F474696

General Info

Members Datasets Scaffolds Average Seq Length
679 375 1358 253

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10001456|JGI25153J46596_100014564
Length 291
Sequence MTRPLSRVWGHACQDVKHAPYKYGWMLRPVRTMTAMMAYNCISRWSGALGVCAIIAVIRPAHADPRAVVELFTSQGCSSCPPADRIVGELAKDPSVIALSMPVDYWDYLGWKDTLADSQFSARQKAYSRARGDRNLYTPQMIVNGSAQVIGSDRTAIDGAIKSTSKSDGVMSLPVTMTLSGKQLNVSVDASKVDPTKVSTAAGHGEVWLCSVSRAVPISIGRGENRGREITYYNVVRSLVKVGDWNGSSGSWTIPVESISRDGVDAAVVYVQDGNRDKPGAMLGAAITELR

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
70 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
145 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
146 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
168 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
179 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
226 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
227 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
282 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
287 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
293 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
294 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
295 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
296 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
297 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
298 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
301 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
302 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
303 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
304 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
305 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
306 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
307 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
308 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
309 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
310 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
311 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
312 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
313 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
314 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
315 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
316 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
317 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
318 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
319 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
320 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
321 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
322 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
323 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
324 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
325 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
326 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
327 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
328 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
331 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
332 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
333 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
334 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
335 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
336 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
337 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
338 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
339 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
340 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
341 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
342 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
343 2791355199
344 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
345 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
346 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
347 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
348 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
349 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
350 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
351 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
352 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
353 2904699407
354 2906610324
355 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
356 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
357 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
358 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
359 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
360 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
361 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
362 2922425934
363 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
364 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
365 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
366 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
367 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
368 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
369 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
370 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
371 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
372 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
373 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
374 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
375 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.63
Metatranscriptomes 0.3
Isolates 6.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.29
Nodule 5.01
Rhizoplane 7.22
Rhizosphere 66.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001456 3300003215 Bacteria 14140
2 Ga0058862_12818071 3300004803 Bacteria 1422
3 Ga0070658_10018416 3300005327 Bacteria 5590
4 Ga0070658_10151665 3300005327 Bacteria 1941
5 Ga0070658_10654042 3300005327 Bacteria 912
6 Ga0070676_10072281 3300005328 Bacteria 2073
7 Ga0070670_100316467 3300005331 Bacteria 1367
8 Ga0068869_100008039 3300005334 Bacteria 6775
9 Ga0068869_100071840 3300005334 Bacteria 2563
10 Ga0070666_10158518 3300005335 Bacteria 1581
11 Ga0070680_100089363 3300005336 Bacteria 2549
12 Ga0068868_100038810 3300005338 Bacteria 3697
13 Ga0068868_100068988 3300005338 Bacteria 2816
14 Ga0070660_100198523 3300005339 Bacteria 1627
15 Ga0070661_100050714 3300005344 Bacteria 3036
16 Ga0070668_100137628 3300005347 Bacteria 1965
17 Ga0070675_100071429 3300005354 Bacteria 2880
18 Ga0070671_100201098 3300005355 Bacteria 1689
19 Ga0070671_100257000 3300005355 Bacteria 1484
20 Ga0070674_100320439 3300005356 Bacteria 1242
21 Ga0070673_100212984 3300005364 Bacteria 1669
22 Ga0070673_100372385 3300005364 Bacteria 1272
23 Ga0070688_100246769 3300005365 Bacteria 1270
24 Ga0070667_100313439 3300005367 Bacteria 1414
25 Ga0070709_10033719 3300005434 Bacteria 3099
26 Ga0070709_10129067 3300005434 Bacteria 1723
27 Ga0070714_100047774 3300005435 Bacteria 3638
28 Ga0070714_100517156 3300005435 Bacteria 1140
29 Ga0070714_100746510 3300005435 Bacteria 946
30 Ga0070713_100025592 3300005436 Bacteria 4617
31 Ga0070713_100062515 3300005436 Bacteria 3119
32 Ga0070713_100085323 3300005436 Bacteria 2705
33 Ga0070710_10015251 3300005437 Bacteria 3886
34 Ga0070710_10097745 3300005437 Bacteria 1743
35 Ga0070711_100004422 3300005439 Bacteria 8294
36 Ga0070711_100009133 3300005439 Bacteria 6092
37 Ga0070711_100041666 3300005439 Bacteria 3103
38 Ga0070711_100102936 3300005439 Bacteria 2080
39 Ga0070700_100157361 3300005441 Bacteria 1560
40 Ga0070694_100153880 3300005444 Bacteria 1682
41 Ga0070663_100017376 3300005455 Bacteria 4693
42 Ga0070663_100051597 3300005455 Bacteria 2931
43 Ga0070663_100055706 3300005455 Bacteria 2831
44 Ga0070663_100120081 3300005455 Bacteria 1984
45 Ga0070663_100154614 3300005455 Bacteria 1761
46 Ga0070678_100075681 3300005456 Bacteria 2533
47 Ga0070678_100142051 3300005456 Bacteria 1922
48 Ga0070678_100256563 3300005456 Bacteria 1468
49 Ga0070662_100214671 3300005457 Bacteria 1532
50 Ga0068867_100615759 3300005459 Bacteria 949
51 Ga0070698_100171701 3300005471 Bacteria 2109
52 Ga0070684_100075527 3300005535 Bacteria 2973
53 Ga0070697_100120225 3300005536 Bacteria 2197
54 Ga0070686_100317157 3300005544 Bacteria 1161
55 Ga0070665_100057702 3300005548 Bacteria 3892
56 Ga0070665_100058941 3300005548 Bacteria 3848
57 Ga0070665_100130665 3300005548 Bacteria 2513
58 Ga0070665_100482314 3300005548 Bacteria 1251
59 Ga0068855_100081140 3300005563 Bacteria 3760
60 Ga0070664_100164554 3300005564 Bacteria 1965
61 Ga0070664_100178494 3300005564 Bacteria 1886
62 Ga0068857_100109784 3300005577 Bacteria 2479
63 Ga0068856_100101531 3300005614 Bacteria 2869
64 Ga0068856_100244713 3300005614 Bacteria 1809
65 Ga0068856_100748900 3300005614 Bacteria 997
66 Ga0068852_100086369 3300005616 Bacteria 2796
67 Ga0068852_100758637 3300005616 Bacteria 983
68 Ga0068864_100752922 3300005618 Bacteria 955
69 Ga0068864_100824929 3300005618 Bacteria 913
70 Ga0068861_100115772 3300005719 Bacteria 2154
71 Ga0068861_100170064 3300005719 Bacteria 1805
72 Ga0068851_10070316 3300005834 Bacteria 1810
73 Ga0068870_10047558 3300005840 Bacteria 2256
74 Ga0068863_100179528 3300005841 Bacteria 2032
75 Ga0068863_100183758 3300005841 Bacteria 2007
76 Ga0068863_100402125 3300005841 Bacteria 1340
77 Ga0068858_100143132 3300005842 Bacteria 2245
78 Ga0068858_100342770 3300005842 Bacteria 1430
79 Ga0068860_100089952 3300005843 Bacteria 2923
80 Ga0068860_100269458 3300005843 Bacteria 1661
81 Ga0068860_100450645 3300005843 Bacteria 1279
82 Ga0068860_100828069 3300005843 Bacteria 939
83 Ga0068862_100073767 3300005844 Bacteria 2949
84 Ga0068862_100148021 3300005844 Bacteria 2088
85 Ga0068862_100295921 3300005844 Bacteria 1488
86 Ga0068862_100646656 3300005844 Bacteria 1020
87 Ga0081455_10000738 3300005937 Bacteria 42457
88 Ga0081455_10025851 3300005937 Bacteria 5412
89 Ga0081455_10064054 3300005937 Bacteria 3080
90 Ga0081455_10148642 3300005937 Bacteria 1809
91 Ga0081455_10201335 3300005937 Bacteria 1491
92 Ga0081538_10079023 3300005981 Bacteria 1762
93 Ga0081540_1005580 3300005983 Bacteria 9369
94 Ga0081540_1016110 3300005983 Bacteria 4699
95 Ga0081540_1027392 3300005983 Bacteria 3230
96 Ga0081540_1047066 3300005983 Bacteria 2172
97 Ga0081539_10036105 3300005985 Bacteria 2962
98 Ga0070717_10003277 3300006028 Bacteria 11581
99 Ga0075365_10031473 3300006038 Bacteria 3403
100 Ga0075365_10102593 3300006038 Bacteria 1960
101 Ga0075365_10178477 3300006038 Bacteria 1484
102 Ga0075365_10363380 3300006038 Bacteria 1020
103 Ga0075368_10031400 3300006042 Bacteria 2060
104 Ga0075363_100034166 3300006048 Bacteria 2653
105 Ga0075363_100051697 3300006048 Bacteria 2192
106 Ga0070715_10004000 3300006163 Bacteria 4778
107 Ga0070715_10090479 3300006163 Bacteria 1407
108 Ga0070716_100005454 3300006173 Bacteria 6164
109 Ga0070716_100038916 3300006173 Bacteria 2636
110 Ga0070716_100105608 3300006173 Bacteria 1736
111 Ga0070712_100016936 3300006175 Bacteria 4712
112 Ga0070712_100122654 3300006175 Bacteria 1958
113 Ga0070712_100194709 3300006175 Bacteria 1588
114 Ga0075362_10019842 3300006177 Bacteria 2801
115 Ga0075367_10141125 3300006178 Bacteria 1492
116 Ga0075367_10156995 3300006178 Bacteria 1414
117 Ga0075369_10138286 3300006186 Bacteria 1109
118 Ga0075369_10140072 3300006186 Bacteria 1102
119 Ga0075366_10014376 3300006195 Bacteria 4520
120 Ga0075366_10044905 3300006195 Bacteria 2619
121 Ga0097621_100080381 3300006237 Bacteria 2711
122 Ga0097621_100261072 3300006237 Bacteria 1519
123 Ga0097621_100287856 3300006237 Bacteria 1448
124 Ga0075370_10191668 3300006353 Bacteria 1205
125 Ga0068871_100346586 3300006358 Bacteria 1313
126 Ga0068871_100468481 3300006358 Bacteria 1131
127 Ga0068871_100532700 3300006358 Bacteria 1062
128 Ga0075428_100240637 3300006844 Bacteria 1952
129 Ga0075434_100188658 3300006871 Bacteria 2082
130 Ga0068865_100298342 3300006881 Bacteria 1289
131 Ga0099824_1019648 3300006942 Bacteria 5190
132 Ga0099822_1008883 3300006943 Bacteria 12778
133 Ga0105240_10165993 3300009093 Bacteria 2619
134 Ga0111539_10619133 3300009094 Bacteria 1261
135 Ga0105245_10169164 3300009098 Bacteria 2080
136 Ga0105247_10048391 3300009101 Bacteria 2611
137 Ga0105247_10094599 3300009101 Bacteria 1901
138 Ga0114129_10267532 3300009147 Bacteria 2288
139 Ga0105243_10339987 3300009148 Bacteria 1374
140 Ga0105242_10192860 3300009176 Bacteria 1805
141 Ga0105242_10200085 3300009176 Bacteria 1774
142 Ga0105248_10049220 3300009177 Bacteria 4726
143 Ga0105248_10251367 3300009177 Bacteria 1990
144 Ga0105248_10274604 3300009177 Bacteria 1898
145 Ga0105237_10043325 3300009545 Bacteria 4534
146 Ga0105237_10056083 3300009545 Bacteria 3945
147 Ga0105237_10122663 3300009545 Bacteria 2593
148 Ga0105237_10421409 3300009545 Bacteria 1340
149 Ga0105238_10324955 3300009551 Bacteria 1525
150 Ga0105238_10634585 3300009551 Bacteria 1078
151 Ga0105249_10266517 3300009553 Bacteria 1704
152 Ga0105249_10293029 3300009553 Bacteria 1629
153 Ga0105249_10578080 3300009553 Bacteria 1176
154 Ga0105239_10065592 3300010375 Bacteria 3987
155 Ga0105239_10094165 3300010375 Bacteria 3308
156 Ga0105239_10206498 3300010375 Bacteria 2201
157 Ga0105239_10351752 3300010375 Bacteria 1664
158 Ga0105246_10030455 3300011119 Bacteria 3564
159 Ga0105246_10106172 3300011119 Bacteria 2053
160 Ga0105246_10184580 3300011119 Bacteria 1609
161 Ga0105246_10218762 3300011119 Bacteria 1491
162 Ga0105246_10345561 3300011119 Bacteria 1217
163 Ga0157370_10075338 3300013104 Bacteria 3181
164 Ga0157374_10064925 3300013296 Bacteria 3427
165 Ga0157374_10087618 3300013296 Bacteria 2964
166 Ga0157378_10148348 3300013297 Bacteria 2184
167 Ga0157378_10187121 3300013297 Bacteria 1951
168 Ga0157378_10279125 3300013297 Bacteria 1610
169 Ga0163162_10075477 3300013306 Bacteria 3432
170 Ga0163162_10214567 3300013306 Bacteria 2055
171 Ga0157372_10276441 3300013307 Bacteria 1952
172 Ga0157372_10406730 3300013307 Bacteria 1586
173 Ga0157375_10056026 3300013308 Bacteria 3889
174 Ga0157375_10180586 3300013308 Bacteria 2261
175 Ga0157375_10876356 3300013308 Bacteria 1043
176 Ga0163163_10026240 3300014325 Bacteria 5566
177 Ga0163163_10081541 3300014325 Bacteria 3237
178 Ga0163163_10164337 3300014325 Bacteria 2265
179 Ga0163163_10235371 3300014325 Bacteria 1881
180 Ga0157380_10294116 3300014326 Bacteria 1493
181 Ga0157380_10771102 3300014326 Bacteria 975
182 Ga0157377_10101279 3300014745 Bacteria 1717
183 Ga0157379_10110012 3300014968 Bacteria 2475
184 Ga0157379_10178822 3300014968 Bacteria 1916
185 Ga0157379_10280289 3300014968 Bacteria 1517
186 Ga0157376_10258911 3300014969 Bacteria 1629
187 Ga0157376_10336588 3300014969 Bacteria 1440
188 Ga0163161_10084369 3300017792 Bacteria 2343
189 Ga0206350_10137578 3300020080 Bacteria 1396
190 Ga0209564_1018161 3300025295 Bacteria 2696
191 Ga0209758_1001013 3300025297 Bacteria 37209
192 Ga0209758_1003254 3300025297 Bacteria 15064
193 Ga0207697_10060484 3300025315 Bacteria 1575
194 Ga0207697_10148414 3300025315 Bacteria 1019
195 Ga0207656_10032438 3300025321 Bacteria 2170
196 Ga0207692_10090498 3300025898 Bacteria 1658
197 Ga0207692_10233475 3300025898 Bacteria 1095
198 Ga0207642_10138646 3300025899 Bacteria 1279
199 Ga0207710_10106011 3300025900 Bacteria 1330
200 Ga0207688_10058674 3300025901 Bacteria 2166
201 Ga0207647_10005652 3300025904 Bacteria 9134
202 Ga0207699_10106961 3300025906 Bacteria 1786
203 Ga0207643_10032073 3300025908 Bacteria 2932
204 Ga0207643_10183594 3300025908 Bacteria 1267
205 Ga0207654_10013803 3300025911 Bacteria 4162
206 Ga0207707_10101414 3300025912 Bacteria 2515
207 Ga0207693_10116621 3300025915 Bacteria 2096
208 Ga0207693_10125347 3300025915 Bacteria 2018
209 Ga0207693_10193305 3300025915 Bacteria 1601
210 Ga0207663_10008619 3300025916 Bacteria 5347
211 Ga0207663_10071411 3300025916 Bacteria 2240
212 Ga0207657_10143659 3300025919 Bacteria 1948
213 Ga0207657_10199184 3300025919 Bacteria 1612
214 Ga0207650_10184914 3300025925 Bacteria 1662
215 Ga0207650_10300888 3300025925 Bacteria 1310
216 Ga0207687_10072079 3300025927 Bacteria 2470
217 Ga0207687_10156595 3300025927 Bacteria 1744
218 Ga0207700_10037943 3300025928 Bacteria 3494
219 Ga0207700_10275401 3300025928 Bacteria 1446
220 Ga0207700_10324849 3300025928 Bacteria 1334
221 Ga0207644_10213018 3300025931 Bacteria 1528
222 Ga0207644_10228643 3300025931 Bacteria 1477
223 Ga0207644_10234979 3300025931 Bacteria 1458
224 Ga0207706_10085043 3300025933 Bacteria 2781
225 Ga0207706_10390982 3300025933 Bacteria 1206
226 Ga0207709_10158539 3300025935 Bacteria 1576
227 Ga0207669_10114095 3300025937 Bacteria 1818
228 Ga0207669_10216885 3300025937 Bacteria 1401
229 Ga0207704_10164664 3300025938 Bacteria 1582
230 Ga0207704_10168613 3300025938 Bacteria 1567
231 Ga0207704_10283426 3300025938 Bacteria 1261
232 Ga0207704_10534002 3300025938 Bacteria 951
233 Ga0207665_10006607 3300025939 Bacteria 7691
234 Ga0207665_10050758 3300025939 Bacteria 2790
235 Ga0207665_10066689 3300025939 Bacteria 2450
236 Ga0207665_10092055 3300025939 Bacteria 2103
237 Ga0207665_10244330 3300025939 Bacteria 1324
238 Ga0207691_10062121 3300025940 Bacteria 3391
239 Ga0207691_10163430 3300025940 Bacteria 1952
240 Ga0207711_10235178 3300025941 Bacteria 1679
241 Ga0207711_10407151 3300025941 Bacteria 1264
242 Ga0207711_10518542 3300025941 Bacteria 1111
243 Ga0207689_10168082 3300025942 Bacteria 1807
244 Ga0207689_10188629 3300025942 Bacteria 1701
245 Ga0207689_10203857 3300025942 Bacteria 1633
246 Ga0207661_10297621 3300025944 Bacteria 1446
247 Ga0207679_10094577 3300025945 Bacteria 2321
248 Ga0207679_10157750 3300025945 Bacteria 1854
249 Ga0207651_10145524 3300025960 Bacteria 1837
250 Ga0207712_10065403 3300025961 Bacteria 2595
251 Ga0207712_10314144 3300025961 Bacteria 1290
252 Ga0207668_10081463 3300025972 Bacteria 2348
253 Ga0207668_10109738 3300025972 Bacteria 2067
254 Ga0207668_10277611 3300025972 Bacteria 1372
255 Ga0207668_10320965 3300025972 Bacteria 1285
256 Ga0207640_10232926 3300025981 Bacteria 1418
257 Ga0207658_10083135 3300025986 Bacteria 2460
258 Ga0207677_10030493 3300026023 Bacteria 3443
259 Ga0207677_10244293 3300026023 Bacteria 1454
260 Ga0207703_10198817 3300026035 Bacteria 1780
261 Ga0207703_10364056 3300026035 Bacteria 1334
262 Ga0207703_10413117 3300026035 Bacteria 1254
263 Ga0207639_10564587 3300026041 Bacteria 1046
264 Ga0207678_10004213 3300026067 Bacteria 12909
265 Ga0207678_10037796 3300026067 Bacteria 4198
266 Ga0207678_10083926 3300026067 Bacteria 2725
267 Ga0207678_10102629 3300026067 Bacteria 2441
268 Ga0207678_10287671 3300026067 Bacteria 1411
269 Ga0207702_10149052 3300026078 Bacteria 2126
270 Ga0207702_10253036 3300026078 Bacteria 1655
271 Ga0207702_10409764 3300026078 Bacteria 1309
272 Ga0207702_10666248 3300026078 Bacteria 1024
273 Ga0207641_10330916 3300026088 Bacteria 1447
274 Ga0207641_10345345 3300026088 Bacteria 1417
275 Ga0207648_10079333 3300026089 Bacteria 2864
276 Ga0207648_10701215 3300026089 Bacteria 938
277 Ga0207676_11008863 3300026095 Bacteria 820
278 Ga0207674_10094956 3300026116 Bacteria 2968
279 Ga0207674_10465484 3300026116 Bacteria 1222
280 Ga0207674_10597958 3300026116 Bacteria 1065
281 Ga0207675_100118535 3300026118 Bacteria 2503
282 Ga0207675_100279283 3300026118 Bacteria 1622
283 Ga0207683_10070200 3300026121 Bacteria 3094
284 Ga0207683_10077838 3300026121 Bacteria 2938
285 Ga0207683_10247755 3300026121 Bacteria 1625
286 Ga0207683_10328754 3300026121 Bacteria 1401
287 Ga0207698_10083933 3300026142 Bacteria 2580
288 Ga0209589_1000035 3300027357 Bacteria 134091
289 Ga0209489_100079 3300027361 Bacteria 134091
290 Ga0209700_100077 3300027363 Bacteria 134091
291 Ga0268266_10001906 3300028379 Bacteria 23472
292 Ga0268266_10009681 3300028379 Bacteria 8469
293 Ga0268266_10072962 3300028379 Bacteria 2977
294 Ga0268266_10125551 3300028379 Bacteria 2289
295 Ga0268266_10321971 3300028379 Bacteria 1447
296 Ga0268265_10522190 3300028380 Bacteria 1122
297 Ga0268264_10125396 3300028381 Bacteria 2268
298 Ga0307517_10000232 3300028786 Bacteria 94332
299 Ga0307517_10151874 3300028786 Bacteria 1586
300 Ga0307515_10221619 3300028794 Bacteria 1708
301 Ga0307515_10231512 3300028794 Bacteria 1639
302 Ga0307515_10342818 3300028794 Bacteria 1145
303 Ga0307513_10118174 3300031456 Bacteria 2626
304 Ga0307509_10225056 3300031507 Bacteria 1684
305 Ga0307408_100085227 3300031548 Bacteria 2372
306 Ga0307508_10000045 3300031616 Bacteria 142824
307 Ga0307508_10084039 3300031616 Bacteria 2766
308 Ga0307516_10289724 3300031730 Bacteria 1316
309 Ga0307405_10448356 3300031731 Bacteria 1022
310 Ga0307410_10258174 3300031852 Bacteria 1358
311 Ga0307406_10456308 3300031901 Bacteria 1026
312 Ga0307407_10380113 3300031903 Bacteria 1008
313 Ga0307412_10135437 3300031911 Bacteria 1796
314 Ga0307416_100158639 3300032002 Bacteria 2087
315 Ga0307414_10229491 3300032004 Bacteria 1530
316 Ga0307411_10069165 3300032005 Bacteria 2383
317 Ga0307415_100035905 3300032126 Bacteria 3242
318 Ga0307415_100095985 3300032126 Bacteria 2160
319 Ga0307510_10217132 3300033180 Bacteria 1428
320 Ga0315911_1000008 3300033442 Bacteria 381285
321 Ga0373950_0012496 3300034818 Bacteria 1402
322 Ga0373936_0100686 3300035113 Bacteria 1219
323 Ga0373946_0147927 3300035171 Bacteria 1094
324 Ga0373961_0089551 3300035241 Bacteria 981
325 Ga0373931_0164289 3300035691 Bacteria 1303
326 Ga0373935_0372563 3300035692 Bacteria 1021
327 Ga0373927_0014665 3300035695 Bacteria 5182
328 Ga0373927_0143934 3300035695 Bacteria 1560
329 Ga0373927_0154985 3300035695 Bacteria 1500
330 Ga0373927_0160215 3300035695 Bacteria 1474
331 Ga0373925_0091261 3300037068 Bacteria 2329
332 Ga0395900_0553037 3300037418 Bacteria 1095
333 Ga0395905_0080583 3300037471 Bacteria 3051
334 Ga0439465_0031671 3300041413 Bacteria 1686
335 Ga0439465_0106595 3300041413 Bacteria 972
336 Ga0451797_0929115 3300041453 Bacteria 1169
337 Ga0451853_3008818 3300041512 Bacteria 1460
338 Ga0451853_3304909 3300041512 Bacteria 1520
339 Ga0451576_0425075 3300045051 Bacteria 1394
340 Ga0466967_0188171 3300045976 Bacteria 1950
341 Ga0466967_0268655 3300045976 Bacteria 1634
342 Ga0466967_0313670 3300045976 Bacteria 1511
343 Ga0495617_017925 3300046452 Bacteria 2393
344 Ga0495603_0072556 3300046455 Bacteria 2022
345 Ga0495603_0300668 3300046455 Bacteria 922
346 Ga0495629_0293572 3300046459 Bacteria 1114
347 Ga0495638_0116386 3300046460 Bacteria 1583
348 Ga0495639_0123572 3300046475 Bacteria 1235
349 Ga0495584_0120688 3300046491 Bacteria 1327
350 Ga0495584_0240512 3300046491 Bacteria 920
351 Ga0495585_0097511 3300046492 Bacteria 1576
352 Ga0495585_0150484 3300046492 Bacteria 1214
353 Ga0495585_0151135 3300046492 Bacteria 1210
354 Ga0495596_0040826 3300046500 Bacteria 1831
355 Ga0495607_0014122 3300046501 Bacteria 5212
356 Ga0495583_0039573 3300046506 Bacteria 2220
357 Ga0495606_0047193 3300046507 Bacteria 2841
358 Ga0495606_0190082 3300046507 Bacteria 1177
359 Ga0495606_0265665 3300046507 Bacteria 945
360 Ga0495610_0020367 3300046512 Bacteria 3684
361 Ga0495616_0028505 3300046513 Bacteria 2956
362 Ga0495620_0019425 3300046515 Bacteria 3342
363 Ga0495620_0064551 3300046515 Bacteria 1514
364 Ga0495630_0255118 3300046517 Bacteria 1340
365 Ga0495631_0005921 3300046518 Bacteria 6363
366 Ga0495631_0132191 3300046518 Bacteria 1072
367 Ga0495632_0060090 3300046519 Bacteria 1848
368 Ga0495632_0129601 3300046519 Bacteria 1174
369 Ga0495632_0188466 3300046519 Bacteria 943
370 Ga0495637_0021380 3300046520 Bacteria 2968
371 Ga0495643_0042418 3300046522 Bacteria 2479
372 Ga0495644_0048268 3300046523 Bacteria 1599
373 Ga0495648_0058520 3300046524 Bacteria 2304
374 Ga0495648_0190950 3300046524 Bacteria 1033
375 Ga0495642_0056148 3300046528 Bacteria 1626
376 Ga0495652_0288986 3300046529 Bacteria 1197
377 Ga0495654_0114610 3300046530 Bacteria 1226
378 Ga0495609_0078284 3300046538 Bacteria 1447
379 Ga0495609_0099092 3300046538 Bacteria 1263
380 Ga0495597_0053596 3300046542 Bacteria 1773
381 Ga0495633_0058307 3300046558 Bacteria 1812
382 Ga0495668_0045837 3300046616 Bacteria 2430
383 Ga0495668_0119303 3300046616 Bacteria 1442
384 Ga0495634_0187578 3300046642 Bacteria 1292
385 Ga0495611_0042280 3300046648 Bacteria 2034
386 Ga0495611_0057441 3300046648 Bacteria 1763
387 Ga0495611_0172572 3300046648 Bacteria 1011
388 Ga0495625_0034785 3300046660 Bacteria 3716
389 Ga0495659_0038320 3300046664 Bacteria 1701
390 Ga0495659_0041709 3300046664 Bacteria 1640
391 Ga0495661_0023237 3300046665 Bacteria 4024
392 Ga0495661_0167147 3300046665 Bacteria 1176
393 Ga0495588_0072373 3300046674 Bacteria 1793
394 Ga0495588_0160449 3300046674 Bacteria 1189
395 Ga0495669_0024230 3300046684 Bacteria 2643
396 Ga0495669_0080709 3300046684 Bacteria 1492
397 Ga0495669_0175744 3300046684 Bacteria 1020
398 Ga0495669_0241332 3300046684 Bacteria 867
399 Ga0495670_0004607 3300046691 Bacteria 6763
400 Ga0495670_0017082 3300046691 Bacteria 3568
401 Ga0495670_0104383 3300046691 Bacteria 1462
402 Ga0495649_0097677 3300046694 Bacteria 1562
403 Ga0495660_0094465 3300046810 Bacteria 1548
404 Ga0495581_0043611 3300047315 Bacteria 2594
405 Ga0495674_0316557 3300047319 Bacteria 1272
406 Ga0495672_0050509 3300047320 Bacteria 2454
407 Ga0495672_0103322 3300047320 Bacteria 1542
408 Ga0495672_0192937 3300047320 Bacteria 1023
409 Ga0495676_0057827 3300047321 Bacteria 3055
410 Ga0495683_0072840 3300047323 Bacteria 1685
411 Ga0495673_0086491 3300047469 Bacteria 1288
412 Ga0495681_0149600 3300047470 Bacteria 980
413 Ga0495686_0019217 3300047472 Bacteria 4568
414 Ga0495686_0123082 3300047472 Bacteria 1544
415 Ga0495686_0165686 3300047472 Bacteria 1288
416 Ga0495686_0219821 3300047472 Bacteria 1081
417 Ga0496100_0040347 3300048903 Bacteria 2969
418 Ga0496100_0051287 3300048903 Bacteria 2678
419 Ga0496101_0007163 3300048904 Bacteria 7211
420 Ga0496101_0123280 3300048904 Bacteria 1961
421 Ga0496101_0234694 3300048904 Bacteria 1426
422 Ga0496101_0250340 3300048904 Bacteria 1380
423 Ga0496101_0349304 3300048904 Bacteria 1162
424 Ga0496102_0156941 3300048905 Bacteria 2139
425 Ga0496102_0647953 3300048905 Bacteria 979
426 Ga0496103_0089702 3300048906 Bacteria 1939
427 Ga0496103_0429686 3300048906 Bacteria 848
428 Ga0496104_0107561 3300048907 Bacteria 2672
429 Ga0496104_0112795 3300048907 Bacteria 2607
430 Ga0496104_0136018 3300048907 Bacteria 2361
431 Ga0496104_0283684 3300048907 Bacteria 1569
432 Ga0496105_0027959 3300048908 Bacteria 4611
433 Ga0496105_0032414 3300048908 Bacteria 4287
434 Ga0496106_0009686 3300048909 Bacteria 7115
435 Ga0496106_0362270 3300048909 Bacteria 1165
436 Ga0496106_0856537 3300048909 Bacteria 719
437 Ga0496107_0019166 3300048910 Bacteria 4826
438 Ga0496108_0064642 3300048911 Bacteria 3082
439 Ga0496108_0075422 3300048911 Bacteria 2849
440 Ga0496108_0143534 3300048911 Bacteria 2057
441 Ga0496109_0053398 3300048912 Bacteria 3685
442 Ga0496109_0075539 3300048912 Bacteria 3098
443 Ga0496109_0075768 3300048912 Bacteria 3093
444 Ga0496109_0076917 3300048912 Bacteria 3070
445 Ga0496109_0330420 3300048912 Bacteria 1439
446 Ga0496110_0040930 3300048913 Bacteria 4041
447 Ga0496110_0076741 3300048913 Bacteria 2971
448 Ga0496110_0134796 3300048913 Bacteria 2231
449 Ga0496110_0167425 3300048913 Bacteria 1993
450 Ga0496111_0090028 3300048914 Bacteria 2248
451 Ga0496112_0004525 3300048915 Bacteria 11810
452 Ga0496112_0047620 3300048915 Bacteria 4206
453 Ga0496112_0054471 3300048915 Bacteria 3930
454 Ga0496112_0109414 3300048915 Bacteria 2733
455 Ga0496113_0127447 3300048916 Bacteria 1994
456 Ga0496114_0012752 3300048917 Bacteria 6731
457 Ga0496114_0393515 3300048917 Bacteria 1227
458 Ga0496115_0057818 3300048918 Bacteria 3120
459 Ga0496115_0061379 3300048918 Bacteria 3030
460 Ga0496115_0151520 3300048918 Bacteria 1915
461 Ga0496115_0155193 3300048918 Bacteria 1891
462 Ga0496115_0628899 3300048918 Bacteria 851
463 Ga0496116_0001930 3300048919 Bacteria 22336
464 Ga0496116_0081649 3300048919 Bacteria 2003
465 Ga0496117_0041706 3300048920 Bacteria 3358
466 Ga0496117_0215946 3300048920 Bacteria 1071
467 Ga0496117_0237276 3300048920 Bacteria 1003
468 Ga0496118_0045051 3300048921 Bacteria 3448
469 Ga0496118_0075327 3300048921 Bacteria 2407
470 Ga0496119_0051425 3300048922 Bacteria 2532
471 Ga0496121_0000811 3300048924 Bacteria 56962
472 Ga0496121_0104810 3300048924 Bacteria 2172
473 Ga0496122_0012751 3300048925 Bacteria 8318
474 Ga0496123_0009028 3300048926 Bacteria 9040
475 Ga0496123_0220335 3300048926 Bacteria 957
476 Ga0496124_0053958 3300048927 Bacteria 3404
477 Ga0496124_0267102 3300048927 Bacteria 1255
478 Ga0496125_0037679 3300048928 Bacteria 4200
479 Ga0496125_0056419 3300048928 Bacteria 3189
480 Ga0496126_0006001 3300048929 Bacteria 13646
481 Ga0496126_0010569 3300048929 Bacteria 9653
482 Ga0496126_0013876 3300048929 Bacteria 8172
483 Ga0496126_0193654 3300048929 Bacteria 1720
484 Ga0496126_0345525 3300048929 Bacteria 1218
485 Ga0495678_040464 3300049459 Bacteria 1874
486 Ga0501031_0000207 3300049568 Bacteria 33573
487 Ga0501031_0360684 3300049568 Bacteria 940
488 Ga0501032_0000252 3300049569 Bacteria 44619
489 Ga0501032_0037783 3300049569 Bacteria 3290
490 Ga0501032_0041641 3300049569 Bacteria 3118
491 Ga0501033_0000082 3300049570 Bacteria 89837
492 Ga0501033_0051271 3300049570 Bacteria 3058
493 Ga0501034_0000198 3300049571 Bacteria 113672
494 Ga0501034_0181598 3300049571 Bacteria 2069
495 Ga0501034_0300938 3300049571 Bacteria 1540
496 Ga0501036_0001281 3300049572 Bacteria 19291
497 Ga0501036_0018168 3300049572 Bacteria 5889
498 Ga0501036_0072667 3300049572 Bacteria 2908
499 Ga0501037_0000050 3300049573 Bacteria 112824
500 Ga0501037_0032242 3300049573 Bacteria 3869
501 Ga0501037_0090070 3300049573 Bacteria 2219
502 Ga0501037_0475006 3300049573 Bacteria 850
503 Ga0501038_0000538 3300049574 Bacteria 33271
504 Ga0501038_0003724 3300049574 Bacteria 14201
505 Ga0501038_0105659 3300049574 Bacteria 2338
506 Ga0501039_0000123 3300049575 Bacteria 53579
507 Ga0501039_0029415 3300049575 Bacteria 4231
508 Ga0501039_0062811 3300049575 Bacteria 2877
509 Ga0501039_0093860 3300049575 Bacteria 2338
510 Ga0501043_0002344 3300049579 Bacteria 16056
511 Ga0501043_0010624 3300049579 Bacteria 7210
512 Ga0501043_0021303 3300049579 Bacteria 5081
513 Ga0501043_0202629 3300049579 Bacteria 1539
514 Ga0501046_0000434 3300049580 Bacteria 41950
515 Ga0501046_0024647 3300049580 Bacteria 4930
516 Ga0501047_0000131 3300049581 Bacteria 91079
517 Ga0501047_0561088 3300049581 Bacteria 965
518 Ga0501048_0016159 3300049582 Bacteria 5502
519 Ga0501048_0035495 3300049582 Bacteria 3589
520 Ga0501067_0000628 3300049583 Bacteria 18974
521 Ga0501067_0089776 3300049583 Bacteria 1705
522 Ga0501068_0000080 3300049584 Bacteria 39376
523 Ga0501069_0003537 3300049585 Bacteria 8040
524 Ga0501069_0027438 3300049585 Bacteria 3120
525 Ga0501070_0179380 3300049586 Bacteria 1743
526 Ga0501070_0201277 3300049586 Bacteria 1635
527 Ga0501070_0285021 3300049586 Bacteria 1347
528 Ga0501072_0000378 3300049588 Bacteria 31856
529 Ga0501072_0067796 3300049588 Bacteria 2816
530 Ga0501073_0000062 3300049589 Bacteria 66884
531 Ga0501074_0000642 3300049590 Bacteria 21686
532 Ga0501074_0059020 3300049590 Bacteria 2764
533 Ga0501079_0001399 3300049741 Bacteria 17010
534 Ga0501080_0009730 3300049742 Bacteria 8780
535 Ga0501080_0037385 3300049742 Bacteria 4534
536 Ga0501080_0491428 3300049742 Bacteria 1097
537 Ga0501083_0076852 3300049744 Bacteria 2215
538 Ga0501083_0123656 3300049744 Bacteria 1696
539 Ga0501035_0000123 3300049822 Bacteria 93734
540 Ga0501035_0107459 3300049822 Bacteria 2446
541 Ga0501035_0531020 3300049822 Bacteria 965
542 Ga0501044_0000100 3300049823 Bacteria 106729
543 Ga0501044_0006836 3300049823 Bacteria 12570
544 Ga0501044_0010966 3300049823 Bacteria 9837
545 Ga0501044_0047138 3300049823 Bacteria 4458
546 Ga0501044_0431634 3300049823 Bacteria 1226
547 Ga0501044_0740928 3300049823 Bacteria 865
548 Ga0501045_0001526 3300049824 Bacteria 15418
549 Ga0501045_0021342 3300049824 Bacteria 4632
550 Ga0501045_0239506 3300049824 Bacteria 1351
551 nmdc:mga03683_152978_c1 3300050489 Bacteria 1042
552 nmdc:mga03n38_18499_c1 3300050490 Bacteria 2752
553 nmdc:mga03n38_60253_c1 3300050490 Bacteria 1725
554 nmdc:mga03n38_69233_c1 3300050490 Bacteria 1629
555 nmdc:mga00v17_249811_c1 3300050491 Bacteria 1150
556 nmdc:mga00v17_51209_c1 3300050491 Bacteria 2511
557 nmdc:mga0yw44_13126_c1 3300050492 Bacteria 4349
558 nmdc:mga0yw44_329184_c1 3300050492 Bacteria 1027
559 nmdc:mga0yw44_58075_c1 3300050492 Bacteria 2363
560 nmdc:mga0k408_224025_c1 3300050493 Bacteria 1123
561 nmdc:mga06z11_127081_c1 3300050494 Bacteria 1428
562 nmdc:mga06z11_137894_c1 3300050494 Bacteria 1376
563 nmdc:mga06z11_15583_c1 3300050494 Bacteria 3397
564 nmdc:mga06z11_220688_c1 3300050494 Bacteria 1108
565 nmdc:mga07m45_120478_c1 3300050496 Bacteria 1515
566 nmdc:mga07m45_70390_c1 3300050496 Bacteria 1990
567 nmdc:mga07m45_93050_c1 3300050496 Bacteria 1728
568 nmdc:mga05p37_73784_c1 3300050507 Bacteria 4199
569 nmdc:mga0sz30_12707_c1 3300050516 Bacteria 3280
570 nmdc:mga0sz30_60759_c1 3300050516 Bacteria 1166
571 nmdc:mga0sz30_7031_c1 3300050516 Bacteria 4207
572 Ga0495595_0035485 3300053084 Bacteria 2259
573 Ga0495619_0108933 3300053085 Bacteria 1891
574 Ga0500578_0118387 3300053086 Bacteria 1666
575 Ga0500644_0004818 3300053088 Bacteria 3391
576 Ga0500646_0005159 3300053090 Bacteria 3305
577 Ga0500646_0126244 3300053090 Bacteria 827
578 Ga0500647_0014493 3300053091 Bacteria 3585
579 Ga0500583_0054572 3300053092 Bacteria 1866
580 Ga0500651_0005151 3300053093 Bacteria 7440
581 Ga0500566_0000055 3300053094 Bacteria 54414
582 Ga0500566_0003437 3300053094 Bacteria 9442
583 Ga0500566_0015200 3300053094 Bacteria 4517
584 Ga0500566_0200304 3300053094 Bacteria 1009
585 Ga0500641_0019390 3300053096 Bacteria 2571
586 Ga0500641_0132116 3300053096 Bacteria 1077
587 Ga0500641_0137883 3300053096 Bacteria 1053
588 Ga0500650_0000245 3300053098 Bacteria 13194
589 Ga0500556_0000006 3300053104 Bacteria 453982
590 Ga0500562_009606 3300053108 Bacteria 2444
591 Ga0500572_132694 3300053111 Bacteria 809
592 Ga0500595_001016 3300053119 Bacteria 15748
593 Ga0500595_002547 3300053119 Bacteria 8931
594 Ga0500608_000604 3300053122 Bacteria 13230
595 Ga0500614_085080 3300053123 Bacteria 891
596 Ga0500618_003038 3300053125 Bacteria 5962
597 Ga0500642_0000004 3300053130 Bacteria 433122
598 Ga0500652_000294 3300053131 Bacteria 18164
599 Ga0500658_0020563 3300053134 Bacteria 2493
600 Ga0500559_0000362 3300053136 Bacteria 33750
601 Ga0500559_0042776 3300053136 Bacteria 1977
602 Ga0500559_0061731 3300053136 Bacteria 1672
603 Ga0500568_0001522 3300053139 Bacteria 14778
604 Ga0500568_0032815 3300053139 Bacteria 2133
605 Ga0500577_0018218 3300053142 Bacteria 2253
606 Ga0500577_0183040 3300053142 Bacteria 899
607 Ga0500589_066719 3300053147 Bacteria 1636
608 Ga0500589_128285 3300053147 Bacteria 1063
609 Ga0500590_031543 3300053148 Bacteria 2748
610 Ga0500590_068746 3300053148 Bacteria 1764
611 Ga0500603_014373 3300053150 Bacteria 1848
612 Ga0500604_0002744 3300053151 Bacteria 4784
613 Ga0500616_0000244 3300053153 Bacteria 85079
614 Ga0500619_014717 3300053154 Bacteria 2110
615 Ga0500620_136454 3300053155 Bacteria 858
616 Ga0500622_0000953 3300053156 Bacteria 24595
617 Ga0500627_0063748 3300053158 Bacteria 1624
618 Ga0500634_0011130 3300053161 Bacteria 4627
619 Ga0500634_0117487 3300053161 Bacteria 1300
620 Ga0500634_0221223 3300053161 Bacteria 812
621 Ga0500638_000160 3300053162 Bacteria 13163
622 Ga0500638_117266 3300053162 Bacteria 1222
623 Ga0500639_100119 3300053163 Bacteria 1427
624 Ga0500636_0024857 3300053177 Bacteria 3539
625 Ga0500636_0210038 3300053177 Bacteria 1022
626 Ga0500637_0000180 3300053178 Bacteria 23612
627 Ga0500637_0077788 3300053178 Bacteria 1914
628 Ga0500637_0082297 3300053178 Bacteria 1860
629 Ga0500637_0182035 3300053178 Bacteria 1204
630 Ga0500645_014585 3300053730 Bacteria 2501
631 Ga0500645_032629 3300053730 Bacteria 1560
632 Ga0501084_0030635 3300054114 Bacteria 4498
633 Ga0501084_0085559 3300054114 Bacteria 2647
634 Ga0501082_0159888 3300060353 Bacteria 1957
635 2509152168 2508501128 Bacteria 8613869
636 2513659499 2513237096 Bacteria 8722461
637 2513676304 2513237098 Bacteria 9902361
638 2513859394 2513237137 Bacteria 9558895
639 2513921568 2513237145 Bacteria 8979722
640 2517889040 2517572143 Bacteria 9484767
641 2524467238 2524023210 Bacteria 9029266
642 2524537474 2524023228 Bacteria 10118060
643 2603858636 2602042107 Bacteria 6226103
644 2671122636 2667528175 Bacteria 7532676
645 2723841810 2721755755 Bacteria 8322773
646 2793072722 2791355197 Bacteria 8420563
647 2793078316
648 2857526243 2857524615 Bacteria 6615449
649 2876814199 2876808645 Bacteria 8824342
650 2879113325 2879110137 Bacteria 8907982
651 2885377542 2885374607 Bacteria 8927485
652 2885386914 2885383462 Bacteria 9473874
653 2889035316 2889033259 Bacteria 9099371
654 2903758808 2903748898 Bacteria 9972761
655 2903774493 2903768456 Bacteria 9749579
656 2904691017 2904690495 Bacteria 9412302
657 2904708414
658 2906613587
659 2906635820 2906635258 Bacteria 8601019
660 2906668119 2906660503 Bacteria 8595048
661 2908747641 2908739725 Bacteria 8628932
662 2908757075 2908756301 Bacteria 8864324
663 2919073905 2919073203 Bacteria 6531949
664 2922363195 2922361189 Bacteria 7436256
665 2922388500 2922386360 Bacteria 7017218
666 2922434023
667 2935636050 2935630451 Bacteria 8169952
668 2941512646 2941507105 Bacteria 8166816
669 2941520516 2941515067 Bacteria 8166720
670 2941528530 2941523033 Bacteria 8169134
671 3005475262 3005474847 Bacteria 9259049
672 8006936015 8006933436 Bacteria 10410654
673 8006975861 8006973647 Bacteria 10679141
674 8006991094 8006984368 Bacteria 9651211
675 8007000423 8006994254 Bacteria 8309700
676 8019562639 8019555841 Bacteria 9642137
677 8019572718 8019565922 Bacteria 9639779
678 8056682928 8056681323 Bacteria 8472857
679 8056691132 8056689827 Bacteria 6712655
680 JGI25153J46596_10001456
681 Ga0058862_12818071
682 Ga0070658_10018416
683 Ga0070658_10151665
684 Ga0070658_10654042
685 Ga0070676_10072281
686 Ga0070670_100316467
687 Ga0068869_100008039
688 Ga0068869_100071840
689 Ga0070666_10158518
690 Ga0070680_100089363
691 Ga0068868_100038810
692 Ga0068868_100068988
693 Ga0070660_100198523
694 Ga0070661_100050714
695 Ga0070668_100137628
696 Ga0070675_100071429
697 Ga0070671_100201098
698 Ga0070671_100257000
699 Ga0070674_100320439
700 Ga0070673_100212984
701 Ga0070673_100372385
702 Ga0070688_100246769
703 Ga0070667_100313439
704 Ga0070709_10033719
705 Ga0070709_10129067
706 Ga0070714_100047774
707 Ga0070714_100517156
708 Ga0070714_100746510
709 Ga0070713_100025592
710 Ga0070713_100062515
711 Ga0070713_100085323
712 Ga0070710_10015251
713 Ga0070710_10097745
714 Ga0070711_100004422
715 Ga0070711_100009133
716 Ga0070711_100041666
717 Ga0070711_100102936
718 Ga0070700_100157361
719 Ga0070694_100153880
720 Ga0070663_100017376
721 Ga0070663_100051597
722 Ga0070663_100055706
723 Ga0070663_100120081
724 Ga0070663_100154614
725 Ga0070678_100075681
726 Ga0070678_100142051
727 Ga0070678_100256563
728 Ga0070662_100214671
729 Ga0068867_100615759
730 Ga0070698_100171701
731 Ga0070684_100075527
732 Ga0070697_100120225
733 Ga0070686_100317157
734 Ga0070665_100057702
735 Ga0070665_100058941
736 Ga0070665_100130665
737 Ga0070665_100482314
738 Ga0068855_100081140
739 Ga0070664_100164554
740 Ga0070664_100178494
741 Ga0068857_100109784
742 Ga0068856_100101531
743 Ga0068856_100244713
744 Ga0068856_100748900
745 Ga0068852_100086369
746 Ga0068852_100758637
747 Ga0068864_100752922
748 Ga0068864_100824929
749 Ga0068861_100115772
750 Ga0068861_100170064
751 Ga0068851_10070316
752 Ga0068870_10047558
753 Ga0068863_100179528
754 Ga0068863_100183758
755 Ga0068863_100402125
756 Ga0068858_100143132
757 Ga0068858_100342770
758 Ga0068860_100089952
759 Ga0068860_100269458
760 Ga0068860_100450645
761 Ga0068860_100828069
762 Ga0068862_100073767
763 Ga0068862_100148021
764 Ga0068862_100295921
765 Ga0068862_100646656
766 Ga0081455_10000738
767 Ga0081455_10025851
768 Ga0081455_10064054
769 Ga0081455_10148642
770 Ga0081455_10201335
771 Ga0081538_10079023
772 Ga0081540_1005580
773 Ga0081540_1016110
774 Ga0081540_1027392
775 Ga0081540_1047066
776 Ga0081539_10036105
777 Ga0070717_10003277
778 Ga0075365_10031473
779 Ga0075365_10102593
780 Ga0075365_10178477
781 Ga0075365_10363380
782 Ga0075368_10031400
783 Ga0075363_100034166
784 Ga0075363_100051697
785 Ga0070715_10004000
786 Ga0070715_10090479
787 Ga0070716_100005454
788 Ga0070716_100038916
789 Ga0070716_100105608
790 Ga0070712_100016936
791 Ga0070712_100122654
792 Ga0070712_100194709
793 Ga0075362_10019842
794 Ga0075367_10141125
795 Ga0075367_10156995
796 Ga0075369_10138286
797 Ga0075369_10140072
798 Ga0075366_10014376
799 Ga0075366_10044905
800 Ga0097621_100080381
801 Ga0097621_100261072
802 Ga0097621_100287856
803 Ga0075370_10191668
804 Ga0068871_100346586
805 Ga0068871_100468481
806 Ga0068871_100532700
807 Ga0075428_100240637
808 Ga0075434_100188658
809 Ga0068865_100298342
810 Ga0099824_1019648
811 Ga0099822_1008883
812 Ga0105240_10165993
813 Ga0111539_10619133
814 Ga0105245_10169164
815 Ga0105247_10048391
816 Ga0105247_10094599
817 Ga0114129_10267532
818 Ga0105243_10339987
819 Ga0105242_10192860
820 Ga0105242_10200085
821 Ga0105248_10049220
822 Ga0105248_10251367
823 Ga0105248_10274604
824 Ga0105237_10043325
825 Ga0105237_10056083
826 Ga0105237_10122663
827 Ga0105237_10421409
828 Ga0105238_10324955
829 Ga0105238_10634585
830 Ga0105249_10266517
831 Ga0105249_10293029
832 Ga0105249_10578080
833 Ga0105239_10065592
834 Ga0105239_10094165
835 Ga0105239_10206498
836 Ga0105239_10351752
837 Ga0105246_10030455
838 Ga0105246_10106172
839 Ga0105246_10184580
840 Ga0105246_10218762
841 Ga0105246_10345561
842 Ga0157370_10075338
843 Ga0157374_10064925
844 Ga0157374_10087618
845 Ga0157378_10148348
846 Ga0157378_10187121
847 Ga0157378_10279125
848 Ga0163162_10075477
849 Ga0163162_10214567
850 Ga0157372_10276441
851 Ga0157372_10406730
852 Ga0157375_10056026
853 Ga0157375_10180586
854 Ga0157375_10876356
855 Ga0163163_10026240
856 Ga0163163_10081541
857 Ga0163163_10164337
858 Ga0163163_10235371
859 Ga0157380_10294116
860 Ga0157380_10771102
861 Ga0157377_10101279
862 Ga0157379_10110012
863 Ga0157379_10178822
864 Ga0157379_10280289
865 Ga0157376_10258911
866 Ga0157376_10336588
867 Ga0163161_10084369
868 Ga0206350_10137578
869 Ga0209564_1018161
870 Ga0209758_1001013
871 Ga0209758_1003254
872 Ga0207697_10060484
873 Ga0207697_10148414
874 Ga0207656_10032438
875 Ga0207692_10090498
876 Ga0207692_10233475
877 Ga0207642_10138646
878 Ga0207710_10106011
879 Ga0207688_10058674
880 Ga0207647_10005652
881 Ga0207699_10106961
882 Ga0207643_10032073
883 Ga0207643_10183594
884 Ga0207654_10013803
885 Ga0207707_10101414
886 Ga0207693_10116621
887 Ga0207693_10125347
888 Ga0207693_10193305
889 Ga0207663_10008619
890 Ga0207663_10071411
891 Ga0207657_10143659
892 Ga0207657_10199184
893 Ga0207650_10184914
894 Ga0207650_10300888
895 Ga0207687_10072079
896 Ga0207687_10156595
897 Ga0207700_10037943
898 Ga0207700_10275401
899 Ga0207700_10324849
900 Ga0207644_10213018
901 Ga0207644_10228643
902 Ga0207644_10234979
903 Ga0207706_10085043
904 Ga0207706_10390982
905 Ga0207709_10158539
906 Ga0207669_10114095
907 Ga0207669_10216885
908 Ga0207704_10164664
909 Ga0207704_10168613
910 Ga0207704_10283426
911 Ga0207704_10534002
912 Ga0207665_10006607
913 Ga0207665_10050758
914 Ga0207665_10066689
915 Ga0207665_10092055
916 Ga0207665_10244330
917 Ga0207691_10062121
918 Ga0207691_10163430
919 Ga0207711_10235178
920 Ga0207711_10407151
921 Ga0207711_10518542
922 Ga0207689_10168082
923 Ga0207689_10188629
924 Ga0207689_10203857
925 Ga0207661_10297621
926 Ga0207679_10094577
927 Ga0207679_10157750
928 Ga0207651_10145524
929 Ga0207712_10065403
930 Ga0207712_10314144
931 Ga0207668_10081463
932 Ga0207668_10109738
933 Ga0207668_10277611
934 Ga0207668_10320965
935 Ga0207640_10232926
936 Ga0207658_10083135
937 Ga0207677_10030493
938 Ga0207677_10244293
939 Ga0207703_10198817
940 Ga0207703_10364056
941 Ga0207703_10413117
942 Ga0207639_10564587
943 Ga0207678_10004213
944 Ga0207678_10037796
945 Ga0207678_10083926
946 Ga0207678_10102629
947 Ga0207678_10287671
948 Ga0207702_10149052
949 Ga0207702_10253036
950 Ga0207702_10409764
951 Ga0207702_10666248
952 Ga0207641_10330916
953 Ga0207641_10345345
954 Ga0207648_10079333
955 Ga0207648_10701215
956 Ga0207676_11008863
957 Ga0207674_10094956
958 Ga0207674_10465484
959 Ga0207674_10597958
960 Ga0207675_100118535
961 Ga0207675_100279283
962 Ga0207683_10070200
963 Ga0207683_10077838
964 Ga0207683_10247755
965 Ga0207683_10328754
966 Ga0207698_10083933
967 Ga0209589_1000035
968 Ga0209489_100079
969 Ga0209700_100077
970 Ga0268266_10001906
971 Ga0268266_10009681
972 Ga0268266_10072962
973 Ga0268266_10125551
974 Ga0268266_10321971
975 Ga0268265_10522190
976 Ga0268264_10125396
977 Ga0307517_10000232
978 Ga0307517_10151874
979 Ga0307515_10221619
980 Ga0307515_10231512
981 Ga0307515_10342818
982 Ga0307513_10118174
983 Ga0307509_10225056
984 Ga0307408_100085227
985 Ga0307508_10000045
986 Ga0307508_10084039
987 Ga0307516_10289724
988 Ga0307405_10448356
989 Ga0307410_10258174
990 Ga0307406_10456308
991 Ga0307407_10380113
992 Ga0307412_10135437
993 Ga0307416_100158639
994 Ga0307414_10229491
995 Ga0307411_10069165
996 Ga0307415_100035905
997 Ga0307415_100095985
998 Ga0307510_10217132
999 Ga0315911_1000008
1000 Ga0373950_0012496
1001 Ga0373936_0100686
1002 Ga0373946_0147927
1003 Ga0373961_0089551
1004 Ga0373931_0164289
1005 Ga0373935_0372563
1006 Ga0373927_0014665
1007 Ga0373927_0143934
1008 Ga0373927_0154985
1009 Ga0373927_0160215
1010 Ga0373925_0091261
1011 Ga0395900_0553037
1012 Ga0395905_0080583
1013 Ga0439465_0031671
1014 Ga0439465_0106595
1015 Ga0451797_0929115
1016 Ga0451853_3008818
1017 Ga0451853_3304909
1018 Ga0451576_0425075
1019 Ga0466967_0188171
1020 Ga0466967_0268655
1021 Ga0466967_0313670
1022 Ga0495617_017925
1023 Ga0495603_0072556
1024 Ga0495603_0300668
1025 Ga0495629_0293572
1026 Ga0495638_0116386
1027 Ga0495639_0123572
1028 Ga0495584_0120688
1029 Ga0495584_0240512
1030 Ga0495585_0097511
1031 Ga0495585_0150484
1032 Ga0495585_0151135
1033 Ga0495596_0040826
1034 Ga0495607_0014122
1035 Ga0495583_0039573
1036 Ga0495606_0047193
1037 Ga0495606_0190082
1038 Ga0495606_0265665
1039 Ga0495610_0020367
1040 Ga0495616_0028505
1041 Ga0495620_0019425
1042 Ga0495620_0064551
1043 Ga0495630_0255118
1044 Ga0495631_0005921
1045 Ga0495631_0132191
1046 Ga0495632_0060090
1047 Ga0495632_0129601
1048 Ga0495632_0188466
1049 Ga0495637_0021380
1050 Ga0495643_0042418
1051 Ga0495644_0048268
1052 Ga0495648_0058520
1053 Ga0495648_0190950
1054 Ga0495642_0056148
1055 Ga0495652_0288986
1056 Ga0495654_0114610
1057 Ga0495609_0078284
1058 Ga0495609_0099092
1059 Ga0495597_0053596
1060 Ga0495633_0058307
1061 Ga0495668_0045837
1062 Ga0495668_0119303
1063 Ga0495634_0187578
1064 Ga0495611_0042280
1065 Ga0495611_0057441
1066 Ga0495611_0172572
1067 Ga0495625_0034785
1068 Ga0495659_0038320
1069 Ga0495659_0041709
1070 Ga0495661_0023237
1071 Ga0495661_0167147
1072 Ga0495588_0072373
1073 Ga0495588_0160449
1074 Ga0495669_0024230
1075 Ga0495669_0080709
1076 Ga0495669_0175744
1077 Ga0495669_0241332
1078 Ga0495670_0004607
1079 Ga0495670_0017082
1080 Ga0495670_0104383
1081 Ga0495649_0097677
1082 Ga0495660_0094465
1083 Ga0495581_0043611
1084 Ga0495674_0316557
1085 Ga0495672_0050509
1086 Ga0495672_0103322
1087 Ga0495672_0192937
1088 Ga0495676_0057827
1089 Ga0495683_0072840
1090 Ga0495673_0086491
1091 Ga0495681_0149600
1092 Ga0495686_0019217
1093 Ga0495686_0123082
1094 Ga0495686_0165686
1095 Ga0495686_0219821
1096 Ga0496100_0040347
1097 Ga0496100_0051287
1098 Ga0496101_0007163
1099 Ga0496101_0123280
1100 Ga0496101_0234694
1101 Ga0496101_0250340
1102 Ga0496101_0349304
1103 Ga0496102_0156941
1104 Ga0496102_0647953
1105 Ga0496103_0089702
1106 Ga0496103_0429686
1107 Ga0496104_0107561
1108 Ga0496104_0112795
1109 Ga0496104_0136018
1110 Ga0496104_0283684
1111 Ga0496105_0027959
1112 Ga0496105_0032414
1113 Ga0496106_0009686
1114 Ga0496106_0362270
1115 Ga0496106_0856537
1116 Ga0496107_0019166
1117 Ga0496108_0064642
1118 Ga0496108_0075422
1119 Ga0496108_0143534
1120 Ga0496109_0053398
1121 Ga0496109_0075539
1122 Ga0496109_0075768
1123 Ga0496109_0076917
1124 Ga0496109_0330420
1125 Ga0496110_0040930
1126 Ga0496110_0076741
1127 Ga0496110_0134796
1128 Ga0496110_0167425
1129 Ga0496111_0090028
1130 Ga0496112_0004525
1131 Ga0496112_0047620
1132 Ga0496112_0054471
1133 Ga0496112_0109414
1134 Ga0496113_0127447
1135 Ga0496114_0012752
1136 Ga0496114_0393515
1137 Ga0496115_0057818
1138 Ga0496115_0061379
1139 Ga0496115_0151520
1140 Ga0496115_0155193
1141 Ga0496115_0628899
1142 Ga0496116_0001930
1143 Ga0496116_0081649
1144 Ga0496117_0041706
1145 Ga0496117_0215946
1146 Ga0496117_0237276
1147 Ga0496118_0045051
1148 Ga0496118_0075327
1149 Ga0496119_0051425
1150 Ga0496121_0000811
1151 Ga0496121_0104810
1152 Ga0496122_0012751
1153 Ga0496123_0009028
1154 Ga0496123_0220335
1155 Ga0496124_0053958
1156 Ga0496124_0267102
1157 Ga0496125_0037679
1158 Ga0496125_0056419
1159 Ga0496126_0006001
1160 Ga0496126_0010569
1161 Ga0496126_0013876
1162 Ga0496126_0193654
1163 Ga0496126_0345525
1164 Ga0495678_040464
1165 Ga0501031_0000207
1166 Ga0501031_0360684
1167 Ga0501032_0000252
1168 Ga0501032_0037783
1169 Ga0501032_0041641
1170 Ga0501033_0000082
1171 Ga0501033_0051271
1172 Ga0501034_0000198
1173 Ga0501034_0181598
1174 Ga0501034_0300938
1175 Ga0501036_0001281
1176 Ga0501036_0018168
1177 Ga0501036_0072667
1178 Ga0501037_0000050
1179 Ga0501037_0032242
1180 Ga0501037_0090070
1181 Ga0501037_0475006
1182 Ga0501038_0000538
1183 Ga0501038_0003724
1184 Ga0501038_0105659
1185 Ga0501039_0000123
1186 Ga0501039_0029415
1187 Ga0501039_0062811
1188 Ga0501039_0093860
1189 Ga0501043_0002344
1190 Ga0501043_0010624
1191 Ga0501043_0021303
1192 Ga0501043_0202629
1193 Ga0501046_0000434
1194 Ga0501046_0024647
1195 Ga0501047_0000131
1196 Ga0501047_0561088
1197 Ga0501048_0016159
1198 Ga0501048_0035495
1199 Ga0501067_0000628
1200 Ga0501067_0089776
1201 Ga0501068_0000080
1202 Ga0501069_0003537
1203 Ga0501069_0027438
1204 Ga0501070_0179380
1205 Ga0501070_0201277
1206 Ga0501070_0285021
1207 Ga0501072_0000378
1208 Ga0501072_0067796
1209 Ga0501073_0000062
1210 Ga0501074_0000642
1211 Ga0501074_0059020
1212 Ga0501079_0001399
1213 Ga0501080_0009730
1214 Ga0501080_0037385
1215 Ga0501080_0491428
1216 Ga0501083_0076852
1217 Ga0501083_0123656
1218 Ga0501035_0000123
1219 Ga0501035_0107459
1220 Ga0501035_0531020
1221 Ga0501044_0000100
1222 Ga0501044_0006836
1223 Ga0501044_0010966
1224 Ga0501044_0047138
1225 Ga0501044_0431634
1226 Ga0501044_0740928
1227 Ga0501045_0001526
1228 Ga0501045_0021342
1229 Ga0501045_0239506
1230 nmdc:mga03683_152978_c1
1231 nmdc:mga03n38_18499_c1
1232 nmdc:mga03n38_60253_c1
1233 nmdc:mga03n38_69233_c1
1234 nmdc:mga00v17_249811_c1
1235 nmdc:mga00v17_51209_c1
1236 nmdc:mga0yw44_13126_c1
1237 nmdc:mga0yw44_329184_c1
1238 nmdc:mga0yw44_58075_c1
1239 nmdc:mga0k408_224025_c1
1240 nmdc:mga06z11_127081_c1
1241 nmdc:mga06z11_137894_c1
1242 nmdc:mga06z11_15583_c1
1243 nmdc:mga06z11_220688_c1
1244 nmdc:mga07m45_120478_c1
1245 nmdc:mga07m45_70390_c1
1246 nmdc:mga07m45_93050_c1
1247 nmdc:mga05p37_73784_c1
1248 nmdc:mga0sz30_12707_c1
1249 nmdc:mga0sz30_60759_c1
1250 nmdc:mga0sz30_7031_c1
1251 Ga0495595_0035485
1252 Ga0495619_0108933
1253 Ga0500578_0118387
1254 Ga0500644_0004818
1255 Ga0500646_0005159
1256 Ga0500646_0126244
1257 Ga0500647_0014493
1258 Ga0500583_0054572
1259 Ga0500651_0005151
1260 Ga0500566_0000055
1261 Ga0500566_0003437
1262 Ga0500566_0015200
1263 Ga0500566_0200304
1264 Ga0500641_0019390
1265 Ga0500641_0132116
1266 Ga0500641_0137883
1267 Ga0500650_0000245
1268 Ga0500556_0000006
1269 Ga0500562_009606
1270 Ga0500572_132694
1271 Ga0500595_001016
1272 Ga0500595_002547
1273 Ga0500608_000604
1274 Ga0500614_085080
1275 Ga0500618_003038
1276 Ga0500642_0000004
1277 Ga0500652_000294
1278 Ga0500658_0020563
1279 Ga0500559_0000362
1280 Ga0500559_0042776
1281 Ga0500559_0061731
1282 Ga0500568_0001522
1283 Ga0500568_0032815
1284 Ga0500577_0018218
1285 Ga0500577_0183040
1286 Ga0500589_066719
1287 Ga0500589_128285
1288 Ga0500590_031543
1289 Ga0500590_068746
1290 Ga0500603_014373
1291 Ga0500604_0002744
1292 Ga0500616_0000244
1293 Ga0500619_014717
1294 Ga0500620_136454
1295 Ga0500622_0000953
1296 Ga0500627_0063748
1297 Ga0500634_0011130
1298 Ga0500634_0117487
1299 Ga0500634_0221223
1300 Ga0500638_000160
1301 Ga0500638_117266
1302 Ga0500639_100119
1303 Ga0500636_0024857
1304 Ga0500636_0210038
1305 Ga0500637_0000180
1306 Ga0500637_0077788
1307 Ga0500637_0082297
1308 Ga0500637_0182035
1309 Ga0500645_014585
1310 Ga0500645_032629
1311 Ga0501084_0030635
1312 Ga0501084_0085559
1313 Ga0501082_0159888
1314 2509152168
1315 2513659499
1316 2513676304
1317 2513859394
1318 2513921568
1319 2517889040
1320 2524467238
1321 2524537474
1322 2603858636
1323 2671122636
1324 2723841810
1325 2793072722
1326 2793078316
1327 2857526243
1328 2876814199
1329 2879113325
1330 2885377542
1331 2885386914
1332 2889035316
1333 2903758808
1334 2903774493
1335 2904691017
1336 2904708414
1337 2906613587
1338 2906635820
1339 2906668119
1340 2908747641
1341 2908757075
1342 2919073905
1343 2922363195
1344 2922388500
1345 2922434023
1346 2935636050
1347 2941512646
1348 2941520516
1349 2941528530
1350 3005475262
1351 8006936015
1352 8006975861
1353 8006991094
1354 8007000423
1355 8019562639
1356 8019572718
1357 8056682928
1358 8056691132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06764

DUF1223

Protein of unknown function (DUF1223)

68

272

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2axo-assembly1.cif.gz_A-2 x-ray crystal structure of protein agr_c_4864 from agrobacterium tumefaciens. northeast structural genomics consortium target atr35. 0.8954 64 287
2axo-assembly1.cif.gz_A-2 x-ray crystal structure of protein agr_c_4864 from agrobacterium tumefaciens. northeast structural genomics consortium target atr35. 0.8389 64 287
2imd-assembly1.cif.gz_A structure of semet 2-hydroxychromene-2-carboxylate isomerase (hcca isomerase) 0.736 68 104
4i8b-assembly1.cif.gz_B crystal structure of thioredoxin from schistosoma japonicum 0.6973 65 163
7rgv-assembly1.cif.gz_A structure of caulobacter crescentus suppressor of copper sensitivity protein c 0.6917 62 164
ID Description Score Start End Superfamily
4i8bB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6973 65 163 3.40.30.10
af_I1LUV6_45_256_2.60.40.640 Mainly Beta;Sandwich;Immunoglobulin-like; 0.692 69 290 2.60.40.640
af_I1LUV6_45_256_2.60.40.640 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6802 69 290 2.60.40.640
6i1cB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6752 66 164 3.40.30.10
af_Q9SEU7_68_173_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6709 67 167 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A537MAF0-F1-model_v4 DUF1223 domain-containing protein 0.9425 58 291
AF-A0A537MAF0-F1-model_v4 DUF1223 domain-containing protein 0.9346 58 291
AF-A0A523FHU3-F1-model_v4 DUF1223 domain-containing protein 0.9247 206 291
AF-A0A4R3M2A2-F1-model_v4 DUF1223 domain-containing protein 0.9214 72 291
AF-A0A7T9INI7-F1-model_v4 deleted 0.9207 68 289

Map