| 1277 | Ga0496122_0001814 | |||
| 1278 | Ga0496122_0029994 | |||
| 1279 | Ga0496123_0003740 | |||
| 1280 | Ga0496124_0000375 | |||
| 1281 | Ga0496124_0000414 | |||
| 1282 | Ga0496124_0005478 | |||
| 1283 | Ga0496124_0062935 | |||
| 1284 | Ga0496125_0001376 | |||
| 1285 | Ga0496125_0003787 | |||
| 1286 | Ga0496125_0005261 | |||
| 1287 | Ga0496125_0056100 | |||
| 1288 | Ga0496125_0098343 | |||
| 1289 | Ga0496126_0000066 | |||
| 1290 | Ga0496126_0000443 | |||
| 1291 | Ga0501032_0228635 | |||
| 1292 | Ga0501034_0202814 | |||
| 1293 | Ga0501038_0032224 | |||
| 1294 | Ga0501047_0153998 | |||
| 1295 | Ga0501073_0020655 | |||
| 1296 | Ga0501076_0012864 | |||
| 1297 | Ga0501076_0249211 | |||
| 1298 | Ga0501083_0074086 | |||
| 1299 | Ga0501044_0310278 | |||
| 1300 | nmdc:mga0rr50_9616_c1 | |||
| 1301 | Ga0500610_0000231 | |||
| 1302 | Ga0500643_000030 | |||
| 1303 | Ga0500643_000465 | |||
| 1304 | Ga0500643_007628 | |||
| 1305 | Ga0500651_0019900 | |||
| 1306 | Ga0500556_0000014 | |||
| 1307 | Ga0500592_003087 | |||
| 1308 | Ga0500594_0003951 | |||
| 1309 | Ga0500595_001729 | |||
| 1310 | Ga0500595_004099 | |||
| 1311 | Ga0500608_000280 | |||
| 1312 | Ga0500642_0000001 | |||
| 1313 | Ga0500642_0000596 | |||
| 1314 | Ga0500642_0013317 | |||
| 1315 | Ga0500658_0008056 | |||
| 1316 | Ga0500559_0062643 | |||
| 1317 | Ga0500564_000953 | |||
| 1318 | Ga0500573_0000271 | |||
| 1319 | Ga0500588_0001660 | |||
| 1320 | Ga0500604_0000027 | |||
| 1321 | Ga0500604_0000984 | |||
| 1322 | Ga0500616_0000730 | |||
| 1323 | Ga0500636_0000462 | |||
| 1324 | Ga0500567_000811 | |||
| 1325 | Ga0500625_000006 | |||
| 1326 | Ga0500645_000002 | |||
| 1327 | Ga0500645_000315 | |||
| 1328 | Ga0466962_0004869 | |||
| 1329 | 2885427557 | |||
| 1330 | 2511126951 | |||
| 1331 | 2600201473 | |||
| 1332 | 2600228219 | |||
| 1333 | 2738711740 | |||
| 1334 | 2738850165 | |||
| 1335 | 2738865894 | |||
| 1336 | 2739298412 | |||
| 1337 | 2739360090 | |||
| 1338 | 2739649952 | |||
| 1339 | 2740028425 | |||
| 1340 | 2753763459 | |||
| 1341 | 2778124221 | |||
| 1342 | 2809064667 | |||
| 1343 | 2819716264 | |||
| 1344 | 2830077289 | |||
| 1345 | 2848299877 | |||
| 1346 | 2852655352 | |||
| 1347 | 2879163976 | |||
| 1348 | 2896184842 | |||
| 1349 | 2896431140 | |||
| 1350 | 2919139912 | |||
| 1351 | 2928101607 | |||
| 1352 | 2928528933 | |||
| 1353 | 2928959698 | |||
| 1354 | 2928970484 | |||
| 1355 | 2946787760 | |||
| 1356 | 3000866064 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bgj-assembly1.cif.gz_A | c. thermophilum pyruvate dehydrogenase complex core | 0.935 | 154 | 356 |
| 7bgj-assembly1.cif.gz_A | c. thermophilum pyruvate dehydrogenase complex core | 0.9092 | 154 | 356 |
| 7wta-assembly1.cif.gz_D | cryo-em structure of human pyruvate carboxylase in apo state | 0.9068 | 17 | 61 |
| 4qoy-assembly2.cif.gz_F | novel binding motif and new flexibility revealed by structural analysis of a pyruvate dehydrogenase-dihydrolipoyl acetyltransferase sub-complex from the escherichia coli pyruvate dehydrogenase multi-enzyme complex | 0.8998 | 79 | 113 |
| 1w85-assembly1.cif.gz_I | the crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 | 0.8991 | 78 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54KE6_633_699_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.914 | 17 | 62 | 2.40.50.100 |
| 4qoyF00 | Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain | 0.8998 | 79 | 113 | 4.10.320.10 |
| af_Q8II35_15_156_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8882 | 13 | 59 | 2.40.50.100 |
| 1w88J00 | Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain | 0.8869 | 78 | 114 | 4.10.320.10 |
| af_Q58628_489_566_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8841 | 17 | 64 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A225X675-F1-model_v4 | deleted | 0.9704 | 164 | 355 |
|
| AF-A0A3S4H414-F1-model_v4 | Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12) | 0.9578 | 158 | 356 |
GO:0004742
GO:0006086 GO:0045254 |
| AF-A0A7C5DAU7-F1-model_v4 | 2-oxoacid dehydrogenase acyltransferase catalytic domain-containing protein | 0.9569 | 189 | 356 |
GO:0006086
GO:0016746 GO:0045254 |
| AF-A0A2F0AGV1-F1-model_v4 | Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase | 0.9552 | 188 | 356 |
GO:0006086
GO:0016746 GO:0045254 |
| AF-A0A6A0HCY1-F1-model_v4 | 2-oxoacid dehydrogenase acyltransferase catalytic domain-containing protein | 0.9537 | 216 | 298 |
GO:0004742
GO:0006086 GO:0045254 |