F474757
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 680 | 278 | 680 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300005444|Ga0070694_100541154|Ga0070694_1005411541 |
| Length | 246 |
| Sequence | MPDSGATRLGVLGGTFDPVHNGHVEVAIAARRVLGLARVVLLPSRIPPHRAAQPVATAFHRFAMTAMAVNGVDGLEASDLELSAPGTSYTSSTLERLHASGLQPAQIFFITGADAFAEIATWHRYPEVLDMAHFVVVSRPGHEASALPALLPSLASRMHTRPERAERGDGKPAVFLIDWKTPVVSSTEVRRRIRNGDALTGLAPPAVEQHIIQHRLYLDGSTPQGVGAAADHLHGKDSDATNTQRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 150 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 151 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 152 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 153 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 154 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 160 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 171 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 172 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 173 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 175 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 176 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 177 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 178 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 179 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 180 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 181 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 182 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 183 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 184 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 185 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 186 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 187 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 188 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 189 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 190 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 191 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 218 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 219 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 222 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 225 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 226 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 254 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 255 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 256 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 257 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 258 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 259 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 271 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 272 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 274 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 275 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 276 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 277 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.82 |
| Nodule | 0 |
| Rhizoplane | 3.53 |
| Rhizosphere | 92.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_822942 | 2162886012 | Bacteria | 1121 |
| 2 | Ga0065704_10076773 | 3300005289 | Bacteria | 4982 |
| 3 | Ga0065704_10156099 | 3300005289 | Bacteria | 1390 |
| 4 | Ga0065712_10068599 | 3300005290 | Bacteria | 9708 |
| 5 | Ga0065712_10072381 | 3300005290 | Bacteria | 4776 |
| 6 | Ga0065715_10007113 | 3300005293 | Bacteria | 4300 |
| 7 | Ga0065715_10021686 | 3300005293 | Bacteria | 1764 |
| 8 | Ga0065715_10170128 | 3300005293 | Unclassified | 1553 |
| 9 | Ga0065715_10277478 | 3300005293 | Bacteria | 1093 |
| 10 | Ga0065707_10000834 | 3300005295 | Bacteria | 15115 |
| 11 | Ga0065707_10009659 | 3300005295 | Bacteria | 2256 |
| 12 | Ga0065707_10138247 | 3300005295 | Bacteria | 1802 |
| 13 | Ga0070676_10031080 | 3300005328 | Bacteria | 3049 |
| 14 | Ga0070676_10040201 | 3300005328 | Bacteria | 2707 |
| 15 | Ga0070683_100000326 | 3300005329 | Bacteria | 32914 |
| 16 | Ga0070683_100002445 | 3300005329 | Bacteria | 14778 |
| 17 | Ga0070683_100061153 | 3300005329 | Unclassified | 3502 |
| 18 | Ga0070690_100085737 | 3300005330 | Bacteria | 2066 |
| 19 | Ga0070670_100008907 | 3300005331 | Bacteria | 8568 |
| 20 | Ga0070670_100025013 | 3300005331 | Bacteria | 5137 |
| 21 | Ga0070670_100048171 | 3300005331 | Bacteria | 3667 |
| 22 | Ga0070670_100106717 | 3300005331 | Bacteria | 2413 |
| 23 | Ga0070670_100471488 | 3300005331 | Unclassified | 1114 |
| 24 | Ga0070670_100480184 | 3300005331 | Bacteria | 1104 |
| 25 | Ga0070677_10055162 | 3300005333 | Bacteria | 1621 |
| 26 | Ga0070682_100195394 | 3300005337 | Bacteria | 1423 |
| 27 | Ga0070682_100497450 | 3300005337 | Bacteria | 944 |
| 28 | Ga0068868_100123488 | 3300005338 | Bacteria | 2113 |
| 29 | Ga0068868_100392113 | 3300005338 | Unclassified | 1197 |
| 30 | Ga0070660_100115994 | 3300005339 | Bacteria | 2135 |
| 31 | Ga0070689_100148828 | 3300005340 | Unclassified | 1887 |
| 32 | Ga0070691_10027912 | 3300005341 | Bacteria | 2634 |
| 33 | Ga0070691_10092043 | 3300005341 | Bacteria | 1496 |
| 34 | Ga0070687_100101365 | 3300005343 | Unclassified | 1612 |
| 35 | Ga0070661_100022313 | 3300005344 | Bacteria | 4531 |
| 36 | Ga0070661_100176475 | 3300005344 | Bacteria | 1624 |
| 37 | Ga0070692_10137478 | 3300005345 | Bacteria | 1380 |
| 38 | Ga0070669_100010678 | 3300005353 | Bacteria | 6518 |
| 39 | Ga0070669_100236358 | 3300005353 | Bacteria | 1450 |
| 40 | Ga0070675_100060238 | 3300005354 | Bacteria | 3134 |
| 41 | Ga0070675_100090971 | 3300005354 | Unclassified | 2556 |
| 42 | Ga0070675_100413278 | 3300005354 | Bacteria | 1205 |
| 43 | Ga0070675_100647047 | 3300005354 | Bacteria | 961 |
| 44 | Ga0070675_100748951 | 3300005354 | Bacteria | 891 |
| 45 | Ga0070671_100006550 | 3300005355 | Bacteria | 9310 |
| 46 | Ga0070671_100008320 | 3300005355 | Bacteria | 8305 |
| 47 | Ga0070671_100485558 | 3300005355 | Unclassified | 1062 |
| 48 | Ga0070674_100038383 | 3300005356 | Bacteria | 3227 |
| 49 | Ga0070674_100076131 | 3300005356 | Bacteria | 2385 |
| 50 | Ga0070674_100151238 | 3300005356 | Bacteria | 1752 |
| 51 | Ga0070674_100252522 | 3300005356 | Bacteria | 1386 |
| 52 | Ga0070673_100080865 | 3300005364 | Bacteria | 2634 |
| 53 | Ga0070673_100188476 | 3300005364 | Bacteria | 1770 |
| 54 | Ga0070673_100880603 | 3300005364 | Unclassified | 830 |
| 55 | Ga0070688_100018946 | 3300005365 | Bacteria | 3981 |
| 56 | Ga0070688_100021315 | 3300005365 | Unclassified | 3784 |
| 57 | Ga0070659_100443326 | 3300005366 | Bacteria | 1100 |
| 58 | Ga0070667_100071791 | 3300005367 | Bacteria | 2949 |
| 59 | Ga0070667_100113453 | 3300005367 | Bacteria | 2352 |
| 60 | Ga0070667_100504587 | 3300005367 | Bacteria | 1109 |
| 61 | Ga0070703_10038597 | 3300005406 | Bacteria | 1477 |
| 62 | Ga0070713_100020203 | 3300005436 | Bacteria | 5101 |
| 63 | Ga0070701_10018755 | 3300005438 | Bacteria | 3256 |
| 64 | Ga0070705_100000353 | 3300005440 | Bacteria | 27139 |
| 65 | Ga0070705_100100434 | 3300005440 | Bacteria | 1826 |
| 66 | Ga0070705_100373719 | 3300005440 | Bacteria | 1047 |
| 67 | Ga0070700_100052052 | 3300005441 | Unclassified | 2552 |
| 68 | Ga0070694_100001728 | 3300005444 | Bacteria | 12875 |
| 69 | Ga0070694_100013000 | 3300005444 | Bacteria | 5192 |
| 70 | Ga0070694_100032991 | 3300005444 | Bacteria | 3403 |
| 71 | Ga0070694_100216176 | 3300005444 | Bacteria | 1436 |
| 72 | Ga0070694_100541154 | 3300005444 | Bacteria | 931 |
| 73 | Ga0070694_100588851 | 3300005444 | Unclassified | 895 |
| 74 | Ga0070708_100086957 | 3300005445 | Bacteria | 2840 |
| 75 | Ga0070708_100114527 | 3300005445 | Bacteria | 2481 |
| 76 | Ga0070663_100009370 | 3300005455 | Bacteria | 6061 |
| 77 | Ga0070678_100129312 | 3300005456 | Bacteria | 2004 |
| 78 | Ga0070678_100652120 | 3300005456 | Bacteria | 944 |
| 79 | Ga0070662_100050063 | 3300005457 | Unclassified | 3013 |
| 80 | Ga0070662_100102819 | 3300005457 | Bacteria | 2165 |
| 81 | Ga0070662_100151431 | 3300005457 | Bacteria | 1806 |
| 82 | Ga0070662_100232970 | 3300005457 | Unclassified | 1474 |
| 83 | Ga0068867_100484826 | 3300005459 | Bacteria | 1060 |
| 84 | Ga0070685_10358124 | 3300005466 | Bacteria | 999 |
| 85 | Ga0070706_100089513 | 3300005467 | Bacteria | 2854 |
| 86 | Ga0070706_100332109 | 3300005467 | Bacteria | 1418 |
| 87 | Ga0070707_100128713 | 3300005468 | Bacteria | 2461 |
| 88 | Ga0070707_100210554 | 3300005468 | Bacteria | 1895 |
| 89 | Ga0070698_100004723 | 3300005471 | Bacteria | 14961 |
| 90 | Ga0070698_100587613 | 3300005471 | Bacteria | 1054 |
| 91 | Ga0070699_100007386 | 3300005518 | Bacteria | 9569 |
| 92 | Ga0070699_100009834 | 3300005518 | Bacteria | 8279 |
| 93 | Ga0070699_100193343 | 3300005518 | Unclassified | 1808 |
| 94 | Ga0070684_100000168 | 3300005535 | Bacteria | 45138 |
| 95 | Ga0070684_100129898 | 3300005535 | Bacteria | 2272 |
| 96 | Ga0070684_100185501 | 3300005535 | Unclassified | 1892 |
| 97 | Ga0070684_100231299 | 3300005535 | Bacteria | 1688 |
| 98 | Ga0070697_100349017 | 3300005536 | Unclassified | 1278 |
| 99 | Ga0070672_100064039 | 3300005543 | Bacteria | 2904 |
| 100 | Ga0070672_100072649 | 3300005543 | Bacteria | 2739 |
| 101 | Ga0070672_100116107 | 3300005543 | Bacteria | 2186 |
| 102 | Ga0070672_100317229 | 3300005543 | Bacteria | 1324 |
| 103 | Ga0070695_100000542 | 3300005545 | Bacteria | 19943 |
| 104 | Ga0070695_100054187 | 3300005545 | Bacteria | 2580 |
| 105 | Ga0070695_100067396 | 3300005545 | Bacteria | 2334 |
| 106 | Ga0070696_100052386 | 3300005546 | Bacteria | 2839 |
| 107 | Ga0070696_100208946 | 3300005546 | Bacteria | 1460 |
| 108 | Ga0070665_100136824 | 3300005548 | Bacteria | 2453 |
| 109 | Ga0070704_100007989 | 3300005549 | Bacteria | 6318 |
| 110 | Ga0070704_100079079 | 3300005549 | Bacteria | 2414 |
| 111 | Ga0070704_100167341 | 3300005549 | Bacteria | 1744 |
| 112 | Ga0068855_100058478 | 3300005563 | Bacteria | 4515 |
| 113 | Ga0070664_100001248 | 3300005564 | Bacteria | 20353 |
| 114 | Ga0070664_100032472 | 3300005564 | Unclassified | 4367 |
| 115 | Ga0070664_100186765 | 3300005564 | Bacteria | 1845 |
| 116 | Ga0070664_100209267 | 3300005564 | Bacteria | 1743 |
| 117 | Ga0070664_100221792 | 3300005564 | Bacteria | 1692 |
| 118 | Ga0070664_100314227 | 3300005564 | Unclassified | 1418 |
| 119 | Ga0070664_100363153 | 3300005564 | Bacteria | 1319 |
| 120 | Ga0070664_100429583 | 3300005564 | Bacteria | 1211 |
| 121 | Ga0068857_100022078 | 3300005577 | Bacteria | 5599 |
| 122 | Ga0068857_100537833 | 3300005577 | Bacteria | 1100 |
| 123 | Ga0070702_100027661 | 3300005615 | Bacteria | 3063 |
| 124 | Ga0070702_100105367 | 3300005615 | Bacteria | 1738 |
| 125 | Ga0068852_100025408 | 3300005616 | Bacteria | 4799 |
| 126 | Ga0068852_100091605 | 3300005616 | Bacteria | 2721 |
| 127 | Ga0068852_100098602 | 3300005616 | Bacteria | 2632 |
| 128 | Ga0068859_100017025 | 3300005617 | Bacteria | 7297 |
| 129 | Ga0068859_100066152 | 3300005617 | Bacteria | 3649 |
| 130 | Ga0068859_100337967 | 3300005617 | Unclassified | 1600 |
| 131 | Ga0068859_101252391 | 3300005617 | Unclassified | 817 |
| 132 | Ga0068864_100065348 | 3300005618 | Bacteria | 3156 |
| 133 | Ga0068864_100077251 | 3300005618 | Bacteria | 2911 |
| 134 | Ga0068861_100170577 | 3300005719 | Bacteria | 1803 |
| 135 | Ga0068870_10058630 | 3300005840 | Bacteria | 2061 |
| 136 | Ga0068863_100064191 | 3300005841 | Bacteria | 3473 |
| 137 | Ga0068863_100350914 | 3300005841 | Bacteria | 1436 |
| 138 | Ga0068858_100102307 | 3300005842 | Bacteria | 2672 |
| 139 | Ga0068858_100160693 | 3300005842 | Bacteria | 2115 |
| 140 | Ga0068858_100214375 | 3300005842 | Bacteria | 1822 |
| 141 | Ga0068860_100005299 | 3300005843 | Bacteria | 13094 |
| 142 | Ga0068860_100210438 | 3300005843 | Unclassified | 1886 |
| 143 | Ga0068860_100267790 | 3300005843 | Bacteria | 1667 |
| 144 | Ga0068862_100008919 | 3300005844 | Bacteria | 8304 |
| 145 | Ga0068862_100153263 | 3300005844 | Unclassified | 2052 |
| 146 | Ga0068862_100532011 | 3300005844 | Bacteria | 1120 |
| 147 | Ga0068862_100576982 | 3300005844 | Bacteria | 1077 |
| 148 | Ga0075368_10025260 | 3300006042 | Bacteria | 2279 |
| 149 | Ga0075368_10035739 | 3300006042 | Bacteria | 1940 |
| 150 | Ga0075363_100011958 | 3300006048 | Bacteria | 4171 |
| 151 | Ga0075364_10004582 | 3300006051 | Bacteria | 7960 |
| 152 | Ga0075364_10005737 | 3300006051 | Bacteria | 7239 |
| 153 | Ga0075362_10000489 | 3300006177 | Bacteria | 11538 |
| 154 | Ga0075367_10004668 | 3300006178 | Bacteria | 6721 |
| 155 | Ga0075366_10012749 | 3300006195 | Bacteria | 4775 |
| 156 | Ga0075366_10126822 | 3300006195 | Bacteria | 1539 |
| 157 | Ga0075366_10316982 | 3300006195 | Bacteria | 955 |
| 158 | Ga0097621_100098805 | 3300006237 | Bacteria | 2453 |
| 159 | Ga0097621_100410810 | 3300006237 | Bacteria | 1213 |
| 160 | Ga0068871_100319630 | 3300006358 | Unclassified | 1366 |
| 161 | Ga0075428_100000030 | 3300006844 | Bacteria | 119551 |
| 162 | Ga0075428_100011002 | 3300006844 | Bacteria | 10062 |
| 163 | Ga0075428_100017106 | 3300006844 | Bacteria | 8010 |
| 164 | Ga0075428_100038342 | 3300006844 | Bacteria | 5273 |
| 165 | Ga0075428_100041279 | 3300006844 | Bacteria | 5074 |
| 166 | Ga0075428_100075795 | 3300006844 | Bacteria | 3672 |
| 167 | Ga0075428_100112653 | 3300006844 | Bacteria | 2963 |
| 168 | Ga0075428_100134313 | 3300006844 | Bacteria | 2690 |
| 169 | Ga0075428_100331368 | 3300006844 | Bacteria | 1635 |
| 170 | Ga0075428_100357830 | 3300006844 | Bacteria | 1566 |
| 171 | Ga0075428_100438939 | 3300006844 | Bacteria | 1398 |
| 172 | Ga0075430_100008531 | 3300006846 | Bacteria | 8655 |
| 173 | Ga0075430_100012219 | 3300006846 | Bacteria | 7311 |
| 174 | Ga0075430_100231481 | 3300006846 | Bacteria | 1532 |
| 175 | Ga0075431_100004362 | 3300006847 | Bacteria | 13882 |
| 176 | Ga0075431_100008733 | 3300006847 | Bacteria | 10151 |
| 177 | Ga0075431_100019271 | 3300006847 | Bacteria | 6954 |
| 178 | Ga0075431_100070379 | 3300006847 | Bacteria | 3610 |
| 179 | Ga0075431_100231316 | 3300006847 | Bacteria | 1883 |
| 180 | Ga0075431_100272389 | 3300006847 | Bacteria | 1715 |
| 181 | Ga0075433_10005701 | 3300006852 | Bacteria | 9791 |
| 182 | Ga0075433_10063822 | 3300006852 | Bacteria | 3228 |
| 183 | Ga0075433_10093714 | 3300006852 | Bacteria | 2657 |
| 184 | Ga0075433_10339416 | 3300006852 | Bacteria | 1328 |
| 185 | Ga0075434_100002362 | 3300006871 | Bacteria | 16533 |
| 186 | Ga0075434_100071599 | 3300006871 | Bacteria | 3458 |
| 187 | Ga0075434_100104126 | 3300006871 | Bacteria | 2847 |
| 188 | Ga0075434_100137424 | 3300006871 | Bacteria | 2463 |
| 189 | Ga0075434_100379257 | 3300006871 | Bacteria | 1435 |
| 190 | Ga0075429_100004407 | 3300006880 | Bacteria | 12098 |
| 191 | Ga0075429_100032450 | 3300006880 | Bacteria | 4539 |
| 192 | Ga0075429_100085831 | 3300006880 | Unclassified | 2743 |
| 193 | Ga0075429_100118292 | 3300006880 | Bacteria | 2316 |
| 194 | Ga0075429_100424987 | 3300006880 | Bacteria | 1164 |
| 195 | Ga0075429_100561832 | 3300006880 | Bacteria | 1000 |
| 196 | Ga0097620_100017024 | 3300006931 | Bacteria | 7297 |
| 197 | Ga0097620_100066152 | 3300006931 | Bacteria | 3649 |
| 198 | Ga0097620_100337991 | 3300006931 | Unclassified | 1600 |
| 199 | Ga0097620_101252399 | 3300006931 | Unclassified | 817 |
| 200 | Ga0075435_100212915 | 3300007076 | Bacteria | 1640 |
| 201 | Ga0105240_10213803 | 3300009093 | Bacteria | 2251 |
| 202 | Ga0105240_10552325 | 3300009093 | Bacteria | 1274 |
| 203 | Ga0111539_10000015 | 3300009094 | Bacteria | 296576 |
| 204 | Ga0111539_10023936 | 3300009094 | Bacteria | 7503 |
| 205 | Ga0111539_10071906 | 3300009094 | Archaea | 4081 |
| 206 | Ga0111539_10099845 | 3300009094 | Bacteria | 3408 |
| 207 | Ga0111539_10305245 | 3300009094 | Bacteria | 1852 |
| 208 | Ga0111539_10481753 | 3300009094 | Bacteria | 1445 |
| 209 | Ga0111539_10524896 | 3300009094 | Bacteria | 1379 |
| 210 | Ga0111539_10669522 | 3300009094 | Bacteria | 1208 |
| 211 | Ga0111539_11178431 | 3300009094 | Unclassified | 890 |
| 212 | Ga0105247_10185044 | 3300009101 | Bacteria | 1392 |
| 213 | Ga0114129_10000288 | 3300009147 | Bacteria | 58119 |
| 214 | Ga0114129_10001659 | 3300009147 | Bacteria | 30298 |
| 215 | Ga0114129_10003888 | 3300009147 | Bacteria | 21072 |
| 216 | Ga0114129_10007226 | 3300009147 | Bacteria | 15811 |
| 217 | Ga0114129_10011087 | 3300009147 | Bacteria | 12841 |
| 218 | Ga0114129_10016501 | 3300009147 | Bacteria | 10516 |
| 219 | Ga0114129_10041543 | 3300009147 | Bacteria | 6479 |
| 220 | Ga0114129_10042294 | 3300009147 | Bacteria | 6416 |
| 221 | Ga0114129_10088636 | 3300009147 | Bacteria | 4289 |
| 222 | Ga0114129_10098200 | 3300009147 | Bacteria | 4053 |
| 223 | Ga0114129_10136172 | 3300009147 | Bacteria | 3370 |
| 224 | Ga0114129_10155324 | 3300009147 | Bacteria | 3129 |
| 225 | Ga0114129_10175158 | 3300009147 | Bacteria | 2922 |
| 226 | Ga0114129_10624963 | 3300009147 | Bacteria | 1393 |
| 227 | Ga0105243_10058182 | 3300009148 | Bacteria | 3080 |
| 228 | Ga0105243_10060040 | 3300009148 | Bacteria | 3037 |
| 229 | Ga0105241_10054310 | 3300009174 | Bacteria | 3066 |
| 230 | Ga0105248_10116361 | 3300009177 | Bacteria | 3015 |
| 231 | Ga0105248_10162416 | 3300009177 | Bacteria | 2519 |
| 232 | Ga0105248_10243459 | 3300009177 | Bacteria | 2024 |
| 233 | Ga0105248_10455003 | 3300009177 | Bacteria | 1443 |
| 234 | Ga0105249_10083147 | 3300009553 | Bacteria | 2979 |
| 235 | Ga0105249_10113728 | 3300009553 | Bacteria | 2562 |
| 236 | Ga0105246_10265644 | 3300011119 | Unclassified | 1369 |
| 237 | Ga0157369_10084492 | 3300013105 | Bacteria | 3393 |
| 238 | Ga0157374_10059231 | 3300013296 | Bacteria | 3580 |
| 239 | Ga0157374_10203209 | 3300013296 | Bacteria | 1940 |
| 240 | Ga0157374_10227404 | 3300013296 | Bacteria | 1832 |
| 241 | Ga0163162_10123467 | 3300013306 | Unclassified | 2695 |
| 242 | Ga0163162_10571582 | 3300013306 | Bacteria | 1258 |
| 243 | Ga0163162_10740975 | 3300013306 | Bacteria | 1102 |
| 244 | Ga0157372_10151914 | 3300013307 | Bacteria | 2673 |
| 245 | Ga0157375_10215124 | 3300013308 | Bacteria | 2079 |
| 246 | Ga0157375_10217294 | 3300013308 | Bacteria | 2070 |
| 247 | Ga0157375_10327160 | 3300013308 | Bacteria | 1698 |
| 248 | Ga0157375_10362523 | 3300013308 | Unclassified | 1615 |
| 249 | Ga0157375_11220528 | 3300013308 | Unclassified | 882 |
| 250 | Ga0163163_10028350 | 3300014325 | Bacteria | 5375 |
| 251 | Ga0163163_10039080 | 3300014325 | Bacteria | 4629 |
| 252 | Ga0163163_10427095 | 3300014325 | Bacteria | 1384 |
| 253 | Ga0157380_10045868 | 3300014326 | Bacteria | 3432 |
| 254 | Ga0157380_10178911 | 3300014326 | Bacteria | 1861 |
| 255 | Ga0157380_11426910 | 3300014326 | Bacteria | 743 |
| 256 | Ga0157377_10113955 | 3300014745 | Bacteria | 1629 |
| 257 | Ga0157377_10185007 | 3300014745 | Bacteria | 1313 |
| 258 | Ga0157379_10322929 | 3300014968 | Bacteria | 1410 |
| 259 | Ga0157376_10060414 | 3300014969 | Bacteria | 3183 |
| 260 | Ga0163161_10011304 | 3300017792 | Bacteria | 6186 |
| 261 | Ga0163161_10095596 | 3300017792 | Bacteria | 2204 |
| 262 | Ga0213876_10178340 | 3300021384 | Bacteria | 1130 |
| 263 | Ga0207697_10025784 | 3300025315 | Bacteria | 2404 |
| 264 | Ga0207697_10046210 | 3300025315 | Bacteria | 1793 |
| 265 | Ga0207682_10024190 | 3300025893 | Bacteria | 2403 |
| 266 | Ga0207682_10085036 | 3300025893 | Bacteria | 1362 |
| 267 | Ga0207642_10014612 | 3300025899 | Bacteria | 2902 |
| 268 | Ga0207680_10131306 | 3300025903 | Bacteria | 1651 |
| 269 | Ga0207645_10022218 | 3300025907 | Unclassified | 4129 |
| 270 | Ga0207645_10047629 | 3300025907 | Bacteria | 2737 |
| 271 | Ga0207643_10037151 | 3300025908 | Unclassified | 2732 |
| 272 | Ga0207684_10206892 | 3300025910 | Bacteria | 1693 |
| 273 | Ga0207695_10451286 | 3300025913 | Bacteria | 1169 |
| 274 | Ga0207662_10047418 | 3300025918 | Bacteria | 2544 |
| 275 | Ga0207649_10135714 | 3300025920 | Bacteria | 1677 |
| 276 | Ga0207649_10154268 | 3300025920 | Bacteria | 1585 |
| 277 | Ga0207646_10111714 | 3300025922 | Bacteria | 2453 |
| 278 | Ga0207646_10544359 | 3300025922 | Bacteria | 1044 |
| 279 | Ga0207646_10548415 | 3300025922 | Bacteria | 1040 |
| 280 | Ga0207681_10190776 | 3300025923 | Bacteria | 1568 |
| 281 | Ga0207650_10015116 | 3300025925 | Bacteria | 5371 |
| 282 | Ga0207650_10052334 | 3300025925 | Bacteria | 3025 |
| 283 | Ga0207650_10053839 | 3300025925 | Bacteria | 2984 |
| 284 | Ga0207650_10401256 | 3300025925 | Bacteria | 1135 |
| 285 | Ga0207650_10712219 | 3300025925 | Bacteria | 848 |
| 286 | Ga0207659_10001465 | 3300025926 | Bacteria | 14071 |
| 287 | Ga0207659_10112199 | 3300025926 | Unclassified | 2074 |
| 288 | Ga0207659_10245267 | 3300025926 | Bacteria | 1451 |
| 289 | Ga0207700_10003078 | 3300025928 | Bacteria | 9625 |
| 290 | Ga0207644_10081315 | 3300025931 | Bacteria | 2394 |
| 291 | Ga0207706_10077823 | 3300025933 | Bacteria | 2917 |
| 292 | Ga0207706_10097974 | 3300025933 | Unclassified | 2579 |
| 293 | Ga0207706_10136039 | 3300025933 | Bacteria | 2162 |
| 294 | Ga0207686_10409100 | 3300025934 | Bacteria | 1035 |
| 295 | Ga0207709_10112218 | 3300025935 | Bacteria | 1825 |
| 296 | Ga0207670_10104809 | 3300025936 | Bacteria | 2026 |
| 297 | Ga0207669_10040227 | 3300025937 | Bacteria | 2710 |
| 298 | Ga0207669_10079899 | 3300025937 | Bacteria | 2090 |
| 299 | Ga0207669_10254247 | 3300025937 | Bacteria | 1310 |
| 300 | Ga0207704_10216504 | 3300025938 | Bacteria | 1414 |
| 301 | Ga0207691_10121725 | 3300025940 | Bacteria | 2312 |
| 302 | Ga0207691_10165578 | 3300025940 | Bacteria | 1937 |
| 303 | Ga0207691_10286009 | 3300025940 | Bacteria | 1418 |
| 304 | Ga0207691_10312122 | 3300025940 | Bacteria | 1349 |
| 305 | Ga0207691_10368910 | 3300025940 | Bacteria | 1226 |
| 306 | Ga0207711_10127745 | 3300025941 | Bacteria | 2276 |
| 307 | Ga0207711_10258098 | 3300025941 | Bacteria | 1601 |
| 308 | Ga0207711_10262024 | 3300025941 | Bacteria | 1589 |
| 309 | Ga0207689_10161831 | 3300025942 | Bacteria | 1844 |
| 310 | Ga0207661_10001481 | 3300025944 | Bacteria | 15878 |
| 311 | Ga0207661_10004405 | 3300025944 | Bacteria | 9876 |
| 312 | Ga0207661_10019055 | 3300025944 | Bacteria | 5108 |
| 313 | Ga0207661_10226598 | 3300025944 | Bacteria | 1654 |
| 314 | Ga0207679_10005466 | 3300025945 | Bacteria | 7961 |
| 315 | Ga0207679_10079401 | 3300025945 | Bacteria | 2502 |
| 316 | Ga0207679_10158951 | 3300025945 | Bacteria | 1848 |
| 317 | Ga0207679_10191853 | 3300025945 | Bacteria | 1699 |
| 318 | Ga0207679_10228111 | 3300025945 | Bacteria | 1570 |
| 319 | Ga0207679_10468762 | 3300025945 | Bacteria | 1119 |
| 320 | Ga0207679_10587913 | 3300025945 | Bacteria | 1002 |
| 321 | Ga0207667_10106183 | 3300025949 | Bacteria | 2897 |
| 322 | Ga0207651_10092531 | 3300025960 | Bacteria | 2218 |
| 323 | Ga0207651_10666177 | 3300025960 | Unclassified | 914 |
| 324 | Ga0207651_10981248 | 3300025960 | Unclassified | 754 |
| 325 | Ga0207668_10098648 | 3300025972 | Unclassified | 2165 |
| 326 | Ga0207658_10061167 | 3300025986 | Bacteria | 2813 |
| 327 | Ga0207658_10172252 | 3300025986 | Bacteria | 1784 |
| 328 | Ga0207658_10277894 | 3300025986 | Bacteria | 1434 |
| 329 | Ga0207658_10638681 | 3300025986 | Bacteria | 959 |
| 330 | Ga0207677_10267757 | 3300026023 | Bacteria | 1396 |
| 331 | Ga0207703_10073161 | 3300026035 | Bacteria | 2835 |
| 332 | Ga0207703_10081417 | 3300026035 | Bacteria | 2699 |
| 333 | Ga0207703_10499900 | 3300026035 | Bacteria | 1141 |
| 334 | Ga0207678_10198326 | 3300026067 | Bacteria | 1716 |
| 335 | Ga0207708_10001614 | 3300026075 | Bacteria | 16807 |
| 336 | Ga0207708_10091600 | 3300026075 | Bacteria | 2345 |
| 337 | Ga0207708_10179487 | 3300026075 | Unclassified | 1681 |
| 338 | Ga0207641_10196513 | 3300026088 | Bacteria | 1857 |
| 339 | Ga0207641_10261749 | 3300026088 | Bacteria | 1620 |
| 340 | Ga0207648_10006648 | 3300026089 | Bacteria | 11475 |
| 341 | Ga0207648_10357299 | 3300026089 | Bacteria | 1318 |
| 342 | Ga0207676_10069080 | 3300026095 | Bacteria | 2828 |
| 343 | Ga0207676_10335715 | 3300026095 | Unclassified | 1392 |
| 344 | Ga0207676_10445870 | 3300026095 | Bacteria | 1219 |
| 345 | Ga0207676_10453804 | 3300026095 | Bacteria | 1209 |
| 346 | Ga0207674_10020387 | 3300026116 | Bacteria | 7163 |
| 347 | Ga0207674_10041419 | 3300026116 | Bacteria | 4764 |
| 348 | Ga0207674_10256462 | 3300026116 | Bacteria | 1696 |
| 349 | Ga0207675_100177617 | 3300026118 | Bacteria | 2038 |
| 350 | Ga0207683_10121950 | 3300026121 | Bacteria | 2341 |
| 351 | Ga0207683_10173179 | 3300026121 | Bacteria | 1955 |
| 352 | Ga0207683_10614497 | 3300026121 | Bacteria | 1006 |
| 353 | Ga0207698_10119787 | 3300026142 | Bacteria | 2225 |
| 354 | Ga0207698_10503825 | 3300026142 | Bacteria | 1179 |
| 355 | Ga0207698_10957252 | 3300026142 | Bacteria | 865 |
| 356 | Ga0209982_1005767 | 3300027552 | Bacteria | 1792 |
| 357 | Ga0209813_10045523 | 3300027866 | Bacteria | 1352 |
| 358 | Ga0207428_10000048 | 3300027907 | Bacteria | 180760 |
| 359 | Ga0207428_10001421 | 3300027907 | Bacteria | 25181 |
| 360 | Ga0207428_10003385 | 3300027907 | Bacteria | 15501 |
| 361 | Ga0207428_10012993 | 3300027907 | Bacteria | 7292 |
| 362 | Ga0268266_10022055 | 3300028379 | Bacteria | 5429 |
| 363 | Ga0268265_10001193 | 3300028380 | Bacteria | 22642 |
| 364 | Ga0268264_10007214 | 3300028381 | Bacteria | 9307 |
| 365 | Ga0268264_10211693 | 3300028381 | Unclassified | 1780 |
| 366 | Ga0268264_10766612 | 3300028381 | Bacteria | 962 |
| 367 | Ga0307408_100012418 | 3300031548 | Bacteria | 5642 |
| 368 | Ga0307408_100077537 | 3300031548 | Bacteria | 2474 |
| 369 | Ga0307408_100098852 | 3300031548 | Bacteria | 2219 |
| 370 | Ga0307408_100147281 | 3300031548 | Bacteria | 1855 |
| 371 | Ga0307408_100152577 | 3300031548 | Unclassified | 1825 |
| 372 | Ga0307408_100166711 | 3300031548 | Bacteria | 1755 |
| 373 | Ga0307405_10035559 | 3300031731 | Bacteria | 2976 |
| 374 | Ga0307405_10396988 | 3300031731 | Bacteria | 1078 |
| 375 | Ga0307413_10047599 | 3300031824 | Bacteria | 2558 |
| 376 | Ga0307413_10255440 | 3300031824 | Unclassified | 1303 |
| 377 | Ga0307410_10134643 | 3300031852 | Bacteria | 1820 |
| 378 | Ga0307410_10270470 | 3300031852 | Bacteria | 1329 |
| 379 | Ga0307406_10093469 | 3300031901 | Bacteria | 2030 |
| 380 | Ga0307407_10075768 | 3300031903 | Bacteria | 2018 |
| 381 | Ga0307407_10312789 | 3300031903 | Archaea | 1099 |
| 382 | Ga0307412_10089590 | 3300031911 | Bacteria | 2149 |
| 383 | Ga0307412_10100362 | 3300031911 | Bacteria | 2046 |
| 384 | Ga0307412_10115053 | 3300031911 | Unclassified | 1927 |
| 385 | Ga0307409_100107264 | 3300031995 | Bacteria | 2333 |
| 386 | Ga0307409_100354227 | 3300031995 | Bacteria | 1386 |
| 387 | Ga0307416_100005976 | 3300032002 | Bacteria | 7564 |
| 388 | Ga0307416_100045600 | 3300032002 | Bacteria | 3453 |
| 389 | Ga0307416_100047586 | 3300032002 | Bacteria | 3395 |
| 390 | Ga0307416_100167528 | 3300032002 | Bacteria | 2040 |
| 391 | Ga0307416_100253705 | 3300032002 | Bacteria | 1714 |
| 392 | Ga0307416_100274777 | 3300032002 | Bacteria | 1657 |
| 393 | Ga0307416_100354114 | 3300032002 | Bacteria | 1487 |
| 394 | Ga0307416_101266020 | 3300032002 | Unclassified | 843 |
| 395 | Ga0307416_101342117 | 3300032002 | Bacteria | 821 |
| 396 | Ga0307411_10055021 | 3300032005 | Bacteria | 2616 |
| 397 | Ga0307411_10067051 | 3300032005 | Bacteria | 2413 |
| 398 | Ga0307411_10182057 | 3300032005 | Unclassified | 1596 |
| 399 | Ga0307411_10227502 | 3300032005 | Bacteria | 1451 |
| 400 | Ga0307411_10476153 | 3300032005 | Bacteria | 1050 |
| 401 | Ga0307415_100031272 | 3300032126 | Bacteria | 3427 |
| 402 | Ga0307415_100379989 | 3300032126 | Bacteria | 1199 |
| 403 | Ga0373926_0008201 | 3300035083 | Bacteria | 3477 |
| 404 | Ga0373956_0258449 | 3300035119 | Unclassified | 828 |
| 405 | Ga0373943_0115001 | 3300035170 | Bacteria | 1423 |
| 406 | Ga0373955_0018405 | 3300035172 | Bacteria | 3473 |
| 407 | Ga0373935_0097227 | 3300035692 | Unclassified | 1936 |
| 408 | Ga0373935_0105662 | 3300035692 | Bacteria | 1862 |
| 409 | Ga0373947_0055763 | 3300035725 | Bacteria | 2387 |
| 410 | Ga0373937_0619256 | 3300036401 | Bacteria | 1027 |
| 411 | Ga0373925_0098098 | 3300037068 | Bacteria | 2248 |
| 412 | Ga0373925_0524712 | 3300037068 | Unclassified | 973 |
| 413 | Ga0395900_0543035 | 3300037418 | Bacteria | 1108 |
| 414 | Ga0395905_0626219 | 3300037471 | Bacteria | 978 |
| 415 | Ga0436365_0372794 | 3300039437 | Bacteria | 2043 |
| 416 | Ga0439439_0015945 | 3300041406 | Unclassified | 1837 |
| 417 | Ga0439453_0022440 | 3300041408 | Archaea | 1144 |
| 418 | Ga0439461_0037172 | 3300041410 | Bacteria | 1039 |
| 419 | Ga0451789_1141407 | 3300041443 | Bacteria | 691 |
| 420 | Ga0451853_0443173 | 3300041512 | Bacteria | 1331 |
| 421 | Ga0439431_0021554 | 3300041997 | Bacteria | 1547 |
| 422 | Ga0439433_0002476 | 3300041999 | Bacteria | 3920 |
| 423 | Ga0439433_0005225 | 3300041999 | Bacteria | 2789 |
| 424 | Ga0439433_0035924 | 3300041999 | Bacteria | 1144 |
| 425 | Ga0439449_0053609 | 3300042007 | Bacteria | 1491 |
| 426 | Ga0439450_000213 | 3300042008 | Bacteria | 6925 |
| 427 | Ga0439462_0014582 | 3300042015 | Bacteria | 2021 |
| 428 | Ga0450920_009630 | 3300042122 | Bacteria | 1780 |
| 429 | Ga0450923_004427 | 3300042125 | Bacteria | 2206 |
| 430 | Ga0450899_010690 | 3300042135 | Bacteria | 1020 |
| 431 | Ga0439446_0010643 | 3300042156 | Bacteria | 2482 |
| 432 | Ga0439446_0012217 | 3300042156 | Bacteria | 2343 |
| 433 | Ga0439434_0003558 | 3300042435 | Bacteria | 4547 |
| 434 | Ga0439434_0055486 | 3300042435 | Unclassified | 1233 |
| 435 | Ga0439434_0055597 | 3300042435 | Bacteria | 1232 |
| 436 | Ga0439435_0065639 | 3300042436 | Bacteria | 1065 |
| 437 | Ga0439444_0015903 | 3300042437 | Unclassified | 1275 |
| 438 | Ga0439464_0080509 | 3300042439 | Bacteria | 972 |
| 439 | Ga0439460_0085975 | 3300042461 | Unclassified | 993 |
| 440 | Ga0450918_003731 | 3300042531 | Bacteria | 2817 |
| 441 | Ga0451577_0514545 | 3300042876 | Bacteria | 1087 |
| 442 | Ga0439440_0030529 | 3300042993 | Bacteria | 1270 |
| 443 | Ga0453684_0225246 | 3300044712 | Bacteria | 2169 |
| 444 | Ga0451576_0012634 | 3300045051 | Bacteria | 9481 |
| 445 | Ga0451576_0083199 | 3300045051 | Bacteria | 3329 |
| 446 | Ga0451576_0186158 | 3300045051 | Bacteria | 2168 |
| 447 | Ga0451576_0612475 | 3300045051 | Unclassified | 1144 |
| 448 | Ga0466967_0200247 | 3300045976 | Bacteria | 1891 |
| 449 | Ga0495629_0010127 | 3300046459 | Bacteria | 6876 |
| 450 | Ga0495584_0013749 | 3300046491 | Bacteria | 4128 |
| 451 | Ga0495594_0020424 | 3300046499 | Bacteria | 3528 |
| 452 | Ga0495594_0049673 | 3300046499 | Bacteria | 2306 |
| 453 | Ga0495594_0064228 | 3300046499 | Bacteria | 2035 |
| 454 | Ga0495663_0008880 | 3300046525 | Bacteria | 2788 |
| 455 | Ga0495642_0012519 | 3300046528 | Bacteria | 3270 |
| 456 | Ga0495642_0119794 | 3300046528 | Archaea | 1129 |
| 457 | Ga0495598_0039601 | 3300046537 | Bacteria | 1371 |
| 458 | Ga0495609_0050739 | 3300046538 | Bacteria | 1849 |
| 459 | Ga0495621_0067629 | 3300046539 | Bacteria | 1309 |
| 460 | Ga0495656_0047373 | 3300046615 | Bacteria | 1823 |
| 461 | Ga0495659_0011551 | 3300046664 | Bacteria | 2845 |
| 462 | Ga0495659_0012673 | 3300046664 | Bacteria | 2735 |
| 463 | Ga0495659_0014479 | 3300046664 | Unclassified | 2582 |
| 464 | Ga0495659_0014608 | 3300046664 | Bacteria | 2572 |
| 465 | Ga0495588_0015994 | 3300046674 | Bacteria | 3620 |
| 466 | Ga0495657_0337007 | 3300046675 | Bacteria | 894 |
| 467 | Ga0495658_0489359 | 3300046683 | Bacteria | 787 |
| 468 | Ga0495600_0106179 | 3300046809 | Unclassified | 1830 |
| 469 | Ga0495636_0010870 | 3300047318 | Unclassified | 3601 |
| 470 | Ga0495636_0271872 | 3300047318 | Unclassified | 788 |
| 471 | Ga0495674_0219955 | 3300047319 | Bacteria | 1570 |
| 472 | Ga0495676_0062131 | 3300047321 | Bacteria | 2918 |
| 473 | Ga0495685_021291 | 3300047447 | Bacteria | 2231 |
| 474 | Ga0495684_0315783 | 3300047471 | Unclassified | 1118 |
| 475 | Ga0496100_0037095 | 3300048903 | Bacteria | 3079 |
| 476 | Ga0496100_0079241 | 3300048903 | Bacteria | 2213 |
| 477 | Ga0496101_0058339 | 3300048904 | Bacteria | 2795 |
| 478 | Ga0496104_0001797 | 3300048907 | Bacteria | 18590 |
| 479 | Ga0496104_0016740 | 3300048907 | Bacteria | 6666 |
| 480 | Ga0496104_0331563 | 3300048907 | Bacteria | 1435 |
| 481 | Ga0496104_0781236 | 3300048907 | Bacteria | 861 |
| 482 | Ga0496105_0062768 | 3300048908 | Bacteria | 3066 |
| 483 | Ga0496105_0119830 | 3300048908 | Bacteria | 2170 |
| 484 | Ga0496105_0385158 | 3300048908 | Bacteria | 1115 |
| 485 | Ga0496107_0112817 | 3300048910 | Bacteria | 1999 |
| 486 | Ga0496108_0004028 | 3300048911 | Bacteria | 11793 |
| 487 | Ga0496108_0017856 | 3300048911 | Bacteria | 5803 |
| 488 | Ga0496109_0001846 | 3300048912 | Bacteria | 17552 |
| 489 | Ga0496109_0287186 | 3300048912 | Bacteria | 1551 |
| 490 | Ga0496109_0607778 | 3300048912 | Bacteria | 1030 |
| 491 | Ga0496110_0339458 | 3300048913 | Bacteria | 1368 |
| 492 | Ga0496110_0362287 | 3300048913 | Bacteria | 1321 |
| 493 | Ga0496111_0019021 | 3300048914 | Bacteria | 4763 |
| 494 | Ga0496112_0012297 | 3300048915 | Bacteria | 7861 |
| 495 | Ga0496113_0207885 | 3300048916 | Bacteria | 1557 |
| 496 | Ga0496113_0224547 | 3300048916 | Bacteria | 1497 |
| 497 | Ga0496114_0001396 | 3300048917 | Bacteria | 18340 |
| 498 | Ga0501031_0044414 | 3300049568 | Bacteria | 2900 |
| 499 | Ga0501031_0156411 | 3300049568 | Bacteria | 1490 |
| 500 | Ga0501033_0302724 | 3300049570 | Bacteria | 1125 |
| 501 | Ga0501034_0113457 | 3300049571 | Bacteria | 2700 |
| 502 | Ga0501036_0042355 | 3300049572 | Bacteria | 3855 |
| 503 | Ga0501036_0061654 | 3300049572 | Bacteria | 3177 |
| 504 | Ga0501036_0076421 | 3300049572 | Bacteria | 2833 |
| 505 | Ga0501036_0086664 | 3300049572 | Bacteria | 2647 |
| 506 | Ga0501036_0103681 | 3300049572 | Bacteria | 2405 |
| 507 | Ga0501036_0268679 | 3300049572 | Bacteria | 1428 |
| 508 | Ga0501038_0095757 | 3300049574 | Bacteria | 2479 |
| 509 | Ga0501039_0061114 | 3300049575 | Bacteria | 2918 |
| 510 | Ga0501039_0086708 | 3300049575 | Bacteria | 2438 |
| 511 | Ga0501039_0262851 | 3300049575 | Bacteria | 1356 |
| 512 | Ga0501040_0021940 | 3300049576 | Bacteria | 4270 |
| 513 | Ga0501040_0066727 | 3300049576 | Bacteria | 2479 |
| 514 | Ga0501040_0250608 | 3300049576 | Bacteria | 1263 |
| 515 | Ga0501041_0046095 | 3300049577 | Unclassified | 2652 |
| 516 | Ga0501041_0063496 | 3300049577 | Bacteria | 2261 |
| 517 | Ga0501041_0103295 | 3300049577 | Bacteria | 1765 |
| 518 | Ga0501041_0104916 | 3300049577 | Bacteria | 1751 |
| 519 | Ga0501041_0264681 | 3300049577 | Bacteria | 1081 |
| 520 | Ga0501042_0015915 | 3300049578 | Bacteria | 5157 |
| 521 | Ga0501042_0108775 | 3300049578 | Bacteria | 1996 |
| 522 | Ga0501042_0131026 | 3300049578 | Bacteria | 1807 |
| 523 | Ga0501042_0243300 | 3300049578 | Bacteria | 1298 |
| 524 | Ga0501042_0252830 | 3300049578 | Unclassified | 1272 |
| 525 | Ga0501043_0365133 | 3300049579 | Bacteria | 1095 |
| 526 | Ga0501046_0087843 | 3300049580 | Bacteria | 2395 |
| 527 | Ga0501046_0303974 | 3300049580 | Bacteria | 1164 |
| 528 | Ga0501048_0034807 | 3300049582 | Bacteria | 3630 |
| 529 | Ga0501048_0042593 | 3300049582 | Bacteria | 3250 |
| 530 | Ga0501048_0127741 | 3300049582 | Bacteria | 1798 |
| 531 | Ga0501067_0016453 | 3300049583 | Unclassified | 4086 |
| 532 | Ga0501069_0068325 | 3300049585 | Bacteria | 1989 |
| 533 | Ga0501069_0079165 | 3300049585 | Unclassified | 1849 |
| 534 | Ga0501069_0141660 | 3300049585 | Bacteria | 1379 |
| 535 | Ga0501069_0407432 | 3300049585 | Bacteria | 805 |
| 536 | Ga0501071_0004355 | 3300049587 | Bacteria | 8980 |
| 537 | Ga0501071_0041216 | 3300049587 | Bacteria | 3307 |
| 538 | Ga0501071_0072851 | 3300049587 | Bacteria | 2505 |
| 539 | Ga0501071_0155842 | 3300049587 | Bacteria | 1705 |
| 540 | Ga0501071_0210629 | 3300049587 | Unclassified | 1461 |
| 541 | Ga0501071_0252052 | 3300049587 | Unclassified | 1333 |
| 542 | Ga0501072_0009895 | 3300049588 | Bacteria | 7252 |
| 543 | Ga0501072_0036484 | 3300049588 | Bacteria | 3854 |
| 544 | Ga0501072_0057194 | 3300049588 | Bacteria | 3073 |
| 545 | Ga0501072_0074399 | 3300049588 | Bacteria | 2686 |
| 546 | Ga0501072_0093286 | 3300049588 | Bacteria | 2391 |
| 547 | Ga0501072_0135272 | 3300049588 | Unclassified | 1965 |
| 548 | Ga0501072_0214388 | 3300049588 | Bacteria | 1534 |
| 549 | Ga0501072_0330400 | 3300049588 | Bacteria | 1211 |
| 550 | Ga0501073_0095153 | 3300049589 | Bacteria | 2069 |
| 551 | Ga0501074_0055568 | 3300049590 | Bacteria | 2853 |
| 552 | Ga0501074_0213864 | 3300049590 | Bacteria | 1373 |
| 553 | Ga0501074_0367266 | 3300049590 | Bacteria | 1021 |
| 554 | Ga0501075_0001534 | 3300049591 | Bacteria | 15063 |
| 555 | Ga0501075_0024470 | 3300049591 | Bacteria | 4429 |
| 556 | Ga0501075_0025191 | 3300049591 | Bacteria | 4371 |
| 557 | Ga0501075_0095487 | 3300049591 | Bacteria | 2256 |
| 558 | Ga0501075_0098892 | 3300049591 | Bacteria | 2215 |
| 559 | Ga0501075_0134275 | 3300049591 | Bacteria | 1885 |
| 560 | Ga0501075_0137098 | 3300049591 | Bacteria | 1864 |
| 561 | Ga0501075_0194268 | 3300049591 | Bacteria | 1548 |
| 562 | Ga0501075_0411045 | 3300049591 | Bacteria | 1032 |
| 563 | Ga0501075_0425911 | 3300049591 | Bacteria | 1012 |
| 564 | Ga0501076_0022992 | 3300049592 | Bacteria | 4798 |
| 565 | Ga0501076_0036695 | 3300049592 | Bacteria | 3841 |
| 566 | Ga0501076_0044318 | 3300049592 | Bacteria | 3508 |
| 567 | Ga0501076_0099060 | 3300049592 | Bacteria | 2348 |
| 568 | Ga0501076_0113450 | 3300049592 | Bacteria | 2192 |
| 569 | Ga0501076_0166370 | 3300049592 | Bacteria | 1797 |
| 570 | Ga0501076_0218466 | 3300049592 | Bacteria | 1558 |
| 571 | Ga0501077_0056570 | 3300049593 | Bacteria | 2490 |
| 572 | Ga0501077_0075813 | 3300049593 | Bacteria | 2130 |
| 573 | Ga0501077_0125764 | 3300049593 | Unclassified | 1625 |
| 574 | Ga0501077_0177884 | 3300049593 | Bacteria | 1352 |
| 575 | Ga0501079_0009615 | 3300049741 | Bacteria | 7333 |
| 576 | Ga0501079_0045180 | 3300049741 | Bacteria | 3400 |
| 577 | Ga0501079_0061582 | 3300049741 | Bacteria | 2895 |
| 578 | Ga0501079_0063662 | 3300049741 | Bacteria | 2845 |
| 579 | Ga0501079_0323813 | 3300049741 | Unclassified | 1207 |
| 580 | Ga0501080_0041313 | 3300049742 | Bacteria | 4298 |
| 581 | Ga0501080_0197373 | 3300049742 | Bacteria | 1848 |
| 582 | Ga0501081_0027452 | 3300049743 | Bacteria | 3840 |
| 583 | Ga0501081_0049052 | 3300049743 | Bacteria | 2906 |
| 584 | Ga0501081_0051693 | 3300049743 | Bacteria | 2834 |
| 585 | Ga0501081_0056415 | 3300049743 | Bacteria | 2715 |
| 586 | Ga0501081_0114055 | 3300049743 | Bacteria | 1920 |
| 587 | Ga0501081_0199976 | 3300049743 | Bacteria | 1449 |
| 588 | Ga0501083_0133136 | 3300049744 | Bacteria | 1630 |
| 589 | Ga0501035_0161684 | 3300049822 | Bacteria | 1938 |
| 590 | Ga0501035_0383642 | 3300049822 | Bacteria | 1171 |
| 591 | Ga0501045_0035210 | 3300049824 | Bacteria | 3634 |
| 592 | Ga0501045_0054252 | 3300049824 | Bacteria | 2930 |
| 593 | Ga0501045_0066836 | 3300049824 | Bacteria | 2639 |
| 594 | Ga0501045_0147967 | 3300049824 | Unclassified | 1747 |
| 595 | Ga0501045_0180592 | 3300049824 | Bacteria | 1572 |
| 596 | Ga0501045_0632996 | 3300049824 | Bacteria | 791 |
| 597 | nmdc:mga03683_3561_c1 | 3300050489 | Bacteria | 5046 |
| 598 | nmdc:mga03n38_17500_c1 | 3300050490 | Bacteria | 2808 |
| 599 | nmdc:mga00v17_28425_c1 | 3300050491 | Bacteria | 3275 |
| 600 | nmdc:mga00v17_3738_c2 | 3300050491 | Bacteria | 4454 |
| 601 | nmdc:mga0yw44_58199_c1 | 3300050492 | Bacteria | 2360 |
| 602 | nmdc:mga0k408_117395_c1 | 3300050493 | Bacteria | 1575 |
| 603 | nmdc:mga0k408_168526_c1 | 3300050493 | Bacteria | 1305 |
| 604 | nmdc:mga0k408_7377_c1 | 3300050493 | Bacteria | 5870 |
| 605 | nmdc:mga0k408_8269_c1 | 3300050493 | Bacteria | 5581 |
| 606 | nmdc:mga06z11_54799_c1 | 3300050494 | Bacteria | 2057 |
| 607 | nmdc:mga04h51_15230_c1 | 3300050495 | Bacteria | 2212 |
| 608 | nmdc:mga04h51_29463_c1 | 3300050495 | Bacteria | 1720 |
| 609 | nmdc:mga04h51_84404_c1 | 3300050495 | Bacteria | 1133 |
| 610 | nmdc:mga05p37_10546_c1 | 3300050507 | Bacteria | 10958 |
| 611 | nmdc:mga05p37_10687_c1 | 3300050507 | Bacteria | 10895 |
| 612 | nmdc:mga05p37_133190_c1 | 3300050507 | Bacteria | 3049 |
| 613 | nmdc:mga05p37_133663_c1 | 3300050507 | Bacteria | 3043 |
| 614 | nmdc:mga05p37_256905_c1 | 3300050507 | Bacteria | 2093 |
| 615 | nmdc:mga05p37_2706_c1 | 3300050507 | Bacteria | 20600 |
| 616 | nmdc:mga05p37_36822_c1 | 3300050507 | Bacteria | 6001 |
| 617 | nmdc:mga05p37_46502_c1 | 3300050507 | Bacteria | 5336 |
| 618 | nmdc:mga05p37_89795_c1 | 3300050507 | Bacteria | 3787 |
| 619 | nmdc:mga05p37_93925_c1 | 3300050507 | Bacteria | 3696 |
| 620 | nmdc:mga09592_133321_c1 | 3300050508 | Bacteria | 2139 |
| 621 | nmdc:mga09592_190088_c1 | 3300050508 | Bacteria | 1777 |
| 622 | nmdc:mga09592_242321_c1 | 3300050508 | Bacteria | 1562 |
| 623 | nmdc:mga09592_390522_c1 | 3300050508 | Bacteria | 1203 |
| 624 | nmdc:mga09592_55254_c1 | 3300050508 | Bacteria | 3355 |
| 625 | nmdc:mga09592_559558_c1 | 3300050508 | Bacteria | 982 |
| 626 | nmdc:mga0qj67_1191_c1 | 3300050509 | Bacteria | 18036 |
| 627 | nmdc:mga0qj67_303671_c1 | 3300050509 | Bacteria | 1293 |
| 628 | nmdc:mga0qj67_442619_c1 | 3300050509 | Bacteria | 1047 |
| 629 | nmdc:mga0qj67_655915_c1 | 3300050509 | Bacteria | 837 |
| 630 | nmdc:mga0qj67_69070_c1 | 3300050509 | Bacteria | 2817 |
| 631 | nmdc:mga06r32_109267_c1 | 3300050510 | Bacteria | 2719 |
| 632 | nmdc:mga06r32_19697_c1 | 3300050510 | Bacteria | 6199 |
| 633 | nmdc:mga06r32_21085_c1 | 3300050510 | Bacteria | 6012 |
| 634 | nmdc:mga06r32_303381_c1 | 3300050510 | Bacteria | 1583 |
| 635 | nmdc:mga06r32_479225_c1 | 3300050510 | Unclassified | 1222 |
| 636 | nmdc:mga06r32_86159_c1 | 3300050510 | Bacteria | 3063 |
| 637 | nmdc:mga06r32_877273_c1 | 3300050510 | Bacteria | 855 |
| 638 | nmdc:mga08y16_12185_c1 | 3300050511 | Bacteria | 9038 |
| 639 | nmdc:mga08y16_138660_c1 | 3300050511 | Bacteria | 2529 |
| 640 | nmdc:mga08y16_484813_c1 | 3300050511 | Unclassified | 1258 |
| 641 | nmdc:mga08y16_58651_c1 | 3300050511 | Unclassified | 4022 |
| 642 | nmdc:mga08y16_8_c1 | 3300050511 | Bacteria | 571177 |
| 643 | nmdc:mga0n895_345259_c1 | 3300050512 | Bacteria | 1508 |
| 644 | nmdc:mga0n895_42495_c1 | 3300050512 | Bacteria | 4422 |
| 645 | nmdc:mga0n895_52001_c1 | 3300050512 | Bacteria | 4020 |
| 646 | nmdc:mga0n895_63479_c1 | 3300050512 | Bacteria | 3652 |
| 647 | nmdc:mga0n895_876676_c1 | 3300050512 | Bacteria | 884 |
| 648 | nmdc:mga0rr50_154058_c1 | 3300050513 | Bacteria | 1860 |
| 649 | nmdc:mga0rr50_178396_c1 | 3300050513 | Bacteria | 1735 |
| 650 | nmdc:mga0rr50_97954_c1 | 3300050513 | Bacteria | 2297 |
| 651 | nmdc:mga0a205_107877_c1 | 3300050515 | Unclassified | 2683 |
| 652 | nmdc:mga0a205_174537_c1 | 3300050515 | Bacteria | 2045 |
| 653 | nmdc:mga0a205_207632_c1 | 3300050515 | Unclassified | 1848 |
| 654 | nmdc:mga0a205_327463_c1 | 3300050515 | Bacteria | 1402 |
| 655 | nmdc:mga0a205_39887_c1 | 3300050515 | Bacteria | 4520 |
| 656 | Ga0495601_0016468 | 3300053077 | Bacteria | 4480 |
| 657 | Ga0495619_0051407 | 3300053085 | Bacteria | 2723 |
| 658 | Ga0500628_002853 | 3300053129 | Bacteria | 2840 |
| 659 | Ga0500611_009352 | 3300053727 | Bacteria | 1550 |
| 660 | Ga0501084_0151050 | 3300054114 | Bacteria | 1958 |
| 661 | Ga0501084_0172625 | 3300054114 | Bacteria | 1825 |
| 662 | Ga0501084_0209160 | 3300054114 | Bacteria | 1646 |
| 663 | Ga0501084_0301493 | 3300054114 | Bacteria | 1353 |
| 664 | Ga0501084_0546872 | 3300054114 | Bacteria | 978 |
| 665 | Ga0501084_0823297 | 3300054114 | Bacteria | 782 |
| 666 | Ga0590071_000282 | 3300059421 | Bacteria | 14815 |
| 667 | Ga0590071_004343 | 3300059421 | Bacteria | 3449 |
| 668 | Ga0590071_038187 | 3300059421 | Unclassified | 1153 |
| 669 | Ga0590074_007341 | 3300059423 | Bacteria | 1832 |
| 670 | Ga0590075_006983 | 3300059424 | Bacteria | 2676 |
| 671 | Ga0590077_000238 | 3300059426 | Bacteria | 15670 |
| 672 | Ga0590077_003048 | 3300059426 | Bacteria | 3511 |
| 673 | Ga0501082_0020583 | 3300060353 | Bacteria | 5687 |
| 674 | Ga0501082_0076373 | 3300060353 | Bacteria | 2888 |
| 675 | Ga0501082_0296378 | 3300060353 | Bacteria | 1408 |
| 676 | Ga0501082_0302428 | 3300060353 | Bacteria | 1393 |
| 677 | Ga0501082_0349904 | 3300060353 | Bacteria | 1288 |
| 678 | Ga0530510_0001988 | 3300061734 | Bacteria | 14024 |
| 679 | Ga0530510_0074430 | 3300061734 | Bacteria | 2466 |
| 680 | Ga0530510_0183500 | 3300061734 | Unclassified | 1552 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046675 | Ga0495657_0337007 | Ga0495657_0337007_14_604 | 172 |
| 2 | 3300041443 | Ga0451789_1141407 | Ga0451789_1141407_111_680 | 174 |
| 3 | 3300046499 | Ga0495594_0064228 | Ga0495594_0064228_774_1478 | 188 |
| 4 | 3300042435 | Ga0439434_0003558 | Ga0439434_0003558_2325_2972 | 190 |
| 5 | 3300049592 | Ga0501076_0218466 | Ga0501076_0218466_897_1532 | 192 |
| 6 | 3300005616 | Ga0068852_100091605 | Ga0068852_1000916052 | 194 |
| 7 | 3300006844 | Ga0075428_100000030 | Ga0075428_10000003068 | 194 |
| 8 | 3300006880 | Ga0075429_100118292 | Ga0075429_1001182922 | 194 |
| 9 | 3300009094 | Ga0111539_10000015 | Ga0111539_1000001573 | 194 |
| 10 | 3300026142 | Ga0207698_10503825 | Ga0207698_105038252 | 194 |
| 11 | 3300027907 | Ga0207428_10000048 | Ga0207428_1000004873 | 194 |
| 12 | 3300046683 | Ga0495658_0489359 | Ga0495658_0489359_30_749 | 194 |
| 13 | 3300050508 | nmdc:mga09592_190088_c1 | nmdc:mga09592_190088_c1_930_1553 | 194 |
| 14 | 3300050510 | nmdc:mga06r32_86159_c1 | nmdc:mga06r32_86159_c1_905_1528 | 194 |
| 15 | 3300050511 | nmdc:mga08y16_8_c1 | nmdc:mga08y16_8_c1_466850_467473 | 194 |
| 16 | 3300005331 | Ga0070670_100471488 | Ga0070670_1004714882 | 195 |
| 17 | 3300031824 | Ga0307413_10255440 | Ga0307413_102554402 | 196 |
| 18 | 3300032002 | Ga0307416_100274777 | Ga0307416_1002747773 | 196 |
| 19 | 3300049576 | Ga0501040_0250608 | Ga0501040_0250608_625_1233 | 196 |
| 20 | 3300059421 | Ga0590071_038187 | Ga0590071_038187_327_1040 | 196 |
| 21 | 3300005295 | Ga0065707_10138247 | Ga0065707_101382472 | 197 |
| 22 | 3300005337 | Ga0070682_100195394 | Ga0070682_1001953941 | 197 |
| 23 | 3300005444 | Ga0070694_100216176 | Ga0070694_1002161762 | 197 |
| 24 | 3300006844 | Ga0075428_100011002 | Ga0075428_1000110028 | 197 |
| 25 | 3300006880 | Ga0075429_100561832 | Ga0075429_1005618322 | 197 |
| 26 | 3300007076 | Ga0075435_100212915 | Ga0075435_1002129152 | 197 |
| 27 | 3300009094 | Ga0111539_10099845 | Ga0111539_100998452 | 197 |
| 28 | 3300009147 | Ga0114129_10098200 | Ga0114129_100982002 | 197 |
| 29 | 3300009147 | Ga0114129_10155324 | Ga0114129_101553242 | 197 |
| 30 | 3300014326 | Ga0157380_11426910 | Ga0157380_114269101 | 197 |
| 31 | 3300027907 | Ga0207428_10012993 | Ga0207428_100129938 | 197 |
| 32 | 3300049585 | Ga0501069_0141660 | Ga0501069_0141660_211_873 | 197 |
| 33 | 3300050507 | nmdc:mga05p37_256905_c1 | nmdc:mga05p37_256905_c1_403_1011 | 197 |
| 34 | 3300050508 | nmdc:mga09592_559558_c1 | nmdc:mga09592_559558_c1_238_846 | 197 |
| 35 | 3300050511 | nmdc:mga08y16_138660_c1 | nmdc:mga08y16_138660_c1_1572_2180 | 197 |
| 36 | 3300050513 | nmdc:mga0rr50_178396_c1 | nmdc:mga0rr50_178396_c1_397_1089 | 197 |
| 37 | 3300005356 | Ga0070674_100252522 | Ga0070674_1002525222 | 199 |
| 38 | 3300006880 | Ga0075429_100424987 | Ga0075429_1004249872 | 200 |
| 39 | 3300049572 | Ga0501036_0103681 | Ga0501036_0103681_186_827 | 200 |
| 40 | 3300049577 | Ga0501041_0063496 | Ga0501041_0063496_640_1281 | 200 |
| 41 | 3300049578 | Ga0501042_0108775 | Ga0501042_0108775_247_888 | 200 |
| 42 | 3300049588 | Ga0501072_0330400 | Ga0501072_0330400_458_1099 | 200 |
| 43 | 3300049591 | Ga0501075_0137098 | Ga0501075_0137098_1197_1838 | 200 |
| 44 | 3300049592 | Ga0501076_0022992 | Ga0501076_0022992_706_1347 | 200 |
| 45 | 3300049743 | Ga0501081_0049052 | Ga0501081_0049052_680_1321 | 200 |
| 46 | 3300049824 | Ga0501045_0066836 | Ga0501045_0066836_484_1125 | 200 |
| 47 | 3300050508 | nmdc:mga09592_390522_c1 | nmdc:mga09592_390522_c1_446_1075 | 200 |
| 48 | 3300054114 | Ga0501084_0151050 | Ga0501084_0151050_1182_1823 | 200 |
| 49 | 3300061734 | Ga0530510_0074430 | Ga0530510_0074430_714_1355 | 200 |
| 50 | 3300005331 | Ga0070670_100480184 | Ga0070670_1004801842 | 201 |
| 51 | 3300005355 | Ga0070671_100485558 | Ga0070671_1004855581 | 201 |
| 52 | 3300005356 | Ga0070674_100151238 | Ga0070674_1001512382 | 201 |
| 53 | 3300005365 | Ga0070688_100018946 | Ga0070688_1000189464 | 201 |
| 54 | 3300005543 | Ga0070672_100064039 | Ga0070672_1000640394 | 201 |
| 55 | 3300005564 | Ga0070664_100209267 | Ga0070664_1002092672 | 201 |
| 56 | 3300005615 | Ga0070702_100105367 | Ga0070702_1001053672 | 201 |
| 57 | 3300009094 | Ga0111539_11178431 | Ga0111539_111784311 | 201 |
| 58 | 3300025923 | Ga0207681_10190776 | Ga0207681_101907761 | 201 |
| 59 | 3300025925 | Ga0207650_10401256 | Ga0207650_104012562 | 201 |
| 60 | 3300025940 | Ga0207691_10121725 | Ga0207691_101217252 | 201 |
| 61 | 3300025945 | Ga0207679_10079401 | Ga0207679_100794014 | 201 |
| 62 | 3300046664 | Ga0495659_0014479 | Ga0495659_0014479_190_870 | 201 |
| 63 | 3300005338 | Ga0068868_100392113 | Ga0068868_1003921131 | 202 |
| 64 | 3300013306 | Ga0163162_10571582 | Ga0163162_105715822 | 202 |
| 65 | 3300013308 | Ga0157375_11220528 | Ga0157375_112205282 | 202 |
| 66 | 3300017792 | Ga0163161_10095596 | Ga0163161_100955962 | 202 |
| 67 | 3300041512 | Ga0451853_0443173 | Ga0451853_0443173_364_1029 | 202 |
| 68 | 3300045051 | Ga0451576_0186158 | Ga0451576_0186158_1192_1896 | 202 |
| 69 | 3300046491 | Ga0495584_0013749 | Ga0495584_0013749_1634_2317 | 202 |
| 70 | 3300046499 | Ga0495594_0049673 | Ga0495594_0049673_218_901 | 202 |
| 71 | 3300046525 | Ga0495663_0008880 | Ga0495663_0008880_493_1176 | 202 |
| 72 | 3300046528 | Ga0495642_0012519 | Ga0495642_0012519_818_1501 | 202 |
| 73 | 3300046538 | Ga0495609_0050739 | Ga0495609_0050739_311_994 | 202 |
| 74 | 3300046664 | Ga0495659_0011551 | Ga0495659_0011551_1095_1778 | 202 |
| 75 | 3300046664 | Ga0495659_0014608 | Ga0495659_0014608_1396_2079 | 202 |
| 76 | 3300046674 | Ga0495588_0015994 | Ga0495588_0015994_1245_1928 | 202 |
| 77 | 3300047318 | Ga0495636_0271872 | Ga0495636_0271872_65_748 | 202 |
| 78 | 3300047447 | Ga0495685_021291 | Ga0495685_021291_598_1281 | 202 |
| 79 | 3300005445 | Ga0070708_100114527 | Ga0070708_1001145272 | 203 |
| 80 | 3300006844 | Ga0075428_100075795 | Ga0075428_1000757956 | 203 |
| 81 | 3300009094 | Ga0111539_10305245 | Ga0111539_103052452 | 203 |
| 82 | 3300035170 | Ga0373943_0115001 | Ga0373943_0115001_91_762 | 203 |
| 83 | 3300035692 | Ga0373935_0105662 | Ga0373935_0105662_736_1407 | 203 |
| 84 | 3300035725 | Ga0373947_0055763 | Ga0373947_0055763_1147_1818 | 203 |
| 85 | 3300005341 | Ga0070691_10092043 | Ga0070691_100920432 | 205 |
| 86 | 3300005438 | Ga0070701_10018755 | Ga0070701_100187553 | 205 |
| 87 | 3300005440 | Ga0070705_100100434 | Ga0070705_1001004342 | 205 |
| 88 | 3300005444 | Ga0070694_100013000 | Ga0070694_1000130002 | 205 |
| 89 | 3300005444 | Ga0070694_100588851 | Ga0070694_1005888511 | 205 |
| 90 | 3300005459 | Ga0068867_100484826 | Ga0068867_1004848262 | 205 |
| 91 | 3300005467 | Ga0070706_100089513 | Ga0070706_1000895133 | 205 |
| 92 | 3300005468 | Ga0070707_100210554 | Ga0070707_1002105542 | 205 |
| 93 | 3300005471 | Ga0070698_100004723 | Ga0070698_10000472314 | 205 |
| 94 | 3300005518 | Ga0070699_100007386 | Ga0070699_10000738610 | 205 |
| 95 | 3300005545 | Ga0070695_100054187 | Ga0070695_1000541874 | 205 |
| 96 | 3300005546 | Ga0070696_100208946 | Ga0070696_1002089461 | 205 |
| 97 | 3300005549 | Ga0070704_100079079 | Ga0070704_1000790793 | 205 |
| 98 | 3300005549 | Ga0070704_100167341 | Ga0070704_1001673412 | 205 |
| 99 | 3300006852 | Ga0075433_10093714 | Ga0075433_100937143 | 205 |
| 100 | 3300006871 | Ga0075434_100104126 | Ga0075434_1001041264 | 205 |
| 101 | 3300006871 | Ga0075434_100137424 | Ga0075434_1001374242 | 205 |
| 102 | 3300009147 | Ga0114129_10003888 | Ga0114129_1000388822 | 205 |
| 103 | 3300009148 | Ga0105243_10058182 | Ga0105243_100581822 | 205 |
| 104 | 3300025910 | Ga0207684_10206892 | Ga0207684_102068923 | 205 |
| 105 | 3300025922 | Ga0207646_10544359 | Ga0207646_105443592 | 205 |
| 106 | 3300046537 | Ga0495598_0039601 | Ga0495598_0039601_56_739 | 205 |
| 107 | 3300046615 | Ga0495656_0047373 | Ga0495656_0047373_788_1471 | 205 |
| 108 | 3300050508 | nmdc:mga09592_133321_c1 | nmdc:mga09592_133321_c1_331_1011 | 205 |
| 109 | 3300050512 | nmdc:mga0n895_345259_c1 | nmdc:mga0n895_345259_c1_203_886 | 205 |
| 110 | 3300050515 | nmdc:mga0a205_39887_c1 | nmdc:mga0a205_39887_c1_2908_3591 | 205 |
| 111 | 3300005440 | Ga0070705_100000353 | Ga0070705_10000035316 | 206 |
| 112 | 3300005444 | Ga0070694_100001728 | Ga0070694_1000017282 | 206 |
| 113 | 3300005518 | Ga0070699_100009834 | Ga0070699_10000983410 | 206 |
| 114 | 3300005545 | Ga0070695_100000542 | Ga0070695_10000054215 | 206 |
| 115 | 3300005546 | Ga0070696_100052386 | Ga0070696_1000523862 | 206 |
| 116 | 3300005615 | Ga0070702_100027661 | Ga0070702_1000276613 | 206 |
| 117 | 3300009148 | Ga0105243_10060040 | Ga0105243_100600404 | 206 |
| 118 | 3300025935 | Ga0207709_10112218 | Ga0207709_101122182 | 206 |
| 119 | 3300041999 | Ga0439433_0002476 | Ga0439433_0002476_349_987 | 206 |
| 120 | 3300042015 | Ga0439462_0014582 | Ga0439462_0014582_1122_1760 | 206 |
| 121 | 3300005289 | Ga0065704_10156099 | Ga0065704_101560992 | 207 |
| 122 | 3300005290 | Ga0065712_10072381 | Ga0065712_100723816 | 207 |
| 123 | 3300005293 | Ga0065715_10021686 | Ga0065715_100216862 | 207 |
| 124 | 3300005328 | Ga0070676_10040201 | Ga0070676_100402012 | 207 |
| 125 | 3300005330 | Ga0070690_100085737 | Ga0070690_1000857372 | 207 |
| 126 | 3300005331 | Ga0070670_100106717 | Ga0070670_1001067172 | 207 |
| 127 | 3300005340 | Ga0070689_100148828 | Ga0070689_1001488282 | 207 |
| 128 | 3300005343 | Ga0070687_100101365 | Ga0070687_1001013652 | 207 |
| 129 | 3300005345 | Ga0070692_10137478 | Ga0070692_101374782 | 207 |
| 130 | 3300005353 | Ga0070669_100010678 | Ga0070669_1000106786 | 207 |
| 131 | 3300005364 | Ga0070673_100880603 | Ga0070673_1008806032 | 207 |
| 132 | 3300005440 | Ga0070705_100373719 | Ga0070705_1003737192 | 207 |
| 133 | 3300005441 | Ga0070700_100052052 | Ga0070700_1000520523 | 207 |
| 134 | 3300005444 | Ga0070694_100032991 | Ga0070694_1000329915 | 207 |
| 135 | 3300005457 | Ga0070662_100050063 | Ga0070662_1000500634 | 207 |
| 136 | 3300005518 | Ga0070699_100193343 | Ga0070699_1001933432 | 207 |
| 137 | 3300005543 | Ga0070672_100116107 | Ga0070672_1001161072 | 207 |
| 138 | 3300005549 | Ga0070704_100007989 | Ga0070704_1000079898 | 207 |
| 139 | 3300005564 | Ga0070664_100429583 | Ga0070664_1004295831 | 207 |
| 140 | 3300005577 | Ga0068857_100022078 | Ga0068857_1000220782 | 207 |
| 141 | 3300005617 | Ga0068859_100066152 | Ga0068859_1000661522 | 207 |
| 142 | 3300005840 | Ga0068870_10058630 | Ga0068870_100586302 | 207 |
| 143 | 3300005842 | Ga0068858_100214375 | Ga0068858_1002143752 | 207 |
| 144 | 3300005843 | Ga0068860_100210438 | Ga0068860_1002104382 | 207 |
| 145 | 3300005844 | Ga0068862_100153263 | Ga0068862_1001532632 | 207 |
| 146 | 3300006844 | Ga0075428_100438939 | Ga0075428_1004389391 | 207 |
| 147 | 3300006880 | Ga0075429_100085831 | Ga0075429_1000858312 | 207 |
| 148 | 3300006931 | Ga0097620_100066152 | Ga0097620_1000661522 | 207 |
| 149 | 3300011119 | Ga0105246_10265644 | Ga0105246_102656442 | 207 |
| 150 | 3300013306 | Ga0163162_10123467 | Ga0163162_101234672 | 207 |
| 151 | 3300013308 | Ga0157375_10217294 | Ga0157375_102172942 | 207 |
| 152 | 3300014745 | Ga0157377_10185007 | Ga0157377_101850072 | 207 |
| 153 | 3300025315 | Ga0207697_10025784 | Ga0207697_100257843 | 207 |
| 154 | 3300025907 | Ga0207645_10022218 | Ga0207645_100222186 | 207 |
| 155 | 3300025908 | Ga0207643_10037151 | Ga0207643_100371514 | 207 |
| 156 | 3300025925 | Ga0207650_10015116 | Ga0207650_100151167 | 207 |
| 157 | 3300025933 | Ga0207706_10097974 | Ga0207706_100979743 | 207 |
| 158 | 3300025936 | Ga0207670_10104809 | Ga0207670_101048092 | 207 |
| 159 | 3300025940 | Ga0207691_10165578 | Ga0207691_101655782 | 207 |
| 160 | 3300025942 | Ga0207689_10161831 | Ga0207689_101618312 | 207 |
| 161 | 3300025960 | Ga0207651_10092531 | Ga0207651_100925313 | 207 |
| 162 | 3300025972 | Ga0207668_10098648 | Ga0207668_100986484 | 207 |
| 163 | 3300026035 | Ga0207703_10073161 | Ga0207703_100731612 | 207 |
| 164 | 3300026075 | Ga0207708_10179487 | Ga0207708_101794873 | 207 |
| 165 | 3300026089 | Ga0207648_10006648 | Ga0207648_100066484 | 207 |
| 166 | 3300026095 | Ga0207676_10069080 | Ga0207676_100690804 | 207 |
| 167 | 3300026095 | Ga0207676_10335715 | Ga0207676_103357152 | 207 |
| 168 | 3300026116 | Ga0207674_10020387 | Ga0207674_100203877 | 207 |
| 169 | 3300026116 | Ga0207674_10041419 | Ga0207674_100414194 | 207 |
| 170 | 3300027907 | Ga0207428_10003385 | Ga0207428_1000338512 | 207 |
| 171 | 3300028380 | Ga0268265_10001193 | Ga0268265_1000119321 | 207 |
| 172 | 3300028381 | Ga0268264_10211693 | Ga0268264_102116932 | 207 |
| 173 | 3300047318 | Ga0495636_0010870 | Ga0495636_0010870_1965_2645 | 207 |
| 174 | 3300048913 | Ga0496110_0362287 | Ga0496110_0362287_366_1040 | 207 |
| 175 | 3300048916 | Ga0496113_0224547 | Ga0496113_0224547_690_1364 | 207 |
| 176 | 3300049585 | Ga0501069_0068325 | Ga0501069_0068325_788_1453 | 207 |
| 177 | 3300005289 | Ga0065704_10076773 | Ga0065704_100767735 | 208 |
| 178 | 3300005295 | Ga0065707_10009659 | Ga0065707_100096591 | 208 |
| 179 | 3300006358 | Ga0068871_100319630 | Ga0068871_1003196302 | 208 |
| 180 | 3300006844 | Ga0075428_100041279 | Ga0075428_1000412794 | 208 |
| 181 | 3300006844 | Ga0075428_100134313 | Ga0075428_1001343135 | 208 |
| 182 | 3300009094 | Ga0111539_10524896 | Ga0111539_105248962 | 208 |
| 183 | 3300009147 | Ga0114129_10001659 | Ga0114129_1000165913 | 208 |
| 184 | 3300009147 | Ga0114129_10088636 | Ga0114129_100886361 | 208 |
| 185 | 3300025934 | Ga0207686_10409100 | Ga0207686_104091002 | 208 |
| 186 | 3300045051 | Ga0451576_0612475 | Ga0451576_0612475_219_902 | 208 |
| 187 | 3300049568 | Ga0501031_0044414 | Ga0501031_0044414_2055_2708 | 208 |
| 188 | 3300049570 | Ga0501033_0302724 | Ga0501033_0302724_154_807 | 208 |
| 189 | 3300049576 | Ga0501040_0021940 | Ga0501040_0021940_438_1091 | 208 |
| 190 | 3300049577 | Ga0501041_0104916 | Ga0501041_0104916_956_1609 | 208 |
| 191 | 3300049578 | Ga0501042_0131026 | Ga0501042_0131026_405_1058 | 208 |
| 192 | 3300049582 | Ga0501048_0127741 | Ga0501048_0127741_1015_1668 | 208 |
| 193 | 3300049583 | Ga0501067_0016453 | Ga0501067_0016453_513_1196 | 208 |
| 194 | 3300049585 | Ga0501069_0079165 | Ga0501069_0079165_1031_1714 | 208 |
| 195 | 3300049587 | Ga0501071_0041216 | Ga0501071_0041216_1950_2603 | 208 |
| 196 | 3300049588 | Ga0501072_0074399 | Ga0501072_0074399_942_1595 | 208 |
| 197 | 3300049590 | Ga0501074_0367266 | Ga0501074_0367266_61_714 | 208 |
| 198 | 3300049591 | Ga0501075_0095487 | Ga0501075_0095487_222_875 | 208 |
| 199 | 3300049592 | Ga0501076_0036695 | Ga0501076_0036695_1161_1814 | 208 |
| 200 | 3300049741 | Ga0501079_0063662 | Ga0501079_0063662_1985_2638 | 208 |
| 201 | 3300049743 | Ga0501081_0114055 | Ga0501081_0114055_586_1239 | 208 |
| 202 | 3300049824 | Ga0501045_0054252 | Ga0501045_0054252_2177_2830 | 208 |
| 203 | 3300050507 | nmdc:mga05p37_2706_c1 | nmdc:mga05p37_2706_c1_6927_7610 | 208 |
| 204 | 3300050507 | nmdc:mga05p37_36822_c1 | nmdc:mga05p37_36822_c1_1504_2187 | 208 |
| 205 | 3300050512 | nmdc:mga0n895_52001_c1 | nmdc:mga0n895_52001_c1_2176_2859 | 208 |
| 206 | 3300050515 | nmdc:mga0a205_174537_c1 | nmdc:mga0a205_174537_c1_1309_1992 | 208 |
| 207 | 3300054114 | Ga0501084_0172625 | Ga0501084_0172625_311_964 | 208 |
| 208 | 3300005341 | Ga0070691_10027912 | Ga0070691_100279122 | 209 |
| 209 | 3300005354 | Ga0070675_100090971 | Ga0070675_1000909714 | 209 |
| 210 | 3300005354 | Ga0070675_100647047 | Ga0070675_1006470472 | 209 |
| 211 | 3300005564 | Ga0070664_100314227 | Ga0070664_1003142272 | 209 |
| 212 | 3300005616 | Ga0068852_100025408 | Ga0068852_1000254083 | 209 |
| 213 | 3300005842 | Ga0068858_100160693 | Ga0068858_1001606934 | 209 |
| 214 | 3300006847 | Ga0075431_100070379 | Ga0075431_1000703796 | 209 |
| 215 | 3300009101 | Ga0105247_10185044 | Ga0105247_101850442 | 209 |
| 216 | 3300025893 | Ga0207682_10024190 | Ga0207682_100241901 | 209 |
| 217 | 3300025903 | Ga0207680_10131306 | Ga0207680_101313062 | 209 |
| 218 | 3300025926 | Ga0207659_10245267 | Ga0207659_102452672 | 209 |
| 219 | 3300025945 | Ga0207679_10587913 | Ga0207679_105879132 | 209 |
| 220 | 3300026035 | Ga0207703_10499900 | Ga0207703_104999002 | 209 |
| 221 | 3300026075 | Ga0207708_10001614 | Ga0207708_100016145 | 209 |
| 222 | 3300044712 | Ga0453684_0225246 | Ga0453684_0225246_1030_1686 | 209 |
| 223 | 3300049572 | Ga0501036_0076421 | Ga0501036_0076421_1121_1783 | 209 |
| 224 | 3300049577 | Ga0501041_0103295 | Ga0501041_0103295_152_814 | 209 |
| 225 | 3300049587 | Ga0501071_0072851 | Ga0501071_0072851_1300_1962 | 209 |
| 226 | 3300049588 | Ga0501072_0214388 | Ga0501072_0214388_787_1449 | 209 |
| 227 | 3300049591 | Ga0501075_0025191 | Ga0501075_0025191_742_1404 | 209 |
| 228 | 3300049592 | Ga0501076_0166370 | Ga0501076_0166370_1066_1728 | 209 |
| 229 | 3300049743 | Ga0501081_0056415 | Ga0501081_0056415_2020_2682 | 209 |
| 230 | 3300049822 | Ga0501035_0383642 | Ga0501035_0383642_411_1073 | 209 |
| 231 | 3300049824 | Ga0501045_0035210 | Ga0501045_0035210_1811_2473 | 209 |
| 232 | 3300050510 | nmdc:mga06r32_303381_c1 | nmdc:mga06r32_303381_c1_32_721 | 209 |
| 233 | 3300053129 | Ga0500628_002853 | Ga0500628_002853_2056_2748 | 209 |
| 234 | 3300054114 | Ga0501084_0546872 | Ga0501084_0546872_204_866 | 209 |
| 235 | 3300005467 | Ga0070706_100332109 | Ga0070706_1003321092 | 210 |
| 236 | 3300005617 | Ga0068859_101252391 | Ga0068859_1012523911 | 210 |
| 237 | 3300006931 | Ga0097620_101252399 | Ga0097620_1012523991 | 210 |
| 238 | 3300009177 | Ga0105248_10243459 | Ga0105248_102434592 | 210 |
| 239 | 3300005331 | Ga0070670_100008907 | Ga0070670_1000089075 | 211 |
| 240 | 3300005436 | Ga0070713_100020203 | Ga0070713_1000202034 | 211 |
| 241 | 3300005471 | Ga0070698_100587613 | Ga0070698_1005876132 | 211 |
| 242 | 3300005543 | Ga0070672_100317229 | Ga0070672_1003172292 | 211 |
| 243 | 3300005564 | Ga0070664_100186765 | Ga0070664_1001867652 | 211 |
| 244 | 3300005617 | Ga0068859_100337967 | Ga0068859_1003379672 | 211 |
| 245 | 3300005618 | Ga0068864_100065348 | Ga0068864_1000653482 | 211 |
| 246 | 3300005719 | Ga0068861_100170577 | Ga0068861_1001705772 | 211 |
| 247 | 3300005844 | Ga0068862_100008919 | Ga0068862_1000089199 | 211 |
| 248 | 3300006931 | Ga0097620_100337991 | Ga0097620_1003379912 | 211 |
| 249 | 3300014325 | Ga0163163_10039080 | Ga0163163_100390806 | 211 |
| 250 | 3300014325 | Ga0163163_10427095 | Ga0163163_104270952 | 211 |
| 251 | 3300025928 | Ga0207700_10003078 | Ga0207700_100030789 | 211 |
| 252 | 3300025940 | Ga0207691_10286009 | Ga0207691_102860092 | 211 |
| 253 | 3300025945 | Ga0207679_10191853 | Ga0207679_101918532 | 211 |
| 254 | 3300026095 | Ga0207676_10453804 | Ga0207676_104538042 | 211 |
| 255 | 3300026118 | Ga0207675_100177617 | Ga0207675_1001776173 | 211 |
| 256 | 3300031548 | Ga0307408_100098852 | Ga0307408_1000988523 | 211 |
| 257 | 3300031903 | Ga0307407_10312789 | Ga0307407_103127891 | 211 |
| 258 | 3300031911 | Ga0307412_10100362 | Ga0307412_101003622 | 211 |
| 259 | 3300032005 | Ga0307411_10055021 | Ga0307411_100550212 | 211 |
| 260 | 3300032126 | Ga0307415_100031272 | Ga0307415_1000312723 | 211 |
| 261 | 3300048912 | Ga0496109_0607778 | Ga0496109_0607778_58_747 | 211 |
| 262 | 3300049572 | Ga0501036_0268679 | Ga0501036_0268679_550_1203 | 211 |
| 263 | 3300049587 | Ga0501071_0155842 | Ga0501071_0155842_652_1305 | 211 |
| 264 | 3300049588 | Ga0501072_0036484 | Ga0501072_0036484_2597_3250 | 211 |
| 265 | 3300049590 | Ga0501074_0055568 | Ga0501074_0055568_2072_2725 | 211 |
| 266 | 3300049591 | Ga0501075_0134275 | Ga0501075_0134275_438_1091 | 211 |
| 267 | 3300049741 | Ga0501079_0009615 | Ga0501079_0009615_2920_3573 | 211 |
| 268 | 3300049742 | Ga0501080_0041313 | Ga0501080_0041313_2546_3199 | 211 |
| 269 | 3300049743 | Ga0501081_0027452 | Ga0501081_0027452_1186_1839 | 211 |
| 270 | 3300060353 | Ga0501082_0349904 | Ga0501082_0349904_55_708 | 211 |
| 271 | 3300061734 | Ga0530510_0183500 | Ga0530510_0183500_782_1513 | 211 |
| 272 | 3300005293 | Ga0065715_10007113 | Ga0065715_100071132 | 212 |
| 273 | 3300005295 | Ga0065707_10000834 | Ga0065707_100008346 | 212 |
| 274 | 3300005364 | Ga0070673_100188476 | Ga0070673_1001884762 | 212 |
| 275 | 3300006852 | Ga0075433_10063822 | Ga0075433_100638222 | 212 |
| 276 | 3300009147 | Ga0114129_10624963 | Ga0114129_106249632 | 212 |
| 277 | 3300009177 | Ga0105248_10162416 | Ga0105248_101624162 | 212 |
| 278 | 3300009553 | Ga0105249_10113728 | Ga0105249_101137282 | 212 |
| 279 | 3300014326 | Ga0157380_10045868 | Ga0157380_100458682 | 212 |
| 280 | 3300031911 | Ga0307412_10089590 | Ga0307412_100895903 | 212 |
| 281 | 3300032002 | Ga0307416_100354114 | Ga0307416_1003541143 | 212 |
| 282 | 3300035083 | Ga0373926_0008201 | Ga0373926_0008201_2265_2927 | 212 |
| 283 | 3300035692 | Ga0373935_0097227 | Ga0373935_0097227_980_1642 | 212 |
| 284 | 3300037068 | Ga0373925_0098098 | Ga0373925_0098098_601_1263 | 212 |
| 285 | 3300041406 | Ga0439439_0015945 | Ga0439439_0015945_1007_1669 | 212 |
| 286 | 3300041997 | Ga0439431_0021554 | Ga0439431_0021554_805_1467 | 212 |
| 287 | 3300041999 | Ga0439433_0035924 | Ga0439433_0035924_119_781 | 212 |
| 288 | 3300042156 | Ga0439446_0010643 | Ga0439446_0010643_45_707 | 212 |
| 289 | 3300049578 | Ga0501042_0243300 | Ga0501042_0243300_603_1271 | 212 |
| 290 | 3300049741 | Ga0501079_0323813 | Ga0501079_0323813_388_1056 | 212 |
| 291 | 3300050512 | nmdc:mga0n895_876676_c1 | nmdc:mga0n895_876676_c1_57_761 | 212 |
| 292 | 3300005364 | Ga0070673_100080865 | Ga0070673_1000808651 | 213 |
| 293 | 3300009147 | Ga0114129_10136172 | Ga0114129_101361723 | 213 |
| 294 | 3300025960 | Ga0207651_10981248 | Ga0207651_109812481 | 213 |
| 295 | 3300032002 | Ga0307416_101342117 | Ga0307416_1013421171 | 213 |
| 296 | 3300035119 | Ga0373956_0258449 | Ga0373956_0258449_94_783 | 213 |
| 297 | 3300041410 | Ga0439461_0037172 | Ga0439461_0037172_41_733 | 213 |
| 298 | 3300047319 | Ga0495674_0219955 | Ga0495674_0219955_208_897 | 213 |
| 299 | 3300049585 | Ga0501069_0407432 | Ga0501069_0407432_36_719 | 213 |
| 300 | 3300050507 | nmdc:mga05p37_46502_c1 | nmdc:mga05p37_46502_c1_561_1244 | 213 |
| 301 | 3300053727 | Ga0500611_009352 | Ga0500611_009352_372_1043 | 213 |
| 302 | 3300059421 | Ga0590071_004343 | Ga0590071_004343_1021_1719 | 213 |
| 303 | 3300059426 | Ga0590077_003048 | Ga0590077_003048_1176_1865 | 213 |
| 304 | 3300060353 | Ga0501082_0296378 | Ga0501082_0296378_623_1351 | 213 |
| 305 | 3300005293 | Ga0065715_10170128 | Ga0065715_101701282 | 214 |
| 306 | 3300005329 | Ga0070683_100061153 | Ga0070683_1000611535 | 214 |
| 307 | 3300005354 | Ga0070675_100060238 | Ga0070675_1000602383 | 214 |
| 308 | 3300005355 | Ga0070671_100008320 | Ga0070671_1000083202 | 214 |
| 309 | 3300005365 | Ga0070688_100021315 | Ga0070688_1000213155 | 214 |
| 310 | 3300005367 | Ga0070667_100504587 | Ga0070667_1005045872 | 214 |
| 311 | 3300005406 | Ga0070703_10038597 | Ga0070703_100385972 | 214 |
| 312 | 3300005445 | Ga0070708_100086957 | Ga0070708_1000869572 | 214 |
| 313 | 3300005468 | Ga0070707_100128713 | Ga0070707_1001287132 | 214 |
| 314 | 3300005535 | Ga0070684_100185501 | Ga0070684_1001855011 | 214 |
| 315 | 3300005536 | Ga0070697_100349017 | Ga0070697_1003490172 | 214 |
| 316 | 3300005543 | Ga0070672_100072649 | Ga0070672_1000726493 | 214 |
| 317 | 3300005545 | Ga0070695_100067396 | Ga0070695_1000673963 | 214 |
| 318 | 3300005564 | Ga0070664_100032472 | Ga0070664_1000324722 | 214 |
| 319 | 3300005577 | Ga0068857_100537833 | Ga0068857_1005378332 | 214 |
| 320 | 3300005617 | Ga0068859_100017025 | Ga0068859_1000170253 | 214 |
| 321 | 3300005618 | Ga0068864_100077251 | Ga0068864_1000772512 | 214 |
| 322 | 3300005841 | Ga0068863_100064191 | Ga0068863_1000641915 | 214 |
| 323 | 3300005842 | Ga0068858_100102307 | Ga0068858_1001023074 | 214 |
| 324 | 3300005843 | Ga0068860_100005299 | Ga0068860_1000052998 | 214 |
| 325 | 3300006042 | Ga0075368_10035739 | Ga0075368_100357393 | 214 |
| 326 | 3300006048 | Ga0075363_100011958 | Ga0075363_1000119585 | 214 |
| 327 | 3300006051 | Ga0075364_10004582 | Ga0075364_100045828 | 214 |
| 328 | 3300006051 | Ga0075364_10005737 | Ga0075364_100057375 | 214 |
| 329 | 3300006177 | Ga0075362_10000489 | Ga0075362_1000048910 | 214 |
| 330 | 3300006178 | Ga0075367_10004668 | Ga0075367_100046685 | 214 |
| 331 | 3300006195 | Ga0075366_10012749 | Ga0075366_100127492 | 214 |
| 332 | 3300006195 | Ga0075366_10316982 | Ga0075366_103169822 | 214 |
| 333 | 3300006844 | Ga0075428_100357830 | Ga0075428_1003578302 | 214 |
| 334 | 3300006852 | Ga0075433_10005701 | Ga0075433_100057019 | 214 |
| 335 | 3300006871 | Ga0075434_100002362 | Ga0075434_10000236211 | 214 |
| 336 | 3300006871 | Ga0075434_100071599 | Ga0075434_1000715993 | 214 |
| 337 | 3300006871 | Ga0075434_100379257 | Ga0075434_1003792572 | 214 |
| 338 | 3300006931 | Ga0097620_100017024 | Ga0097620_1000170243 | 214 |
| 339 | 3300009147 | Ga0114129_10016501 | Ga0114129_100165018 | 214 |
| 340 | 3300009147 | Ga0114129_10042294 | Ga0114129_100422948 | 214 |
| 341 | 3300009147 | Ga0114129_10175158 | Ga0114129_101751582 | 214 |
| 342 | 3300013296 | Ga0157374_10203209 | Ga0157374_102032092 | 214 |
| 343 | 3300013308 | Ga0157375_10327160 | Ga0157375_103271602 | 214 |
| 344 | 3300013308 | Ga0157375_10362523 | Ga0157375_103625233 | 214 |
| 345 | 3300014745 | Ga0157377_10113955 | Ga0157377_101139552 | 214 |
| 346 | 3300025918 | Ga0207662_10047418 | Ga0207662_100474184 | 214 |
| 347 | 3300025922 | Ga0207646_10111714 | Ga0207646_101117142 | 214 |
| 348 | 3300025922 | Ga0207646_10548415 | Ga0207646_105484152 | 214 |
| 349 | 3300025926 | Ga0207659_10001465 | Ga0207659_100014659 | 214 |
| 350 | 3300025926 | Ga0207659_10112199 | Ga0207659_101121994 | 214 |
| 351 | 3300025931 | Ga0207644_10081315 | Ga0207644_100813154 | 214 |
| 352 | 3300025940 | Ga0207691_10312122 | Ga0207691_103121222 | 214 |
| 353 | 3300025941 | Ga0207711_10127745 | Ga0207711_101277451 | 214 |
| 354 | 3300025944 | Ga0207661_10019055 | Ga0207661_100190554 | 214 |
| 355 | 3300025945 | Ga0207679_10228111 | Ga0207679_102281112 | 214 |
| 356 | 3300025945 | Ga0207679_10468762 | Ga0207679_104687622 | 214 |
| 357 | 3300025960 | Ga0207651_10666177 | Ga0207651_106661772 | 214 |
| 358 | 3300025986 | Ga0207658_10061167 | Ga0207658_100611673 | 214 |
| 359 | 3300025986 | Ga0207658_10638681 | Ga0207658_106386812 | 214 |
| 360 | 3300026035 | Ga0207703_10081417 | Ga0207703_100814174 | 214 |
| 361 | 3300026075 | Ga0207708_10091600 | Ga0207708_100916004 | 214 |
| 362 | 3300026088 | Ga0207641_10196513 | Ga0207641_101965132 | 214 |
| 363 | 3300026088 | Ga0207641_10261749 | Ga0207641_102617492 | 214 |
| 364 | 3300026095 | Ga0207676_10445870 | Ga0207676_104458702 | 214 |
| 365 | 3300026116 | Ga0207674_10256462 | Ga0207674_102564622 | 214 |
| 366 | 3300026121 | Ga0207683_10614497 | Ga0207683_106144972 | 214 |
| 367 | 3300027866 | Ga0209813_10045523 | Ga0209813_100455231 | 214 |
| 368 | 3300028381 | Ga0268264_10007214 | Ga0268264_100072148 | 214 |
| 369 | 3300031995 | Ga0307409_100107264 | Ga0307409_1001072642 | 214 |
| 370 | 3300036401 | Ga0373937_0619256 | Ga0373937_0619256_153_821 | 214 |
| 371 | 3300042876 | Ga0451577_0514545 | Ga0451577_0514545_180_863 | 214 |
| 372 | 3300045051 | Ga0451576_0012634 | Ga0451576_0012634_8366_9049 | 214 |
| 373 | 3300045051 | Ga0451576_0083199 | Ga0451576_0083199_1544_2227 | 214 |
| 374 | 3300046528 | Ga0495642_0119794 | Ga0495642_0119794_180_863 | 214 |
| 375 | 3300046539 | Ga0495621_0067629 | Ga0495621_0067629_297_980 | 214 |
| 376 | 3300046664 | Ga0495659_0012673 | Ga0495659_0012673_1688_2371 | 214 |
| 377 | 3300048907 | Ga0496104_0331563 | Ga0496104_0331563_642_1310 | 214 |
| 378 | 3300048908 | Ga0496105_0385158 | Ga0496105_0385158_108_776 | 214 |
| 379 | 3300050489 | nmdc:mga03683_3561_c1 | nmdc:mga03683_3561_c1_1117_1830 | 214 |
| 380 | 3300050490 | nmdc:mga03n38_17500_c1 | nmdc:mga03n38_17500_c1_718_1431 | 214 |
| 381 | 3300050491 | nmdc:mga00v17_28425_c1 | nmdc:mga00v17_28425_c1_2170_2883 | 214 |
| 382 | 3300050491 | nmdc:mga00v17_3738_c2 | nmdc:mga00v17_3738_c2_1940_2653 | 214 |
| 383 | 3300050492 | nmdc:mga0yw44_58199_c1 | nmdc:mga0yw44_58199_c1_598_1311 | 214 |
| 384 | 3300050493 | nmdc:mga0k408_168526_c1 | nmdc:mga0k408_168526_c1_537_1226 | 214 |
| 385 | 3300050493 | nmdc:mga0k408_7377_c1 | nmdc:mga0k408_7377_c1_4189_4902 | 214 |
| 386 | 3300050493 | nmdc:mga0k408_8269_c1 | nmdc:mga0k408_8269_c1_550_1263 | 214 |
| 387 | 3300050494 | nmdc:mga06z11_54799_c1 | nmdc:mga06z11_54799_c1_597_1310 | 214 |
| 388 | 3300050495 | nmdc:mga04h51_29463_c1 | nmdc:mga04h51_29463_c1_352_1065 | 214 |
| 389 | 3300050495 | nmdc:mga04h51_84404_c1 | nmdc:mga04h51_84404_c1_223_936 | 214 |
| 390 | 3300050507 | nmdc:mga05p37_10687_c1 | nmdc:mga05p37_10687_c1_5647_6327 | 214 |
| 391 | 3300050507 | nmdc:mga05p37_133190_c1 | nmdc:mga05p37_133190_c1_1206_1889 | 214 |
| 392 | 3300050507 | nmdc:mga05p37_133663_c1 | nmdc:mga05p37_133663_c1_1188_1904 | 214 |
| 393 | 3300050508 | nmdc:mga09592_242321_c1 | nmdc:mga09592_242321_c1_638_1354 | 214 |
| 394 | 3300050509 | nmdc:mga0qj67_303671_c1 | nmdc:mga0qj67_303671_c1_490_1170 | 214 |
| 395 | 3300050509 | nmdc:mga0qj67_442619_c1 | nmdc:mga0qj67_442619_c1_123_794 | 214 |
| 396 | 3300050512 | nmdc:mga0n895_42495_c1 | nmdc:mga0n895_42495_c1_2452_3135 | 214 |
| 397 | 3300050513 | nmdc:mga0rr50_154058_c1 | nmdc:mga0rr50_154058_c1_46_729 | 214 |
| 398 | 3300050513 | nmdc:mga0rr50_97954_c1 | nmdc:mga0rr50_97954_c1_140_823 | 214 |
| 399 | 3300050515 | nmdc:mga0a205_207632_c1 | nmdc:mga0a205_207632_c1_626_1309 | 214 |
| 400 | 3300005328 | Ga0070676_10031080 | Ga0070676_100310802 | 215 |
| 401 | 3300005331 | Ga0070670_100048171 | Ga0070670_1000481714 | 215 |
| 402 | 3300005337 | Ga0070682_100497450 | Ga0070682_1004974502 | 215 |
| 403 | 3300005338 | Ga0068868_100123488 | Ga0068868_1001234883 | 215 |
| 404 | 3300005354 | Ga0070675_100748951 | Ga0070675_1007489511 | 215 |
| 405 | 3300005367 | Ga0070667_100071791 | Ga0070667_1000717913 | 215 |
| 406 | 3300005444 | Ga0070694_100541154 | Ga0070694_1005411541 | 215 |
| 407 | 3300005457 | Ga0070662_100102819 | Ga0070662_1001028193 | 215 |
| 408 | 3300005535 | Ga0070684_100231299 | Ga0070684_1002312993 | 215 |
| 409 | 3300005548 | Ga0070665_100136824 | Ga0070665_1001368244 | 215 |
| 410 | 3300005841 | Ga0068863_100350914 | Ga0068863_1003509142 | 215 |
| 411 | 3300005843 | Ga0068860_100267790 | Ga0068860_1002677903 | 215 |
| 412 | 3300006237 | Ga0097621_100098805 | Ga0097621_1000988052 | 215 |
| 413 | 3300006847 | Ga0075431_100272389 | Ga0075431_1002723892 | 215 |
| 414 | 3300009093 | Ga0105240_10552325 | Ga0105240_105523252 | 215 |
| 415 | 3300009174 | Ga0105241_10054310 | Ga0105241_100543103 | 215 |
| 416 | 3300009177 | Ga0105248_10455003 | Ga0105248_104550033 | 215 |
| 417 | 3300009553 | Ga0105249_10083147 | Ga0105249_100831474 | 215 |
| 418 | 3300013296 | Ga0157374_10059231 | Ga0157374_100592313 | 215 |
| 419 | 3300013306 | Ga0163162_10740975 | Ga0163162_107409751 | 215 |
| 420 | 3300013308 | Ga0157375_10215124 | Ga0157375_102151241 | 215 |
| 421 | 3300014969 | Ga0157376_10060414 | Ga0157376_100604144 | 215 |
| 422 | 3300017792 | Ga0163161_10011304 | Ga0163161_100113047 | 215 |
| 423 | 3300021384 | Ga0213876_10178340 | Ga0213876_101783402 | 215 |
| 424 | 3300025893 | Ga0207682_10085036 | Ga0207682_100850361 | 215 |
| 425 | 3300025899 | Ga0207642_10014612 | Ga0207642_100146123 | 215 |
| 426 | 3300025907 | Ga0207645_10047629 | Ga0207645_100476292 | 215 |
| 427 | 3300025913 | Ga0207695_10451286 | Ga0207695_104512861 | 215 |
| 428 | 3300025925 | Ga0207650_10052334 | Ga0207650_100523342 | 215 |
| 429 | 3300025925 | Ga0207650_10712219 | Ga0207650_107122192 | 215 |
| 430 | 3300025937 | Ga0207669_10079899 | Ga0207669_100798993 | 215 |
| 431 | 3300025938 | Ga0207704_10216504 | Ga0207704_102165041 | 215 |
| 432 | 3300025940 | Ga0207691_10368910 | Ga0207691_103689102 | 215 |
| 433 | 3300025941 | Ga0207711_10258098 | Ga0207711_102580982 | 215 |
| 434 | 3300025986 | Ga0207658_10277894 | Ga0207658_102778943 | 215 |
| 435 | 3300026023 | Ga0207677_10267757 | Ga0207677_102677572 | 215 |
| 436 | 3300026089 | Ga0207648_10357299 | Ga0207648_103572992 | 215 |
| 437 | 3300026121 | Ga0207683_10173179 | Ga0207683_101731793 | 215 |
| 438 | 3300026142 | Ga0207698_10957252 | Ga0207698_109572521 | 215 |
| 439 | 3300028379 | Ga0268266_10022055 | Ga0268266_100220553 | 215 |
| 440 | 3300028381 | Ga0268264_10766612 | Ga0268264_107666121 | 215 |
| 441 | 3300031548 | Ga0307408_100166711 | Ga0307408_1001667111 | 215 |
| 442 | 3300032002 | Ga0307416_100253705 | Ga0307416_1002537052 | 215 |
| 443 | 3300032002 | Ga0307416_101266020 | Ga0307416_1012660201 | 215 |
| 444 | 3300032126 | Ga0307415_100379989 | Ga0307415_1003799892 | 215 |
| 445 | 3300035172 | Ga0373955_0018405 | Ga0373955_0018405_2684_3403 | 215 |
| 446 | 3300037068 | Ga0373925_0524712 | Ga0373925_0524712_150_869 | 215 |
| 447 | 3300039437 | Ga0436365_0372794 | Ga0436365_0372794_213_884 | 215 |
| 448 | 3300041999 | Ga0439433_0005225 | Ga0439433_0005225_517_1221 | 215 |
| 449 | 3300042007 | Ga0439449_0053609 | Ga0439449_0053609_262_966 | 215 |
| 450 | 3300042156 | Ga0439446_0012217 | Ga0439446_0012217_1015_1719 | 215 |
| 451 | 3300042435 | Ga0439434_0055597 | Ga0439434_0055597_93_797 | 215 |
| 452 | 3300046459 | Ga0495629_0010127 | Ga0495629_0010127_976_1668 | 215 |
| 453 | 3300046499 | Ga0495594_0020424 | Ga0495594_0020424_1454_2146 | 215 |
| 454 | 3300046809 | Ga0495600_0106179 | Ga0495600_0106179_640_1359 | 215 |
| 455 | 3300047321 | Ga0495676_0062131 | Ga0495676_0062131_446_1138 | 215 |
| 456 | 3300047471 | Ga0495684_0315783 | Ga0495684_0315783_333_1052 | 215 |
| 457 | 3300048903 | Ga0496100_0037095 | Ga0496100_0037095_265_984 | 215 |
| 458 | 3300048907 | Ga0496104_0016740 | Ga0496104_0016740_4948_5667 | 215 |
| 459 | 3300048907 | Ga0496104_0781236 | Ga0496104_0781236_105_824 | 215 |
| 460 | 3300048908 | Ga0496105_0062768 | Ga0496105_0062768_2012_2731 | 215 |
| 461 | 3300048910 | Ga0496107_0112817 | Ga0496107_0112817_230_949 | 215 |
| 462 | 3300048911 | Ga0496108_0017856 | Ga0496108_0017856_3641_4360 | 215 |
| 463 | 3300048917 | Ga0496114_0001396 | Ga0496114_0001396_1088_1807 | 215 |
| 464 | 3300049572 | Ga0501036_0042355 | Ga0501036_0042355_398_1108 | 215 |
| 465 | 3300049574 | Ga0501038_0095757 | Ga0501038_0095757_1214_1924 | 215 |
| 466 | 3300049575 | Ga0501039_0086708 | Ga0501039_0086708_1187_1897 | 215 |
| 467 | 3300049578 | Ga0501042_0015915 | Ga0501042_0015915_1995_2705 | 215 |
| 468 | 3300049579 | Ga0501043_0365133 | Ga0501043_0365133_274_984 | 215 |
| 469 | 3300049580 | Ga0501046_0087843 | Ga0501046_0087843_939_1649 | 215 |
| 470 | 3300049582 | Ga0501048_0034807 | Ga0501048_0034807_17_727 | 215 |
| 471 | 3300049587 | Ga0501071_0252052 | Ga0501071_0252052_516_1226 | 215 |
| 472 | 3300049588 | Ga0501072_0009895 | Ga0501072_0009895_4111_4821 | 215 |
| 473 | 3300049591 | Ga0501075_0001534 | Ga0501075_0001534_7133_7843 | 215 |
| 474 | 3300049592 | Ga0501076_0113450 | Ga0501076_0113450_1412_2122 | 215 |
| 475 | 3300049593 | Ga0501077_0125764 | Ga0501077_0125764_411_1121 | 215 |
| 476 | 3300049741 | Ga0501079_0045180 | Ga0501079_0045180_1578_2288 | 215 |
| 477 | 3300049742 | Ga0501080_0197373 | Ga0501080_0197373_1013_1723 | 215 |
| 478 | 3300049824 | Ga0501045_0180592 | Ga0501045_0180592_200_910 | 215 |
| 479 | 3300053077 | Ga0495601_0016468 | Ga0495601_0016468_309_1028 | 215 |
| 480 | 3300053085 | Ga0495619_0051407 | Ga0495619_0051407_917_1636 | 215 |
| 481 | 3300054114 | Ga0501084_0301493 | Ga0501084_0301493_582_1292 | 215 |
| 482 | 3300059421 | Ga0590071_000282 | Ga0590071_000282_11553_12224 | 215 |
| 483 | 3300059423 | Ga0590074_007341 | Ga0590074_007341_633_1304 | 215 |
| 484 | 3300059426 | Ga0590077_000238 | Ga0590077_000238_7192_7863 | 215 |
| 485 | 3300061734 | Ga0530510_0001988 | Ga0530510_0001988_7649_8359 | 215 |
| 486 | 3300005333 | Ga0070677_10055162 | Ga0070677_100551622 | 216 |
| 487 | 3300005339 | Ga0070660_100115994 | Ga0070660_1001159942 | 216 |
| 488 | 3300005344 | Ga0070661_100176475 | Ga0070661_1001764752 | 216 |
| 489 | 3300005353 | Ga0070669_100236358 | Ga0070669_1002363582 | 216 |
| 490 | 3300005356 | Ga0070674_100038383 | Ga0070674_1000383835 | 216 |
| 491 | 3300005366 | Ga0070659_100443326 | Ga0070659_1004433262 | 216 |
| 492 | 3300005563 | Ga0068855_100058478 | Ga0068855_1000584785 | 216 |
| 493 | 3300005564 | Ga0070664_100221792 | Ga0070664_1002217922 | 216 |
| 494 | 3300005616 | Ga0068852_100098602 | Ga0068852_1000986021 | 216 |
| 495 | 3300006844 | Ga0075428_100038342 | Ga0075428_1000383427 | 216 |
| 496 | 3300006844 | Ga0075428_100331368 | Ga0075428_1003313683 | 216 |
| 497 | 3300006846 | Ga0075430_100008531 | Ga0075430_1000085318 | 216 |
| 498 | 3300006846 | Ga0075430_100231481 | Ga0075430_1002314811 | 216 |
| 499 | 3300006847 | Ga0075431_100231316 | Ga0075431_1002313162 | 216 |
| 500 | 3300006880 | Ga0075429_100032450 | Ga0075429_1000324504 | 216 |
| 501 | 3300009093 | Ga0105240_10213803 | Ga0105240_102138032 | 216 |
| 502 | 3300009147 | Ga0114129_10007226 | Ga0114129_1000722611 | 216 |
| 503 | 3300013105 | Ga0157369_10084492 | Ga0157369_100844925 | 216 |
| 504 | 3300013307 | Ga0157372_10151914 | Ga0157372_101519144 | 216 |
| 505 | 3300025920 | Ga0207649_10135714 | Ga0207649_101357142 | 216 |
| 506 | 3300025937 | Ga0207669_10040227 | Ga0207669_100402273 | 216 |
| 507 | 3300025944 | Ga0207661_10226598 | Ga0207661_102265982 | 216 |
| 508 | 3300025945 | Ga0207679_10158951 | Ga0207679_101589512 | 216 |
| 509 | 3300025949 | Ga0207667_10106183 | Ga0207667_101061832 | 216 |
| 510 | 3300026142 | Ga0207698_10119787 | Ga0207698_101197873 | 216 |
| 511 | 3300037418 | Ga0395900_0543035 | Ga0395900_0543035_177_887 | 216 |
| 512 | 3300037471 | Ga0395905_0626219 | Ga0395905_0626219_164_862 | 216 |
| 513 | 3300042435 | Ga0439434_0055486 | Ga0439434_0055486_25_705 | 216 |
| 514 | 3300045976 | Ga0466967_0200247 | Ga0466967_0200247_43_741 | 216 |
| 515 | 3300049571 | Ga0501034_0113457 | Ga0501034_0113457_510_1208 | 216 |
| 516 | 3300049593 | Ga0501077_0075813 | Ga0501077_0075813_838_1527 | 216 |
| 517 | 3300049744 | Ga0501083_0133136 | Ga0501083_0133136_731_1429 | 216 |
| 518 | 3300050507 | nmdc:mga05p37_10546_c1 | nmdc:mga05p37_10546_c1_9511_10188 | 216 |
| 519 | 3300050508 | nmdc:mga09592_55254_c1 | nmdc:mga09592_55254_c1_787_1464 | 216 |
| 520 | 3300050509 | nmdc:mga0qj67_655915_c1 | nmdc:mga0qj67_655915_c1_93_785 | 216 |
| 521 | 3300050510 | nmdc:mga06r32_109267_c1 | nmdc:mga06r32_109267_c1_621_1301 | 216 |
| 522 | 3300050510 | nmdc:mga06r32_877273_c1 | nmdc:mga06r32_877273_c1_149_826 | 216 |
| 523 | 3300005290 | Ga0065712_10068599 | Ga0065712_100685999 | 217 |
| 524 | 3300005329 | Ga0070683_100000326 | Ga0070683_10000032613 | 217 |
| 525 | 3300005331 | Ga0070670_100025013 | Ga0070670_1000250136 | 217 |
| 526 | 3300005344 | Ga0070661_100022313 | Ga0070661_1000223136 | 217 |
| 527 | 3300005354 | Ga0070675_100413278 | Ga0070675_1004132781 | 217 |
| 528 | 3300005355 | Ga0070671_100006550 | Ga0070671_1000065508 | 217 |
| 529 | 3300005367 | Ga0070667_100113453 | Ga0070667_1001134532 | 217 |
| 530 | 3300005455 | Ga0070663_100009370 | Ga0070663_1000093709 | 217 |
| 531 | 3300005457 | Ga0070662_100151431 | Ga0070662_1001514312 | 217 |
| 532 | 3300005466 | Ga0070685_10358124 | Ga0070685_103581242 | 217 |
| 533 | 3300005535 | Ga0070684_100000168 | Ga0070684_10000016825 | 217 |
| 534 | 3300005564 | Ga0070664_100001248 | Ga0070664_1000012485 | 217 |
| 535 | 3300005844 | Ga0068862_100532011 | Ga0068862_1005320112 | 217 |
| 536 | 3300006852 | Ga0075433_10339416 | Ga0075433_103394162 | 217 |
| 537 | 3300009094 | Ga0111539_10481753 | Ga0111539_104817532 | 217 |
| 538 | 3300009177 | Ga0105248_10116361 | Ga0105248_101163612 | 217 |
| 539 | 3300013296 | Ga0157374_10227404 | Ga0157374_102274043 | 217 |
| 540 | 3300014325 | Ga0163163_10028350 | Ga0163163_100283502 | 217 |
| 541 | 3300014968 | Ga0157379_10322929 | Ga0157379_103229292 | 217 |
| 542 | 3300025920 | Ga0207649_10154268 | Ga0207649_101542682 | 217 |
| 543 | 3300025925 | Ga0207650_10053839 | Ga0207650_100538394 | 217 |
| 544 | 3300025933 | Ga0207706_10077823 | Ga0207706_100778234 | 217 |
| 545 | 3300025941 | Ga0207711_10262024 | Ga0207711_102620243 | 217 |
| 546 | 3300025944 | Ga0207661_10004405 | Ga0207661_100044055 | 217 |
| 547 | 3300025945 | Ga0207679_10005466 | Ga0207679_1000546610 | 217 |
| 548 | 3300025986 | Ga0207658_10172252 | Ga0207658_101722522 | 217 |
| 549 | 3300026067 | Ga0207678_10198326 | Ga0207678_101983262 | 217 |
| 550 | 3300027552 | Ga0209982_1005767 | Ga0209982_10057672 | 217 |
| 551 | 3300031548 | Ga0307408_100147281 | Ga0307408_1001472812 | 217 |
| 552 | 3300032002 | Ga0307416_100167528 | Ga0307416_1001675282 | 217 |
| 553 | 3300042437 | Ga0439444_0015903 | Ga0439444_0015903_222_953 | 217 |
| 554 | 3300042439 | Ga0439464_0080509 | Ga0439464_0080509_199_930 | 217 |
| 555 | 3300042993 | Ga0439440_0030529 | Ga0439440_0030529_367_1044 | 217 |
| 556 | 3300048907 | Ga0496104_0001797 | Ga0496104_0001797_2131_2838 | 217 |
| 557 | 3300048908 | Ga0496105_0119830 | Ga0496105_0119830_440_1147 | 217 |
| 558 | 3300048911 | Ga0496108_0004028 | Ga0496108_0004028_3650_4357 | 217 |
| 559 | 3300048912 | Ga0496109_0001846 | Ga0496109_0001846_7722_8429 | 217 |
| 560 | 3300048913 | Ga0496110_0339458 | Ga0496110_0339458_501_1208 | 217 |
| 561 | 3300048914 | Ga0496111_0019021 | Ga0496111_0019021_854_1561 | 217 |
| 562 | 3300048915 | Ga0496112_0012297 | Ga0496112_0012297_1710_2417 | 217 |
| 563 | 3300048916 | Ga0496113_0207885 | Ga0496113_0207885_497_1204 | 217 |
| 564 | 3300049568 | Ga0501031_0156411 | Ga0501031_0156411_259_945 | 217 |
| 565 | 3300049572 | Ga0501036_0061654 | Ga0501036_0061654_45_731 | 217 |
| 566 | 3300049587 | Ga0501071_0004355 | Ga0501071_0004355_4799_5503 | 217 |
| 567 | 3300049588 | Ga0501072_0093286 | Ga0501072_0093286_1327_2007 | 217 |
| 568 | 3300049590 | Ga0501074_0213864 | Ga0501074_0213864_175_855 | 217 |
| 569 | 3300049591 | Ga0501075_0024470 | Ga0501075_0024470_1053_1733 | 217 |
| 570 | 3300049743 | Ga0501081_0051693 | Ga0501081_0051693_1727_2407 | 217 |
| 571 | 3300050510 | nmdc:mga06r32_479225_c1 | nmdc:mga06r32_479225_c1_407_1090 | 217 |
| 572 | 3300050515 | nmdc:mga0a205_107877_c1 | nmdc:mga0a205_107877_c1_321_1016 | 217 |
| 573 | 3300050515 | nmdc:mga0a205_327463_c1 | nmdc:mga0a205_327463_c1_240_935 | 217 |
| 574 | 3300005329 | Ga0070683_100002445 | Ga0070683_10000244511 | 218 |
| 575 | 3300005535 | Ga0070684_100129898 | Ga0070684_1001298982 | 218 |
| 576 | 3300005564 | Ga0070664_100363153 | Ga0070664_1003631532 | 218 |
| 577 | 3300005844 | Ga0068862_100576982 | Ga0068862_1005769822 | 218 |
| 578 | 3300006042 | Ga0075368_10025260 | Ga0075368_100252603 | 218 |
| 579 | 3300006195 | Ga0075366_10126822 | Ga0075366_101268222 | 218 |
| 580 | 3300006847 | Ga0075431_100008733 | Ga0075431_1000087336 | 218 |
| 581 | 3300009147 | Ga0114129_10011087 | Ga0114129_100110879 | 218 |
| 582 | 3300025944 | Ga0207661_10001481 | Ga0207661_100014818 | 218 |
| 583 | 3300042436 | Ga0439435_0065639 | Ga0439435_0065639_75_779 | 218 |
| 584 | 3300048903 | Ga0496100_0079241 | Ga0496100_0079241_652_1356 | 218 |
| 585 | 3300048904 | Ga0496101_0058339 | Ga0496101_0058339_1343_2047 | 218 |
| 586 | 3300048912 | Ga0496109_0287186 | Ga0496109_0287186_61_765 | 218 |
| 587 | 3300049572 | Ga0501036_0086664 | Ga0501036_0086664_1464_2168 | 218 |
| 588 | 3300049575 | Ga0501039_0061114 | Ga0501039_0061114_1695_2399 | 218 |
| 589 | 3300049575 | Ga0501039_0262851 | Ga0501039_0262851_513_1217 | 218 |
| 590 | 3300049576 | Ga0501040_0066727 | Ga0501040_0066727_1659_2363 | 218 |
| 591 | 3300049577 | Ga0501041_0046095 | Ga0501041_0046095_82_786 | 218 |
| 592 | 3300049577 | Ga0501041_0264681 | Ga0501041_0264681_345_1049 | 218 |
| 593 | 3300049578 | Ga0501042_0252830 | Ga0501042_0252830_221_925 | 218 |
| 594 | 3300049580 | Ga0501046_0303974 | Ga0501046_0303974_11_715 | 218 |
| 595 | 3300049582 | Ga0501048_0042593 | Ga0501048_0042593_2302_3006 | 218 |
| 596 | 3300049587 | Ga0501071_0210629 | Ga0501071_0210629_598_1302 | 218 |
| 597 | 3300049588 | Ga0501072_0057194 | Ga0501072_0057194_50_754 | 218 |
| 598 | 3300049588 | Ga0501072_0135272 | Ga0501072_0135272_302_1006 | 218 |
| 599 | 3300049589 | Ga0501073_0095153 | Ga0501073_0095153_1144_1851 | 218 |
| 600 | 3300049591 | Ga0501075_0098892 | Ga0501075_0098892_1266_1970 | 218 |
| 601 | 3300049591 | Ga0501075_0194268 | Ga0501075_0194268_758_1501 | 218 |
| 602 | 3300049591 | Ga0501075_0411045 | Ga0501075_0411045_81_764 | 218 |
| 603 | 3300049591 | Ga0501075_0425911 | Ga0501075_0425911_35_742 | 218 |
| 604 | 3300049592 | Ga0501076_0044318 | Ga0501076_0044318_1955_2659 | 218 |
| 605 | 3300049592 | Ga0501076_0099060 | Ga0501076_0099060_1289_1993 | 218 |
| 606 | 3300049593 | Ga0501077_0056570 | Ga0501077_0056570_1026_1727 | 218 |
| 607 | 3300049593 | Ga0501077_0177884 | Ga0501077_0177884_287_994 | 218 |
| 608 | 3300049741 | Ga0501079_0061582 | Ga0501079_0061582_40_744 | 218 |
| 609 | 3300049743 | Ga0501081_0199976 | Ga0501081_0199976_308_1021 | 218 |
| 610 | 3300049822 | Ga0501035_0161684 | Ga0501035_0161684_1194_1898 | 218 |
| 611 | 3300049824 | Ga0501045_0147967 | Ga0501045_0147967_814_1518 | 218 |
| 612 | 3300049824 | Ga0501045_0632996 | Ga0501045_0632996_30_731 | 218 |
| 613 | 3300050493 | nmdc:mga0k408_117395_c1 | nmdc:mga0k408_117395_c1_419_1117 | 218 |
| 614 | 3300050495 | nmdc:mga04h51_15230_c1 | nmdc:mga04h51_15230_c1_457_1155 | 218 |
| 615 | 3300050507 | nmdc:mga05p37_93925_c1 | nmdc:mga05p37_93925_c1_1600_2301 | 218 |
| 616 | 3300054114 | Ga0501084_0209160 | Ga0501084_0209160_862_1566 | 218 |
| 617 | 3300054114 | Ga0501084_0823297 | Ga0501084_0823297_61_762 | 218 |
| 618 | 3300060353 | Ga0501082_0020583 | Ga0501082_0020583_4866_5570 | 218 |
| 619 | 3300060353 | Ga0501082_0076373 | Ga0501082_0076373_1247_1954 | 218 |
| 620 | 3300060353 | Ga0501082_0302428 | Ga0501082_0302428_168_872 | 218 |
| 621 | 3300005293 | Ga0065715_10277478 | Ga0065715_102774781 | 219 |
| 622 | 3300005356 | Ga0070674_100076131 | Ga0070674_1000761311 | 219 |
| 623 | 3300005456 | Ga0070678_100129312 | Ga0070678_1001293122 | 219 |
| 624 | 3300006237 | Ga0097621_100410810 | Ga0097621_1004108102 | 219 |
| 625 | 3300014326 | Ga0157380_10178911 | Ga0157380_101789112 | 219 |
| 626 | 3300025937 | Ga0207669_10254247 | Ga0207669_102542472 | 219 |
| 627 | 3300026121 | Ga0207683_10121950 | Ga0207683_101219502 | 219 |
| 628 | 3300031731 | Ga0307405_10396988 | Ga0307405_103969882 | 219 |
| 629 | 3300031824 | Ga0307413_10047599 | Ga0307413_100475993 | 219 |
| 630 | 3300031852 | Ga0307410_10134643 | Ga0307410_101346432 | 219 |
| 631 | 3300031903 | Ga0307407_10075768 | Ga0307407_100757681 | 219 |
| 632 | 3300032002 | Ga0307416_100047586 | Ga0307416_1000475863 | 219 |
| 633 | 3300041408 | Ga0439453_0022440 | Ga0439453_0022440_60_794 | 219 |
| 634 | 3300042122 | Ga0450920_009630 | Ga0450920_009630_841_1575 | 219 |
| 635 | 3300042125 | Ga0450923_004427 | Ga0450923_004427_646_1380 | 219 |
| 636 | 3300042135 | Ga0450899_010690 | Ga0450899_010690_148_882 | 219 |
| 637 | 3300042531 | Ga0450918_003731 | Ga0450918_003731_1043_1777 | 219 |
| 638 | 3300059424 | Ga0590075_006983 | Ga0590075_006983_790_1518 | 219 |
| 639 | 3300032005 | Ga0307411_10182057 | Ga0307411_101820572 | 220 |
| 640 | 3300050512 | nmdc:mga0n895_63479_c1 | nmdc:mga0n895_63479_c1_1461_2174 | 221 |
| 641 | 2162886012 | MBSR1b_contig_822942 | MBSR1b_0948.00003350 | 227 |
| 642 | 3300005456 | Ga0070678_100652120 | Ga0070678_1006521201 | 227 |
| 643 | 3300005457 | Ga0070662_100232970 | Ga0070662_1002329702 | 227 |
| 644 | 3300006844 | Ga0075428_100017106 | Ga0075428_1000171066 | 227 |
| 645 | 3300006844 | Ga0075428_100112653 | Ga0075428_1001126533 | 227 |
| 646 | 3300006846 | Ga0075430_100012219 | Ga0075430_1000122196 | 227 |
| 647 | 3300006847 | Ga0075431_100004362 | Ga0075431_1000043626 | 227 |
| 648 | 3300006847 | Ga0075431_100019271 | Ga0075431_1000192714 | 227 |
| 649 | 3300006880 | Ga0075429_100004407 | Ga0075429_1000044076 | 227 |
| 650 | 3300009094 | Ga0111539_10023936 | Ga0111539_100239366 | 227 |
| 651 | 3300009094 | Ga0111539_10071906 | Ga0111539_100719064 | 227 |
| 652 | 3300009094 | Ga0111539_10669522 | Ga0111539_106695221 | 227 |
| 653 | 3300009147 | Ga0114129_10000288 | Ga0114129_100002886 | 227 |
| 654 | 3300009147 | Ga0114129_10041543 | Ga0114129_100415436 | 227 |
| 655 | 3300025315 | Ga0207697_10046210 | Ga0207697_100462102 | 227 |
| 656 | 3300025933 | Ga0207706_10136039 | Ga0207706_101360392 | 227 |
| 657 | 3300027907 | Ga0207428_10001421 | Ga0207428_1000142111 | 227 |
| 658 | 3300031548 | Ga0307408_100012418 | Ga0307408_1000124186 | 227 |
| 659 | 3300031548 | Ga0307408_100077537 | Ga0307408_1000775373 | 227 |
| 660 | 3300031548 | Ga0307408_100152577 | Ga0307408_1001525772 | 227 |
| 661 | 3300031731 | Ga0307405_10035559 | Ga0307405_100355593 | 227 |
| 662 | 3300031852 | Ga0307410_10270470 | Ga0307410_102704702 | 227 |
| 663 | 3300031901 | Ga0307406_10093469 | Ga0307406_100934693 | 227 |
| 664 | 3300031911 | Ga0307412_10115053 | Ga0307412_101150532 | 227 |
| 665 | 3300031995 | Ga0307409_100354227 | Ga0307409_1003542271 | 227 |
| 666 | 3300032002 | Ga0307416_100005976 | Ga0307416_1000059766 | 227 |
| 667 | 3300032002 | Ga0307416_100045600 | Ga0307416_1000456002 | 227 |
| 668 | 3300032005 | Ga0307411_10067051 | Ga0307411_100670512 | 227 |
| 669 | 3300032005 | Ga0307411_10227502 | Ga0307411_102275022 | 227 |
| 670 | 3300032005 | Ga0307411_10476153 | Ga0307411_104761531 | 227 |
| 671 | 3300042008 | Ga0439450_000213 | Ga0439450_000213_1913_2596 | 227 |
| 672 | 3300042461 | Ga0439460_0085975 | Ga0439460_0085975_88_771 | 227 |
| 673 | 3300050507 | nmdc:mga05p37_89795_c1 | nmdc:mga05p37_89795_c1_2079_2762 | 227 |
| 674 | 3300050509 | nmdc:mga0qj67_1191_c1 | nmdc:mga0qj67_1191_c1_230_913 | 227 |
| 675 | 3300050509 | nmdc:mga0qj67_69070_c1 | nmdc:mga0qj67_69070_c1_38_721 | 227 |
| 676 | 3300050510 | nmdc:mga06r32_19697_c1 | nmdc:mga06r32_19697_c1_2996_3679 | 227 |
| 677 | 3300050510 | nmdc:mga06r32_21085_c1 | nmdc:mga06r32_21085_c1_2152_2835 | 227 |
| 678 | 3300050511 | nmdc:mga08y16_12185_c1 | nmdc:mga08y16_12185_c1_5607_6290 | 227 |
| 679 | 3300050511 | nmdc:mga08y16_484813_c1 | nmdc:mga08y16_484813_c1_174_857 | 227 |
| 680 | 3300050511 | nmdc:mga08y16_58651_c1 | nmdc:mga08y16_58651_c1_1302_1985 | 227 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e27-assembly2.cif.gz_D | nicotinic acid mononucleotide (namn) adenylyltransferase from bacillus anthracis: product complex | 0.9235 | 9 | 217 |
| 2qtr-assembly1.cif.gz_A | crystal structure of nicotinate mononucleotide adenylyltransferase | 0.9187 | 9 | 219 |
| 1kaq-assembly3.cif.gz_E | structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase | 0.917 | 9 | 217 |
| 3e27-assembly2.cif.gz_D | nicotinic acid mononucleotide (namn) adenylyltransferase from bacillus anthracis: product complex | 0.9093 | 9 | 217 |
| 1kaq-assembly1.cif.gz_D | structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase | 0.9086 | 9 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2h2aB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9027 | 8 | 217 | 3.40.50.620 |
| 5virA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8867 | 9 | 217 | 3.40.50.620 |
| 2h2aB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8844 | 8 | 217 | 3.40.50.620 |
| 1k4kB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8689 | 9 | 217 | 3.40.50.620 |
| 5virA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8684 | 9 | 217 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521T6F1-F1-model_v4 | Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) | 0.9725 | 10 | 219 |
GO:0004515
GO:0005524 GO:0009435 |
| AF-A0A2E7BLV7-F1-model_v4 | Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) | 0.9687 | 6 | 217 |
GO:0004515
GO:0005524 GO:0009435 |
| AF-A0A432HU36-F1-model_v4 | Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) | 0.9639 | 8 | 221 |
GO:0004515
GO:0005524 GO:0009435 |
| AF-A0A2E5LAG4-F1-model_v4 | Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) | 0.9582 | 9 | 219 |
GO:0004515
GO:0005524 GO:0009435 |
| AF-A0A2E4W6X0-F1-model_v4 | Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) | 0.958 | 9 | 217 |
GO:0004515
GO:0005524 GO:0009435 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar