F474757

General Info

Members Datasets Scaffolds Average Seq Length
680 278 680 226

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100541154|Ga0070694_1005411541
Length 246
Sequence MPDSGATRLGVLGGTFDPVHNGHVEVAIAARRVLGLARVVLLPSRIPPHRAAQPVATAFHRFAMTAMAVNGVDGLEASDLELSAPGTSYTSSTLERLHASGLQPAQIFFITGADAFAEIATWHRYPEVLDMAHFVVVSRPGHEASALPALLPSLASRMHTRPERAERGDGKPAVFLIDWKTPVVSSTEVRRRIRNGDALTGLAPPAVEQHIIQHRLYLDGSTPQGVGAAADHLHGKDSDATNTQRS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
171 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
172 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
173 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
176 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
177 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
178 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
179 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
180 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
181 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
182 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
186 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
187 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
188 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
189 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
201 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
271 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.82
Nodule 0
Rhizoplane 3.53
Rhizosphere 92.21
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_822942 2162886012 Bacteria 1121
2 Ga0065704_10076773 3300005289 Bacteria 4982
3 Ga0065704_10156099 3300005289 Bacteria 1390
4 Ga0065712_10068599 3300005290 Bacteria 9708
5 Ga0065712_10072381 3300005290 Bacteria 4776
6 Ga0065715_10007113 3300005293 Bacteria 4300
7 Ga0065715_10021686 3300005293 Bacteria 1764
8 Ga0065715_10170128 3300005293 Unclassified 1553
9 Ga0065715_10277478 3300005293 Bacteria 1093
10 Ga0065707_10000834 3300005295 Bacteria 15115
11 Ga0065707_10009659 3300005295 Bacteria 2256
12 Ga0065707_10138247 3300005295 Bacteria 1802
13 Ga0070676_10031080 3300005328 Bacteria 3049
14 Ga0070676_10040201 3300005328 Bacteria 2707
15 Ga0070683_100000326 3300005329 Bacteria 32914
16 Ga0070683_100002445 3300005329 Bacteria 14778
17 Ga0070683_100061153 3300005329 Unclassified 3502
18 Ga0070690_100085737 3300005330 Bacteria 2066
19 Ga0070670_100008907 3300005331 Bacteria 8568
20 Ga0070670_100025013 3300005331 Bacteria 5137
21 Ga0070670_100048171 3300005331 Bacteria 3667
22 Ga0070670_100106717 3300005331 Bacteria 2413
23 Ga0070670_100471488 3300005331 Unclassified 1114
24 Ga0070670_100480184 3300005331 Bacteria 1104
25 Ga0070677_10055162 3300005333 Bacteria 1621
26 Ga0070682_100195394 3300005337 Bacteria 1423
27 Ga0070682_100497450 3300005337 Bacteria 944
28 Ga0068868_100123488 3300005338 Bacteria 2113
29 Ga0068868_100392113 3300005338 Unclassified 1197
30 Ga0070660_100115994 3300005339 Bacteria 2135
31 Ga0070689_100148828 3300005340 Unclassified 1887
32 Ga0070691_10027912 3300005341 Bacteria 2634
33 Ga0070691_10092043 3300005341 Bacteria 1496
34 Ga0070687_100101365 3300005343 Unclassified 1612
35 Ga0070661_100022313 3300005344 Bacteria 4531
36 Ga0070661_100176475 3300005344 Bacteria 1624
37 Ga0070692_10137478 3300005345 Bacteria 1380
38 Ga0070669_100010678 3300005353 Bacteria 6518
39 Ga0070669_100236358 3300005353 Bacteria 1450
40 Ga0070675_100060238 3300005354 Bacteria 3134
41 Ga0070675_100090971 3300005354 Unclassified 2556
42 Ga0070675_100413278 3300005354 Bacteria 1205
43 Ga0070675_100647047 3300005354 Bacteria 961
44 Ga0070675_100748951 3300005354 Bacteria 891
45 Ga0070671_100006550 3300005355 Bacteria 9310
46 Ga0070671_100008320 3300005355 Bacteria 8305
47 Ga0070671_100485558 3300005355 Unclassified 1062
48 Ga0070674_100038383 3300005356 Bacteria 3227
49 Ga0070674_100076131 3300005356 Bacteria 2385
50 Ga0070674_100151238 3300005356 Bacteria 1752
51 Ga0070674_100252522 3300005356 Bacteria 1386
52 Ga0070673_100080865 3300005364 Bacteria 2634
53 Ga0070673_100188476 3300005364 Bacteria 1770
54 Ga0070673_100880603 3300005364 Unclassified 830
55 Ga0070688_100018946 3300005365 Bacteria 3981
56 Ga0070688_100021315 3300005365 Unclassified 3784
57 Ga0070659_100443326 3300005366 Bacteria 1100
58 Ga0070667_100071791 3300005367 Bacteria 2949
59 Ga0070667_100113453 3300005367 Bacteria 2352
60 Ga0070667_100504587 3300005367 Bacteria 1109
61 Ga0070703_10038597 3300005406 Bacteria 1477
62 Ga0070713_100020203 3300005436 Bacteria 5101
63 Ga0070701_10018755 3300005438 Bacteria 3256
64 Ga0070705_100000353 3300005440 Bacteria 27139
65 Ga0070705_100100434 3300005440 Bacteria 1826
66 Ga0070705_100373719 3300005440 Bacteria 1047
67 Ga0070700_100052052 3300005441 Unclassified 2552
68 Ga0070694_100001728 3300005444 Bacteria 12875
69 Ga0070694_100013000 3300005444 Bacteria 5192
70 Ga0070694_100032991 3300005444 Bacteria 3403
71 Ga0070694_100216176 3300005444 Bacteria 1436
72 Ga0070694_100541154 3300005444 Bacteria 931
73 Ga0070694_100588851 3300005444 Unclassified 895
74 Ga0070708_100086957 3300005445 Bacteria 2840
75 Ga0070708_100114527 3300005445 Bacteria 2481
76 Ga0070663_100009370 3300005455 Bacteria 6061
77 Ga0070678_100129312 3300005456 Bacteria 2004
78 Ga0070678_100652120 3300005456 Bacteria 944
79 Ga0070662_100050063 3300005457 Unclassified 3013
80 Ga0070662_100102819 3300005457 Bacteria 2165
81 Ga0070662_100151431 3300005457 Bacteria 1806
82 Ga0070662_100232970 3300005457 Unclassified 1474
83 Ga0068867_100484826 3300005459 Bacteria 1060
84 Ga0070685_10358124 3300005466 Bacteria 999
85 Ga0070706_100089513 3300005467 Bacteria 2854
86 Ga0070706_100332109 3300005467 Bacteria 1418
87 Ga0070707_100128713 3300005468 Bacteria 2461
88 Ga0070707_100210554 3300005468 Bacteria 1895
89 Ga0070698_100004723 3300005471 Bacteria 14961
90 Ga0070698_100587613 3300005471 Bacteria 1054
91 Ga0070699_100007386 3300005518 Bacteria 9569
92 Ga0070699_100009834 3300005518 Bacteria 8279
93 Ga0070699_100193343 3300005518 Unclassified 1808
94 Ga0070684_100000168 3300005535 Bacteria 45138
95 Ga0070684_100129898 3300005535 Bacteria 2272
96 Ga0070684_100185501 3300005535 Unclassified 1892
97 Ga0070684_100231299 3300005535 Bacteria 1688
98 Ga0070697_100349017 3300005536 Unclassified 1278
99 Ga0070672_100064039 3300005543 Bacteria 2904
100 Ga0070672_100072649 3300005543 Bacteria 2739
101 Ga0070672_100116107 3300005543 Bacteria 2186
102 Ga0070672_100317229 3300005543 Bacteria 1324
103 Ga0070695_100000542 3300005545 Bacteria 19943
104 Ga0070695_100054187 3300005545 Bacteria 2580
105 Ga0070695_100067396 3300005545 Bacteria 2334
106 Ga0070696_100052386 3300005546 Bacteria 2839
107 Ga0070696_100208946 3300005546 Bacteria 1460
108 Ga0070665_100136824 3300005548 Bacteria 2453
109 Ga0070704_100007989 3300005549 Bacteria 6318
110 Ga0070704_100079079 3300005549 Bacteria 2414
111 Ga0070704_100167341 3300005549 Bacteria 1744
112 Ga0068855_100058478 3300005563 Bacteria 4515
113 Ga0070664_100001248 3300005564 Bacteria 20353
114 Ga0070664_100032472 3300005564 Unclassified 4367
115 Ga0070664_100186765 3300005564 Bacteria 1845
116 Ga0070664_100209267 3300005564 Bacteria 1743
117 Ga0070664_100221792 3300005564 Bacteria 1692
118 Ga0070664_100314227 3300005564 Unclassified 1418
119 Ga0070664_100363153 3300005564 Bacteria 1319
120 Ga0070664_100429583 3300005564 Bacteria 1211
121 Ga0068857_100022078 3300005577 Bacteria 5599
122 Ga0068857_100537833 3300005577 Bacteria 1100
123 Ga0070702_100027661 3300005615 Bacteria 3063
124 Ga0070702_100105367 3300005615 Bacteria 1738
125 Ga0068852_100025408 3300005616 Bacteria 4799
126 Ga0068852_100091605 3300005616 Bacteria 2721
127 Ga0068852_100098602 3300005616 Bacteria 2632
128 Ga0068859_100017025 3300005617 Bacteria 7297
129 Ga0068859_100066152 3300005617 Bacteria 3649
130 Ga0068859_100337967 3300005617 Unclassified 1600
131 Ga0068859_101252391 3300005617 Unclassified 817
132 Ga0068864_100065348 3300005618 Bacteria 3156
133 Ga0068864_100077251 3300005618 Bacteria 2911
134 Ga0068861_100170577 3300005719 Bacteria 1803
135 Ga0068870_10058630 3300005840 Bacteria 2061
136 Ga0068863_100064191 3300005841 Bacteria 3473
137 Ga0068863_100350914 3300005841 Bacteria 1436
138 Ga0068858_100102307 3300005842 Bacteria 2672
139 Ga0068858_100160693 3300005842 Bacteria 2115
140 Ga0068858_100214375 3300005842 Bacteria 1822
141 Ga0068860_100005299 3300005843 Bacteria 13094
142 Ga0068860_100210438 3300005843 Unclassified 1886
143 Ga0068860_100267790 3300005843 Bacteria 1667
144 Ga0068862_100008919 3300005844 Bacteria 8304
145 Ga0068862_100153263 3300005844 Unclassified 2052
146 Ga0068862_100532011 3300005844 Bacteria 1120
147 Ga0068862_100576982 3300005844 Bacteria 1077
148 Ga0075368_10025260 3300006042 Bacteria 2279
149 Ga0075368_10035739 3300006042 Bacteria 1940
150 Ga0075363_100011958 3300006048 Bacteria 4171
151 Ga0075364_10004582 3300006051 Bacteria 7960
152 Ga0075364_10005737 3300006051 Bacteria 7239
153 Ga0075362_10000489 3300006177 Bacteria 11538
154 Ga0075367_10004668 3300006178 Bacteria 6721
155 Ga0075366_10012749 3300006195 Bacteria 4775
156 Ga0075366_10126822 3300006195 Bacteria 1539
157 Ga0075366_10316982 3300006195 Bacteria 955
158 Ga0097621_100098805 3300006237 Bacteria 2453
159 Ga0097621_100410810 3300006237 Bacteria 1213
160 Ga0068871_100319630 3300006358 Unclassified 1366
161 Ga0075428_100000030 3300006844 Bacteria 119551
162 Ga0075428_100011002 3300006844 Bacteria 10062
163 Ga0075428_100017106 3300006844 Bacteria 8010
164 Ga0075428_100038342 3300006844 Bacteria 5273
165 Ga0075428_100041279 3300006844 Bacteria 5074
166 Ga0075428_100075795 3300006844 Bacteria 3672
167 Ga0075428_100112653 3300006844 Bacteria 2963
168 Ga0075428_100134313 3300006844 Bacteria 2690
169 Ga0075428_100331368 3300006844 Bacteria 1635
170 Ga0075428_100357830 3300006844 Bacteria 1566
171 Ga0075428_100438939 3300006844 Bacteria 1398
172 Ga0075430_100008531 3300006846 Bacteria 8655
173 Ga0075430_100012219 3300006846 Bacteria 7311
174 Ga0075430_100231481 3300006846 Bacteria 1532
175 Ga0075431_100004362 3300006847 Bacteria 13882
176 Ga0075431_100008733 3300006847 Bacteria 10151
177 Ga0075431_100019271 3300006847 Bacteria 6954
178 Ga0075431_100070379 3300006847 Bacteria 3610
179 Ga0075431_100231316 3300006847 Bacteria 1883
180 Ga0075431_100272389 3300006847 Bacteria 1715
181 Ga0075433_10005701 3300006852 Bacteria 9791
182 Ga0075433_10063822 3300006852 Bacteria 3228
183 Ga0075433_10093714 3300006852 Bacteria 2657
184 Ga0075433_10339416 3300006852 Bacteria 1328
185 Ga0075434_100002362 3300006871 Bacteria 16533
186 Ga0075434_100071599 3300006871 Bacteria 3458
187 Ga0075434_100104126 3300006871 Bacteria 2847
188 Ga0075434_100137424 3300006871 Bacteria 2463
189 Ga0075434_100379257 3300006871 Bacteria 1435
190 Ga0075429_100004407 3300006880 Bacteria 12098
191 Ga0075429_100032450 3300006880 Bacteria 4539
192 Ga0075429_100085831 3300006880 Unclassified 2743
193 Ga0075429_100118292 3300006880 Bacteria 2316
194 Ga0075429_100424987 3300006880 Bacteria 1164
195 Ga0075429_100561832 3300006880 Bacteria 1000
196 Ga0097620_100017024 3300006931 Bacteria 7297
197 Ga0097620_100066152 3300006931 Bacteria 3649
198 Ga0097620_100337991 3300006931 Unclassified 1600
199 Ga0097620_101252399 3300006931 Unclassified 817
200 Ga0075435_100212915 3300007076 Bacteria 1640
201 Ga0105240_10213803 3300009093 Bacteria 2251
202 Ga0105240_10552325 3300009093 Bacteria 1274
203 Ga0111539_10000015 3300009094 Bacteria 296576
204 Ga0111539_10023936 3300009094 Bacteria 7503
205 Ga0111539_10071906 3300009094 Archaea 4081
206 Ga0111539_10099845 3300009094 Bacteria 3408
207 Ga0111539_10305245 3300009094 Bacteria 1852
208 Ga0111539_10481753 3300009094 Bacteria 1445
209 Ga0111539_10524896 3300009094 Bacteria 1379
210 Ga0111539_10669522 3300009094 Bacteria 1208
211 Ga0111539_11178431 3300009094 Unclassified 890
212 Ga0105247_10185044 3300009101 Bacteria 1392
213 Ga0114129_10000288 3300009147 Bacteria 58119
214 Ga0114129_10001659 3300009147 Bacteria 30298
215 Ga0114129_10003888 3300009147 Bacteria 21072
216 Ga0114129_10007226 3300009147 Bacteria 15811
217 Ga0114129_10011087 3300009147 Bacteria 12841
218 Ga0114129_10016501 3300009147 Bacteria 10516
219 Ga0114129_10041543 3300009147 Bacteria 6479
220 Ga0114129_10042294 3300009147 Bacteria 6416
221 Ga0114129_10088636 3300009147 Bacteria 4289
222 Ga0114129_10098200 3300009147 Bacteria 4053
223 Ga0114129_10136172 3300009147 Bacteria 3370
224 Ga0114129_10155324 3300009147 Bacteria 3129
225 Ga0114129_10175158 3300009147 Bacteria 2922
226 Ga0114129_10624963 3300009147 Bacteria 1393
227 Ga0105243_10058182 3300009148 Bacteria 3080
228 Ga0105243_10060040 3300009148 Bacteria 3037
229 Ga0105241_10054310 3300009174 Bacteria 3066
230 Ga0105248_10116361 3300009177 Bacteria 3015
231 Ga0105248_10162416 3300009177 Bacteria 2519
232 Ga0105248_10243459 3300009177 Bacteria 2024
233 Ga0105248_10455003 3300009177 Bacteria 1443
234 Ga0105249_10083147 3300009553 Bacteria 2979
235 Ga0105249_10113728 3300009553 Bacteria 2562
236 Ga0105246_10265644 3300011119 Unclassified 1369
237 Ga0157369_10084492 3300013105 Bacteria 3393
238 Ga0157374_10059231 3300013296 Bacteria 3580
239 Ga0157374_10203209 3300013296 Bacteria 1940
240 Ga0157374_10227404 3300013296 Bacteria 1832
241 Ga0163162_10123467 3300013306 Unclassified 2695
242 Ga0163162_10571582 3300013306 Bacteria 1258
243 Ga0163162_10740975 3300013306 Bacteria 1102
244 Ga0157372_10151914 3300013307 Bacteria 2673
245 Ga0157375_10215124 3300013308 Bacteria 2079
246 Ga0157375_10217294 3300013308 Bacteria 2070
247 Ga0157375_10327160 3300013308 Bacteria 1698
248 Ga0157375_10362523 3300013308 Unclassified 1615
249 Ga0157375_11220528 3300013308 Unclassified 882
250 Ga0163163_10028350 3300014325 Bacteria 5375
251 Ga0163163_10039080 3300014325 Bacteria 4629
252 Ga0163163_10427095 3300014325 Bacteria 1384
253 Ga0157380_10045868 3300014326 Bacteria 3432
254 Ga0157380_10178911 3300014326 Bacteria 1861
255 Ga0157380_11426910 3300014326 Bacteria 743
256 Ga0157377_10113955 3300014745 Bacteria 1629
257 Ga0157377_10185007 3300014745 Bacteria 1313
258 Ga0157379_10322929 3300014968 Bacteria 1410
259 Ga0157376_10060414 3300014969 Bacteria 3183
260 Ga0163161_10011304 3300017792 Bacteria 6186
261 Ga0163161_10095596 3300017792 Bacteria 2204
262 Ga0213876_10178340 3300021384 Bacteria 1130
263 Ga0207697_10025784 3300025315 Bacteria 2404
264 Ga0207697_10046210 3300025315 Bacteria 1793
265 Ga0207682_10024190 3300025893 Bacteria 2403
266 Ga0207682_10085036 3300025893 Bacteria 1362
267 Ga0207642_10014612 3300025899 Bacteria 2902
268 Ga0207680_10131306 3300025903 Bacteria 1651
269 Ga0207645_10022218 3300025907 Unclassified 4129
270 Ga0207645_10047629 3300025907 Bacteria 2737
271 Ga0207643_10037151 3300025908 Unclassified 2732
272 Ga0207684_10206892 3300025910 Bacteria 1693
273 Ga0207695_10451286 3300025913 Bacteria 1169
274 Ga0207662_10047418 3300025918 Bacteria 2544
275 Ga0207649_10135714 3300025920 Bacteria 1677
276 Ga0207649_10154268 3300025920 Bacteria 1585
277 Ga0207646_10111714 3300025922 Bacteria 2453
278 Ga0207646_10544359 3300025922 Bacteria 1044
279 Ga0207646_10548415 3300025922 Bacteria 1040
280 Ga0207681_10190776 3300025923 Bacteria 1568
281 Ga0207650_10015116 3300025925 Bacteria 5371
282 Ga0207650_10052334 3300025925 Bacteria 3025
283 Ga0207650_10053839 3300025925 Bacteria 2984
284 Ga0207650_10401256 3300025925 Bacteria 1135
285 Ga0207650_10712219 3300025925 Bacteria 848
286 Ga0207659_10001465 3300025926 Bacteria 14071
287 Ga0207659_10112199 3300025926 Unclassified 2074
288 Ga0207659_10245267 3300025926 Bacteria 1451
289 Ga0207700_10003078 3300025928 Bacteria 9625
290 Ga0207644_10081315 3300025931 Bacteria 2394
291 Ga0207706_10077823 3300025933 Bacteria 2917
292 Ga0207706_10097974 3300025933 Unclassified 2579
293 Ga0207706_10136039 3300025933 Bacteria 2162
294 Ga0207686_10409100 3300025934 Bacteria 1035
295 Ga0207709_10112218 3300025935 Bacteria 1825
296 Ga0207670_10104809 3300025936 Bacteria 2026
297 Ga0207669_10040227 3300025937 Bacteria 2710
298 Ga0207669_10079899 3300025937 Bacteria 2090
299 Ga0207669_10254247 3300025937 Bacteria 1310
300 Ga0207704_10216504 3300025938 Bacteria 1414
301 Ga0207691_10121725 3300025940 Bacteria 2312
302 Ga0207691_10165578 3300025940 Bacteria 1937
303 Ga0207691_10286009 3300025940 Bacteria 1418
304 Ga0207691_10312122 3300025940 Bacteria 1349
305 Ga0207691_10368910 3300025940 Bacteria 1226
306 Ga0207711_10127745 3300025941 Bacteria 2276
307 Ga0207711_10258098 3300025941 Bacteria 1601
308 Ga0207711_10262024 3300025941 Bacteria 1589
309 Ga0207689_10161831 3300025942 Bacteria 1844
310 Ga0207661_10001481 3300025944 Bacteria 15878
311 Ga0207661_10004405 3300025944 Bacteria 9876
312 Ga0207661_10019055 3300025944 Bacteria 5108
313 Ga0207661_10226598 3300025944 Bacteria 1654
314 Ga0207679_10005466 3300025945 Bacteria 7961
315 Ga0207679_10079401 3300025945 Bacteria 2502
316 Ga0207679_10158951 3300025945 Bacteria 1848
317 Ga0207679_10191853 3300025945 Bacteria 1699
318 Ga0207679_10228111 3300025945 Bacteria 1570
319 Ga0207679_10468762 3300025945 Bacteria 1119
320 Ga0207679_10587913 3300025945 Bacteria 1002
321 Ga0207667_10106183 3300025949 Bacteria 2897
322 Ga0207651_10092531 3300025960 Bacteria 2218
323 Ga0207651_10666177 3300025960 Unclassified 914
324 Ga0207651_10981248 3300025960 Unclassified 754
325 Ga0207668_10098648 3300025972 Unclassified 2165
326 Ga0207658_10061167 3300025986 Bacteria 2813
327 Ga0207658_10172252 3300025986 Bacteria 1784
328 Ga0207658_10277894 3300025986 Bacteria 1434
329 Ga0207658_10638681 3300025986 Bacteria 959
330 Ga0207677_10267757 3300026023 Bacteria 1396
331 Ga0207703_10073161 3300026035 Bacteria 2835
332 Ga0207703_10081417 3300026035 Bacteria 2699
333 Ga0207703_10499900 3300026035 Bacteria 1141
334 Ga0207678_10198326 3300026067 Bacteria 1716
335 Ga0207708_10001614 3300026075 Bacteria 16807
336 Ga0207708_10091600 3300026075 Bacteria 2345
337 Ga0207708_10179487 3300026075 Unclassified 1681
338 Ga0207641_10196513 3300026088 Bacteria 1857
339 Ga0207641_10261749 3300026088 Bacteria 1620
340 Ga0207648_10006648 3300026089 Bacteria 11475
341 Ga0207648_10357299 3300026089 Bacteria 1318
342 Ga0207676_10069080 3300026095 Bacteria 2828
343 Ga0207676_10335715 3300026095 Unclassified 1392
344 Ga0207676_10445870 3300026095 Bacteria 1219
345 Ga0207676_10453804 3300026095 Bacteria 1209
346 Ga0207674_10020387 3300026116 Bacteria 7163
347 Ga0207674_10041419 3300026116 Bacteria 4764
348 Ga0207674_10256462 3300026116 Bacteria 1696
349 Ga0207675_100177617 3300026118 Bacteria 2038
350 Ga0207683_10121950 3300026121 Bacteria 2341
351 Ga0207683_10173179 3300026121 Bacteria 1955
352 Ga0207683_10614497 3300026121 Bacteria 1006
353 Ga0207698_10119787 3300026142 Bacteria 2225
354 Ga0207698_10503825 3300026142 Bacteria 1179
355 Ga0207698_10957252 3300026142 Bacteria 865
356 Ga0209982_1005767 3300027552 Bacteria 1792
357 Ga0209813_10045523 3300027866 Bacteria 1352
358 Ga0207428_10000048 3300027907 Bacteria 180760
359 Ga0207428_10001421 3300027907 Bacteria 25181
360 Ga0207428_10003385 3300027907 Bacteria 15501
361 Ga0207428_10012993 3300027907 Bacteria 7292
362 Ga0268266_10022055 3300028379 Bacteria 5429
363 Ga0268265_10001193 3300028380 Bacteria 22642
364 Ga0268264_10007214 3300028381 Bacteria 9307
365 Ga0268264_10211693 3300028381 Unclassified 1780
366 Ga0268264_10766612 3300028381 Bacteria 962
367 Ga0307408_100012418 3300031548 Bacteria 5642
368 Ga0307408_100077537 3300031548 Bacteria 2474
369 Ga0307408_100098852 3300031548 Bacteria 2219
370 Ga0307408_100147281 3300031548 Bacteria 1855
371 Ga0307408_100152577 3300031548 Unclassified 1825
372 Ga0307408_100166711 3300031548 Bacteria 1755
373 Ga0307405_10035559 3300031731 Bacteria 2976
374 Ga0307405_10396988 3300031731 Bacteria 1078
375 Ga0307413_10047599 3300031824 Bacteria 2558
376 Ga0307413_10255440 3300031824 Unclassified 1303
377 Ga0307410_10134643 3300031852 Bacteria 1820
378 Ga0307410_10270470 3300031852 Bacteria 1329
379 Ga0307406_10093469 3300031901 Bacteria 2030
380 Ga0307407_10075768 3300031903 Bacteria 2018
381 Ga0307407_10312789 3300031903 Archaea 1099
382 Ga0307412_10089590 3300031911 Bacteria 2149
383 Ga0307412_10100362 3300031911 Bacteria 2046
384 Ga0307412_10115053 3300031911 Unclassified 1927
385 Ga0307409_100107264 3300031995 Bacteria 2333
386 Ga0307409_100354227 3300031995 Bacteria 1386
387 Ga0307416_100005976 3300032002 Bacteria 7564
388 Ga0307416_100045600 3300032002 Bacteria 3453
389 Ga0307416_100047586 3300032002 Bacteria 3395
390 Ga0307416_100167528 3300032002 Bacteria 2040
391 Ga0307416_100253705 3300032002 Bacteria 1714
392 Ga0307416_100274777 3300032002 Bacteria 1657
393 Ga0307416_100354114 3300032002 Bacteria 1487
394 Ga0307416_101266020 3300032002 Unclassified 843
395 Ga0307416_101342117 3300032002 Bacteria 821
396 Ga0307411_10055021 3300032005 Bacteria 2616
397 Ga0307411_10067051 3300032005 Bacteria 2413
398 Ga0307411_10182057 3300032005 Unclassified 1596
399 Ga0307411_10227502 3300032005 Bacteria 1451
400 Ga0307411_10476153 3300032005 Bacteria 1050
401 Ga0307415_100031272 3300032126 Bacteria 3427
402 Ga0307415_100379989 3300032126 Bacteria 1199
403 Ga0373926_0008201 3300035083 Bacteria 3477
404 Ga0373956_0258449 3300035119 Unclassified 828
405 Ga0373943_0115001 3300035170 Bacteria 1423
406 Ga0373955_0018405 3300035172 Bacteria 3473
407 Ga0373935_0097227 3300035692 Unclassified 1936
408 Ga0373935_0105662 3300035692 Bacteria 1862
409 Ga0373947_0055763 3300035725 Bacteria 2387
410 Ga0373937_0619256 3300036401 Bacteria 1027
411 Ga0373925_0098098 3300037068 Bacteria 2248
412 Ga0373925_0524712 3300037068 Unclassified 973
413 Ga0395900_0543035 3300037418 Bacteria 1108
414 Ga0395905_0626219 3300037471 Bacteria 978
415 Ga0436365_0372794 3300039437 Bacteria 2043
416 Ga0439439_0015945 3300041406 Unclassified 1837
417 Ga0439453_0022440 3300041408 Archaea 1144
418 Ga0439461_0037172 3300041410 Bacteria 1039
419 Ga0451789_1141407 3300041443 Bacteria 691
420 Ga0451853_0443173 3300041512 Bacteria 1331
421 Ga0439431_0021554 3300041997 Bacteria 1547
422 Ga0439433_0002476 3300041999 Bacteria 3920
423 Ga0439433_0005225 3300041999 Bacteria 2789
424 Ga0439433_0035924 3300041999 Bacteria 1144
425 Ga0439449_0053609 3300042007 Bacteria 1491
426 Ga0439450_000213 3300042008 Bacteria 6925
427 Ga0439462_0014582 3300042015 Bacteria 2021
428 Ga0450920_009630 3300042122 Bacteria 1780
429 Ga0450923_004427 3300042125 Bacteria 2206
430 Ga0450899_010690 3300042135 Bacteria 1020
431 Ga0439446_0010643 3300042156 Bacteria 2482
432 Ga0439446_0012217 3300042156 Bacteria 2343
433 Ga0439434_0003558 3300042435 Bacteria 4547
434 Ga0439434_0055486 3300042435 Unclassified 1233
435 Ga0439434_0055597 3300042435 Bacteria 1232
436 Ga0439435_0065639 3300042436 Bacteria 1065
437 Ga0439444_0015903 3300042437 Unclassified 1275
438 Ga0439464_0080509 3300042439 Bacteria 972
439 Ga0439460_0085975 3300042461 Unclassified 993
440 Ga0450918_003731 3300042531 Bacteria 2817
441 Ga0451577_0514545 3300042876 Bacteria 1087
442 Ga0439440_0030529 3300042993 Bacteria 1270
443 Ga0453684_0225246 3300044712 Bacteria 2169
444 Ga0451576_0012634 3300045051 Bacteria 9481
445 Ga0451576_0083199 3300045051 Bacteria 3329
446 Ga0451576_0186158 3300045051 Bacteria 2168
447 Ga0451576_0612475 3300045051 Unclassified 1144
448 Ga0466967_0200247 3300045976 Bacteria 1891
449 Ga0495629_0010127 3300046459 Bacteria 6876
450 Ga0495584_0013749 3300046491 Bacteria 4128
451 Ga0495594_0020424 3300046499 Bacteria 3528
452 Ga0495594_0049673 3300046499 Bacteria 2306
453 Ga0495594_0064228 3300046499 Bacteria 2035
454 Ga0495663_0008880 3300046525 Bacteria 2788
455 Ga0495642_0012519 3300046528 Bacteria 3270
456 Ga0495642_0119794 3300046528 Archaea 1129
457 Ga0495598_0039601 3300046537 Bacteria 1371
458 Ga0495609_0050739 3300046538 Bacteria 1849
459 Ga0495621_0067629 3300046539 Bacteria 1309
460 Ga0495656_0047373 3300046615 Bacteria 1823
461 Ga0495659_0011551 3300046664 Bacteria 2845
462 Ga0495659_0012673 3300046664 Bacteria 2735
463 Ga0495659_0014479 3300046664 Unclassified 2582
464 Ga0495659_0014608 3300046664 Bacteria 2572
465 Ga0495588_0015994 3300046674 Bacteria 3620
466 Ga0495657_0337007 3300046675 Bacteria 894
467 Ga0495658_0489359 3300046683 Bacteria 787
468 Ga0495600_0106179 3300046809 Unclassified 1830
469 Ga0495636_0010870 3300047318 Unclassified 3601
470 Ga0495636_0271872 3300047318 Unclassified 788
471 Ga0495674_0219955 3300047319 Bacteria 1570
472 Ga0495676_0062131 3300047321 Bacteria 2918
473 Ga0495685_021291 3300047447 Bacteria 2231
474 Ga0495684_0315783 3300047471 Unclassified 1118
475 Ga0496100_0037095 3300048903 Bacteria 3079
476 Ga0496100_0079241 3300048903 Bacteria 2213
477 Ga0496101_0058339 3300048904 Bacteria 2795
478 Ga0496104_0001797 3300048907 Bacteria 18590
479 Ga0496104_0016740 3300048907 Bacteria 6666
480 Ga0496104_0331563 3300048907 Bacteria 1435
481 Ga0496104_0781236 3300048907 Bacteria 861
482 Ga0496105_0062768 3300048908 Bacteria 3066
483 Ga0496105_0119830 3300048908 Bacteria 2170
484 Ga0496105_0385158 3300048908 Bacteria 1115
485 Ga0496107_0112817 3300048910 Bacteria 1999
486 Ga0496108_0004028 3300048911 Bacteria 11793
487 Ga0496108_0017856 3300048911 Bacteria 5803
488 Ga0496109_0001846 3300048912 Bacteria 17552
489 Ga0496109_0287186 3300048912 Bacteria 1551
490 Ga0496109_0607778 3300048912 Bacteria 1030
491 Ga0496110_0339458 3300048913 Bacteria 1368
492 Ga0496110_0362287 3300048913 Bacteria 1321
493 Ga0496111_0019021 3300048914 Bacteria 4763
494 Ga0496112_0012297 3300048915 Bacteria 7861
495 Ga0496113_0207885 3300048916 Bacteria 1557
496 Ga0496113_0224547 3300048916 Bacteria 1497
497 Ga0496114_0001396 3300048917 Bacteria 18340
498 Ga0501031_0044414 3300049568 Bacteria 2900
499 Ga0501031_0156411 3300049568 Bacteria 1490
500 Ga0501033_0302724 3300049570 Bacteria 1125
501 Ga0501034_0113457 3300049571 Bacteria 2700
502 Ga0501036_0042355 3300049572 Bacteria 3855
503 Ga0501036_0061654 3300049572 Bacteria 3177
504 Ga0501036_0076421 3300049572 Bacteria 2833
505 Ga0501036_0086664 3300049572 Bacteria 2647
506 Ga0501036_0103681 3300049572 Bacteria 2405
507 Ga0501036_0268679 3300049572 Bacteria 1428
508 Ga0501038_0095757 3300049574 Bacteria 2479
509 Ga0501039_0061114 3300049575 Bacteria 2918
510 Ga0501039_0086708 3300049575 Bacteria 2438
511 Ga0501039_0262851 3300049575 Bacteria 1356
512 Ga0501040_0021940 3300049576 Bacteria 4270
513 Ga0501040_0066727 3300049576 Bacteria 2479
514 Ga0501040_0250608 3300049576 Bacteria 1263
515 Ga0501041_0046095 3300049577 Unclassified 2652
516 Ga0501041_0063496 3300049577 Bacteria 2261
517 Ga0501041_0103295 3300049577 Bacteria 1765
518 Ga0501041_0104916 3300049577 Bacteria 1751
519 Ga0501041_0264681 3300049577 Bacteria 1081
520 Ga0501042_0015915 3300049578 Bacteria 5157
521 Ga0501042_0108775 3300049578 Bacteria 1996
522 Ga0501042_0131026 3300049578 Bacteria 1807
523 Ga0501042_0243300 3300049578 Bacteria 1298
524 Ga0501042_0252830 3300049578 Unclassified 1272
525 Ga0501043_0365133 3300049579 Bacteria 1095
526 Ga0501046_0087843 3300049580 Bacteria 2395
527 Ga0501046_0303974 3300049580 Bacteria 1164
528 Ga0501048_0034807 3300049582 Bacteria 3630
529 Ga0501048_0042593 3300049582 Bacteria 3250
530 Ga0501048_0127741 3300049582 Bacteria 1798
531 Ga0501067_0016453 3300049583 Unclassified 4086
532 Ga0501069_0068325 3300049585 Bacteria 1989
533 Ga0501069_0079165 3300049585 Unclassified 1849
534 Ga0501069_0141660 3300049585 Bacteria 1379
535 Ga0501069_0407432 3300049585 Bacteria 805
536 Ga0501071_0004355 3300049587 Bacteria 8980
537 Ga0501071_0041216 3300049587 Bacteria 3307
538 Ga0501071_0072851 3300049587 Bacteria 2505
539 Ga0501071_0155842 3300049587 Bacteria 1705
540 Ga0501071_0210629 3300049587 Unclassified 1461
541 Ga0501071_0252052 3300049587 Unclassified 1333
542 Ga0501072_0009895 3300049588 Bacteria 7252
543 Ga0501072_0036484 3300049588 Bacteria 3854
544 Ga0501072_0057194 3300049588 Bacteria 3073
545 Ga0501072_0074399 3300049588 Bacteria 2686
546 Ga0501072_0093286 3300049588 Bacteria 2391
547 Ga0501072_0135272 3300049588 Unclassified 1965
548 Ga0501072_0214388 3300049588 Bacteria 1534
549 Ga0501072_0330400 3300049588 Bacteria 1211
550 Ga0501073_0095153 3300049589 Bacteria 2069
551 Ga0501074_0055568 3300049590 Bacteria 2853
552 Ga0501074_0213864 3300049590 Bacteria 1373
553 Ga0501074_0367266 3300049590 Bacteria 1021
554 Ga0501075_0001534 3300049591 Bacteria 15063
555 Ga0501075_0024470 3300049591 Bacteria 4429
556 Ga0501075_0025191 3300049591 Bacteria 4371
557 Ga0501075_0095487 3300049591 Bacteria 2256
558 Ga0501075_0098892 3300049591 Bacteria 2215
559 Ga0501075_0134275 3300049591 Bacteria 1885
560 Ga0501075_0137098 3300049591 Bacteria 1864
561 Ga0501075_0194268 3300049591 Bacteria 1548
562 Ga0501075_0411045 3300049591 Bacteria 1032
563 Ga0501075_0425911 3300049591 Bacteria 1012
564 Ga0501076_0022992 3300049592 Bacteria 4798
565 Ga0501076_0036695 3300049592 Bacteria 3841
566 Ga0501076_0044318 3300049592 Bacteria 3508
567 Ga0501076_0099060 3300049592 Bacteria 2348
568 Ga0501076_0113450 3300049592 Bacteria 2192
569 Ga0501076_0166370 3300049592 Bacteria 1797
570 Ga0501076_0218466 3300049592 Bacteria 1558
571 Ga0501077_0056570 3300049593 Bacteria 2490
572 Ga0501077_0075813 3300049593 Bacteria 2130
573 Ga0501077_0125764 3300049593 Unclassified 1625
574 Ga0501077_0177884 3300049593 Bacteria 1352
575 Ga0501079_0009615 3300049741 Bacteria 7333
576 Ga0501079_0045180 3300049741 Bacteria 3400
577 Ga0501079_0061582 3300049741 Bacteria 2895
578 Ga0501079_0063662 3300049741 Bacteria 2845
579 Ga0501079_0323813 3300049741 Unclassified 1207
580 Ga0501080_0041313 3300049742 Bacteria 4298
581 Ga0501080_0197373 3300049742 Bacteria 1848
582 Ga0501081_0027452 3300049743 Bacteria 3840
583 Ga0501081_0049052 3300049743 Bacteria 2906
584 Ga0501081_0051693 3300049743 Bacteria 2834
585 Ga0501081_0056415 3300049743 Bacteria 2715
586 Ga0501081_0114055 3300049743 Bacteria 1920
587 Ga0501081_0199976 3300049743 Bacteria 1449
588 Ga0501083_0133136 3300049744 Bacteria 1630
589 Ga0501035_0161684 3300049822 Bacteria 1938
590 Ga0501035_0383642 3300049822 Bacteria 1171
591 Ga0501045_0035210 3300049824 Bacteria 3634
592 Ga0501045_0054252 3300049824 Bacteria 2930
593 Ga0501045_0066836 3300049824 Bacteria 2639
594 Ga0501045_0147967 3300049824 Unclassified 1747
595 Ga0501045_0180592 3300049824 Bacteria 1572
596 Ga0501045_0632996 3300049824 Bacteria 791
597 nmdc:mga03683_3561_c1 3300050489 Bacteria 5046
598 nmdc:mga03n38_17500_c1 3300050490 Bacteria 2808
599 nmdc:mga00v17_28425_c1 3300050491 Bacteria 3275
600 nmdc:mga00v17_3738_c2 3300050491 Bacteria 4454
601 nmdc:mga0yw44_58199_c1 3300050492 Bacteria 2360
602 nmdc:mga0k408_117395_c1 3300050493 Bacteria 1575
603 nmdc:mga0k408_168526_c1 3300050493 Bacteria 1305
604 nmdc:mga0k408_7377_c1 3300050493 Bacteria 5870
605 nmdc:mga0k408_8269_c1 3300050493 Bacteria 5581
606 nmdc:mga06z11_54799_c1 3300050494 Bacteria 2057
607 nmdc:mga04h51_15230_c1 3300050495 Bacteria 2212
608 nmdc:mga04h51_29463_c1 3300050495 Bacteria 1720
609 nmdc:mga04h51_84404_c1 3300050495 Bacteria 1133
610 nmdc:mga05p37_10546_c1 3300050507 Bacteria 10958
611 nmdc:mga05p37_10687_c1 3300050507 Bacteria 10895
612 nmdc:mga05p37_133190_c1 3300050507 Bacteria 3049
613 nmdc:mga05p37_133663_c1 3300050507 Bacteria 3043
614 nmdc:mga05p37_256905_c1 3300050507 Bacteria 2093
615 nmdc:mga05p37_2706_c1 3300050507 Bacteria 20600
616 nmdc:mga05p37_36822_c1 3300050507 Bacteria 6001
617 nmdc:mga05p37_46502_c1 3300050507 Bacteria 5336
618 nmdc:mga05p37_89795_c1 3300050507 Bacteria 3787
619 nmdc:mga05p37_93925_c1 3300050507 Bacteria 3696
620 nmdc:mga09592_133321_c1 3300050508 Bacteria 2139
621 nmdc:mga09592_190088_c1 3300050508 Bacteria 1777
622 nmdc:mga09592_242321_c1 3300050508 Bacteria 1562
623 nmdc:mga09592_390522_c1 3300050508 Bacteria 1203
624 nmdc:mga09592_55254_c1 3300050508 Bacteria 3355
625 nmdc:mga09592_559558_c1 3300050508 Bacteria 982
626 nmdc:mga0qj67_1191_c1 3300050509 Bacteria 18036
627 nmdc:mga0qj67_303671_c1 3300050509 Bacteria 1293
628 nmdc:mga0qj67_442619_c1 3300050509 Bacteria 1047
629 nmdc:mga0qj67_655915_c1 3300050509 Bacteria 837
630 nmdc:mga0qj67_69070_c1 3300050509 Bacteria 2817
631 nmdc:mga06r32_109267_c1 3300050510 Bacteria 2719
632 nmdc:mga06r32_19697_c1 3300050510 Bacteria 6199
633 nmdc:mga06r32_21085_c1 3300050510 Bacteria 6012
634 nmdc:mga06r32_303381_c1 3300050510 Bacteria 1583
635 nmdc:mga06r32_479225_c1 3300050510 Unclassified 1222
636 nmdc:mga06r32_86159_c1 3300050510 Bacteria 3063
637 nmdc:mga06r32_877273_c1 3300050510 Bacteria 855
638 nmdc:mga08y16_12185_c1 3300050511 Bacteria 9038
639 nmdc:mga08y16_138660_c1 3300050511 Bacteria 2529
640 nmdc:mga08y16_484813_c1 3300050511 Unclassified 1258
641 nmdc:mga08y16_58651_c1 3300050511 Unclassified 4022
642 nmdc:mga08y16_8_c1 3300050511 Bacteria 571177
643 nmdc:mga0n895_345259_c1 3300050512 Bacteria 1508
644 nmdc:mga0n895_42495_c1 3300050512 Bacteria 4422
645 nmdc:mga0n895_52001_c1 3300050512 Bacteria 4020
646 nmdc:mga0n895_63479_c1 3300050512 Bacteria 3652
647 nmdc:mga0n895_876676_c1 3300050512 Bacteria 884
648 nmdc:mga0rr50_154058_c1 3300050513 Bacteria 1860
649 nmdc:mga0rr50_178396_c1 3300050513 Bacteria 1735
650 nmdc:mga0rr50_97954_c1 3300050513 Bacteria 2297
651 nmdc:mga0a205_107877_c1 3300050515 Unclassified 2683
652 nmdc:mga0a205_174537_c1 3300050515 Bacteria 2045
653 nmdc:mga0a205_207632_c1 3300050515 Unclassified 1848
654 nmdc:mga0a205_327463_c1 3300050515 Bacteria 1402
655 nmdc:mga0a205_39887_c1 3300050515 Bacteria 4520
656 Ga0495601_0016468 3300053077 Bacteria 4480
657 Ga0495619_0051407 3300053085 Bacteria 2723
658 Ga0500628_002853 3300053129 Bacteria 2840
659 Ga0500611_009352 3300053727 Bacteria 1550
660 Ga0501084_0151050 3300054114 Bacteria 1958
661 Ga0501084_0172625 3300054114 Bacteria 1825
662 Ga0501084_0209160 3300054114 Bacteria 1646
663 Ga0501084_0301493 3300054114 Bacteria 1353
664 Ga0501084_0546872 3300054114 Bacteria 978
665 Ga0501084_0823297 3300054114 Bacteria 782
666 Ga0590071_000282 3300059421 Bacteria 14815
667 Ga0590071_004343 3300059421 Bacteria 3449
668 Ga0590071_038187 3300059421 Unclassified 1153
669 Ga0590074_007341 3300059423 Bacteria 1832
670 Ga0590075_006983 3300059424 Bacteria 2676
671 Ga0590077_000238 3300059426 Bacteria 15670
672 Ga0590077_003048 3300059426 Bacteria 3511
673 Ga0501082_0020583 3300060353 Bacteria 5687
674 Ga0501082_0076373 3300060353 Bacteria 2888
675 Ga0501082_0296378 3300060353 Bacteria 1408
676 Ga0501082_0302428 3300060353 Bacteria 1393
677 Ga0501082_0349904 3300060353 Bacteria 1288
678 Ga0530510_0001988 3300061734 Bacteria 14024
679 Ga0530510_0074430 3300061734 Bacteria 2466
680 Ga0530510_0183500 3300061734 Unclassified 1552

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046675 Ga0495657_0337007 Ga0495657_0337007_14_604 172
2 3300041443 Ga0451789_1141407 Ga0451789_1141407_111_680 174
3 3300046499 Ga0495594_0064228 Ga0495594_0064228_774_1478 188
4 3300042435 Ga0439434_0003558 Ga0439434_0003558_2325_2972 190
5 3300049592 Ga0501076_0218466 Ga0501076_0218466_897_1532 192
6 3300005616 Ga0068852_100091605 Ga0068852_1000916052 194
7 3300006844 Ga0075428_100000030 Ga0075428_10000003068 194
8 3300006880 Ga0075429_100118292 Ga0075429_1001182922 194
9 3300009094 Ga0111539_10000015 Ga0111539_1000001573 194
10 3300026142 Ga0207698_10503825 Ga0207698_105038252 194
11 3300027907 Ga0207428_10000048 Ga0207428_1000004873 194
12 3300046683 Ga0495658_0489359 Ga0495658_0489359_30_749 194
13 3300050508 nmdc:mga09592_190088_c1 nmdc:mga09592_190088_c1_930_1553 194
14 3300050510 nmdc:mga06r32_86159_c1 nmdc:mga06r32_86159_c1_905_1528 194
15 3300050511 nmdc:mga08y16_8_c1 nmdc:mga08y16_8_c1_466850_467473 194
16 3300005331 Ga0070670_100471488 Ga0070670_1004714882 195
17 3300031824 Ga0307413_10255440 Ga0307413_102554402 196
18 3300032002 Ga0307416_100274777 Ga0307416_1002747773 196
19 3300049576 Ga0501040_0250608 Ga0501040_0250608_625_1233 196
20 3300059421 Ga0590071_038187 Ga0590071_038187_327_1040 196
21 3300005295 Ga0065707_10138247 Ga0065707_101382472 197
22 3300005337 Ga0070682_100195394 Ga0070682_1001953941 197
23 3300005444 Ga0070694_100216176 Ga0070694_1002161762 197
24 3300006844 Ga0075428_100011002 Ga0075428_1000110028 197
25 3300006880 Ga0075429_100561832 Ga0075429_1005618322 197
26 3300007076 Ga0075435_100212915 Ga0075435_1002129152 197
27 3300009094 Ga0111539_10099845 Ga0111539_100998452 197
28 3300009147 Ga0114129_10098200 Ga0114129_100982002 197
29 3300009147 Ga0114129_10155324 Ga0114129_101553242 197
30 3300014326 Ga0157380_11426910 Ga0157380_114269101 197
31 3300027907 Ga0207428_10012993 Ga0207428_100129938 197
32 3300049585 Ga0501069_0141660 Ga0501069_0141660_211_873 197
33 3300050507 nmdc:mga05p37_256905_c1 nmdc:mga05p37_256905_c1_403_1011 197
34 3300050508 nmdc:mga09592_559558_c1 nmdc:mga09592_559558_c1_238_846 197
35 3300050511 nmdc:mga08y16_138660_c1 nmdc:mga08y16_138660_c1_1572_2180 197
36 3300050513 nmdc:mga0rr50_178396_c1 nmdc:mga0rr50_178396_c1_397_1089 197
37 3300005356 Ga0070674_100252522 Ga0070674_1002525222 199
38 3300006880 Ga0075429_100424987 Ga0075429_1004249872 200
39 3300049572 Ga0501036_0103681 Ga0501036_0103681_186_827 200
40 3300049577 Ga0501041_0063496 Ga0501041_0063496_640_1281 200
41 3300049578 Ga0501042_0108775 Ga0501042_0108775_247_888 200
42 3300049588 Ga0501072_0330400 Ga0501072_0330400_458_1099 200
43 3300049591 Ga0501075_0137098 Ga0501075_0137098_1197_1838 200
44 3300049592 Ga0501076_0022992 Ga0501076_0022992_706_1347 200
45 3300049743 Ga0501081_0049052 Ga0501081_0049052_680_1321 200
46 3300049824 Ga0501045_0066836 Ga0501045_0066836_484_1125 200
47 3300050508 nmdc:mga09592_390522_c1 nmdc:mga09592_390522_c1_446_1075 200
48 3300054114 Ga0501084_0151050 Ga0501084_0151050_1182_1823 200
49 3300061734 Ga0530510_0074430 Ga0530510_0074430_714_1355 200
50 3300005331 Ga0070670_100480184 Ga0070670_1004801842 201
51 3300005355 Ga0070671_100485558 Ga0070671_1004855581 201
52 3300005356 Ga0070674_100151238 Ga0070674_1001512382 201
53 3300005365 Ga0070688_100018946 Ga0070688_1000189464 201
54 3300005543 Ga0070672_100064039 Ga0070672_1000640394 201
55 3300005564 Ga0070664_100209267 Ga0070664_1002092672 201
56 3300005615 Ga0070702_100105367 Ga0070702_1001053672 201
57 3300009094 Ga0111539_11178431 Ga0111539_111784311 201
58 3300025923 Ga0207681_10190776 Ga0207681_101907761 201
59 3300025925 Ga0207650_10401256 Ga0207650_104012562 201
60 3300025940 Ga0207691_10121725 Ga0207691_101217252 201
61 3300025945 Ga0207679_10079401 Ga0207679_100794014 201
62 3300046664 Ga0495659_0014479 Ga0495659_0014479_190_870 201
63 3300005338 Ga0068868_100392113 Ga0068868_1003921131 202
64 3300013306 Ga0163162_10571582 Ga0163162_105715822 202
65 3300013308 Ga0157375_11220528 Ga0157375_112205282 202
66 3300017792 Ga0163161_10095596 Ga0163161_100955962 202
67 3300041512 Ga0451853_0443173 Ga0451853_0443173_364_1029 202
68 3300045051 Ga0451576_0186158 Ga0451576_0186158_1192_1896 202
69 3300046491 Ga0495584_0013749 Ga0495584_0013749_1634_2317 202
70 3300046499 Ga0495594_0049673 Ga0495594_0049673_218_901 202
71 3300046525 Ga0495663_0008880 Ga0495663_0008880_493_1176 202
72 3300046528 Ga0495642_0012519 Ga0495642_0012519_818_1501 202
73 3300046538 Ga0495609_0050739 Ga0495609_0050739_311_994 202
74 3300046664 Ga0495659_0011551 Ga0495659_0011551_1095_1778 202
75 3300046664 Ga0495659_0014608 Ga0495659_0014608_1396_2079 202
76 3300046674 Ga0495588_0015994 Ga0495588_0015994_1245_1928 202
77 3300047318 Ga0495636_0271872 Ga0495636_0271872_65_748 202
78 3300047447 Ga0495685_021291 Ga0495685_021291_598_1281 202
79 3300005445 Ga0070708_100114527 Ga0070708_1001145272 203
80 3300006844 Ga0075428_100075795 Ga0075428_1000757956 203
81 3300009094 Ga0111539_10305245 Ga0111539_103052452 203
82 3300035170 Ga0373943_0115001 Ga0373943_0115001_91_762 203
83 3300035692 Ga0373935_0105662 Ga0373935_0105662_736_1407 203
84 3300035725 Ga0373947_0055763 Ga0373947_0055763_1147_1818 203
85 3300005341 Ga0070691_10092043 Ga0070691_100920432 205
86 3300005438 Ga0070701_10018755 Ga0070701_100187553 205
87 3300005440 Ga0070705_100100434 Ga0070705_1001004342 205
88 3300005444 Ga0070694_100013000 Ga0070694_1000130002 205
89 3300005444 Ga0070694_100588851 Ga0070694_1005888511 205
90 3300005459 Ga0068867_100484826 Ga0068867_1004848262 205
91 3300005467 Ga0070706_100089513 Ga0070706_1000895133 205
92 3300005468 Ga0070707_100210554 Ga0070707_1002105542 205
93 3300005471 Ga0070698_100004723 Ga0070698_10000472314 205
94 3300005518 Ga0070699_100007386 Ga0070699_10000738610 205
95 3300005545 Ga0070695_100054187 Ga0070695_1000541874 205
96 3300005546 Ga0070696_100208946 Ga0070696_1002089461 205
97 3300005549 Ga0070704_100079079 Ga0070704_1000790793 205
98 3300005549 Ga0070704_100167341 Ga0070704_1001673412 205
99 3300006852 Ga0075433_10093714 Ga0075433_100937143 205
100 3300006871 Ga0075434_100104126 Ga0075434_1001041264 205
101 3300006871 Ga0075434_100137424 Ga0075434_1001374242 205
102 3300009147 Ga0114129_10003888 Ga0114129_1000388822 205
103 3300009148 Ga0105243_10058182 Ga0105243_100581822 205
104 3300025910 Ga0207684_10206892 Ga0207684_102068923 205
105 3300025922 Ga0207646_10544359 Ga0207646_105443592 205
106 3300046537 Ga0495598_0039601 Ga0495598_0039601_56_739 205
107 3300046615 Ga0495656_0047373 Ga0495656_0047373_788_1471 205
108 3300050508 nmdc:mga09592_133321_c1 nmdc:mga09592_133321_c1_331_1011 205
109 3300050512 nmdc:mga0n895_345259_c1 nmdc:mga0n895_345259_c1_203_886 205
110 3300050515 nmdc:mga0a205_39887_c1 nmdc:mga0a205_39887_c1_2908_3591 205
111 3300005440 Ga0070705_100000353 Ga0070705_10000035316 206
112 3300005444 Ga0070694_100001728 Ga0070694_1000017282 206
113 3300005518 Ga0070699_100009834 Ga0070699_10000983410 206
114 3300005545 Ga0070695_100000542 Ga0070695_10000054215 206
115 3300005546 Ga0070696_100052386 Ga0070696_1000523862 206
116 3300005615 Ga0070702_100027661 Ga0070702_1000276613 206
117 3300009148 Ga0105243_10060040 Ga0105243_100600404 206
118 3300025935 Ga0207709_10112218 Ga0207709_101122182 206
119 3300041999 Ga0439433_0002476 Ga0439433_0002476_349_987 206
120 3300042015 Ga0439462_0014582 Ga0439462_0014582_1122_1760 206
121 3300005289 Ga0065704_10156099 Ga0065704_101560992 207
122 3300005290 Ga0065712_10072381 Ga0065712_100723816 207
123 3300005293 Ga0065715_10021686 Ga0065715_100216862 207
124 3300005328 Ga0070676_10040201 Ga0070676_100402012 207
125 3300005330 Ga0070690_100085737 Ga0070690_1000857372 207
126 3300005331 Ga0070670_100106717 Ga0070670_1001067172 207
127 3300005340 Ga0070689_100148828 Ga0070689_1001488282 207
128 3300005343 Ga0070687_100101365 Ga0070687_1001013652 207
129 3300005345 Ga0070692_10137478 Ga0070692_101374782 207
130 3300005353 Ga0070669_100010678 Ga0070669_1000106786 207
131 3300005364 Ga0070673_100880603 Ga0070673_1008806032 207
132 3300005440 Ga0070705_100373719 Ga0070705_1003737192 207
133 3300005441 Ga0070700_100052052 Ga0070700_1000520523 207
134 3300005444 Ga0070694_100032991 Ga0070694_1000329915 207
135 3300005457 Ga0070662_100050063 Ga0070662_1000500634 207
136 3300005518 Ga0070699_100193343 Ga0070699_1001933432 207
137 3300005543 Ga0070672_100116107 Ga0070672_1001161072 207
138 3300005549 Ga0070704_100007989 Ga0070704_1000079898 207
139 3300005564 Ga0070664_100429583 Ga0070664_1004295831 207
140 3300005577 Ga0068857_100022078 Ga0068857_1000220782 207
141 3300005617 Ga0068859_100066152 Ga0068859_1000661522 207
142 3300005840 Ga0068870_10058630 Ga0068870_100586302 207
143 3300005842 Ga0068858_100214375 Ga0068858_1002143752 207
144 3300005843 Ga0068860_100210438 Ga0068860_1002104382 207
145 3300005844 Ga0068862_100153263 Ga0068862_1001532632 207
146 3300006844 Ga0075428_100438939 Ga0075428_1004389391 207
147 3300006880 Ga0075429_100085831 Ga0075429_1000858312 207
148 3300006931 Ga0097620_100066152 Ga0097620_1000661522 207
149 3300011119 Ga0105246_10265644 Ga0105246_102656442 207
150 3300013306 Ga0163162_10123467 Ga0163162_101234672 207
151 3300013308 Ga0157375_10217294 Ga0157375_102172942 207
152 3300014745 Ga0157377_10185007 Ga0157377_101850072 207
153 3300025315 Ga0207697_10025784 Ga0207697_100257843 207
154 3300025907 Ga0207645_10022218 Ga0207645_100222186 207
155 3300025908 Ga0207643_10037151 Ga0207643_100371514 207
156 3300025925 Ga0207650_10015116 Ga0207650_100151167 207
157 3300025933 Ga0207706_10097974 Ga0207706_100979743 207
158 3300025936 Ga0207670_10104809 Ga0207670_101048092 207
159 3300025940 Ga0207691_10165578 Ga0207691_101655782 207
160 3300025942 Ga0207689_10161831 Ga0207689_101618312 207
161 3300025960 Ga0207651_10092531 Ga0207651_100925313 207
162 3300025972 Ga0207668_10098648 Ga0207668_100986484 207
163 3300026035 Ga0207703_10073161 Ga0207703_100731612 207
164 3300026075 Ga0207708_10179487 Ga0207708_101794873 207
165 3300026089 Ga0207648_10006648 Ga0207648_100066484 207
166 3300026095 Ga0207676_10069080 Ga0207676_100690804 207
167 3300026095 Ga0207676_10335715 Ga0207676_103357152 207
168 3300026116 Ga0207674_10020387 Ga0207674_100203877 207
169 3300026116 Ga0207674_10041419 Ga0207674_100414194 207
170 3300027907 Ga0207428_10003385 Ga0207428_1000338512 207
171 3300028380 Ga0268265_10001193 Ga0268265_1000119321 207
172 3300028381 Ga0268264_10211693 Ga0268264_102116932 207
173 3300047318 Ga0495636_0010870 Ga0495636_0010870_1965_2645 207
174 3300048913 Ga0496110_0362287 Ga0496110_0362287_366_1040 207
175 3300048916 Ga0496113_0224547 Ga0496113_0224547_690_1364 207
176 3300049585 Ga0501069_0068325 Ga0501069_0068325_788_1453 207
177 3300005289 Ga0065704_10076773 Ga0065704_100767735 208
178 3300005295 Ga0065707_10009659 Ga0065707_100096591 208
179 3300006358 Ga0068871_100319630 Ga0068871_1003196302 208
180 3300006844 Ga0075428_100041279 Ga0075428_1000412794 208
181 3300006844 Ga0075428_100134313 Ga0075428_1001343135 208
182 3300009094 Ga0111539_10524896 Ga0111539_105248962 208
183 3300009147 Ga0114129_10001659 Ga0114129_1000165913 208
184 3300009147 Ga0114129_10088636 Ga0114129_100886361 208
185 3300025934 Ga0207686_10409100 Ga0207686_104091002 208
186 3300045051 Ga0451576_0612475 Ga0451576_0612475_219_902 208
187 3300049568 Ga0501031_0044414 Ga0501031_0044414_2055_2708 208
188 3300049570 Ga0501033_0302724 Ga0501033_0302724_154_807 208
189 3300049576 Ga0501040_0021940 Ga0501040_0021940_438_1091 208
190 3300049577 Ga0501041_0104916 Ga0501041_0104916_956_1609 208
191 3300049578 Ga0501042_0131026 Ga0501042_0131026_405_1058 208
192 3300049582 Ga0501048_0127741 Ga0501048_0127741_1015_1668 208
193 3300049583 Ga0501067_0016453 Ga0501067_0016453_513_1196 208
194 3300049585 Ga0501069_0079165 Ga0501069_0079165_1031_1714 208
195 3300049587 Ga0501071_0041216 Ga0501071_0041216_1950_2603 208
196 3300049588 Ga0501072_0074399 Ga0501072_0074399_942_1595 208
197 3300049590 Ga0501074_0367266 Ga0501074_0367266_61_714 208
198 3300049591 Ga0501075_0095487 Ga0501075_0095487_222_875 208
199 3300049592 Ga0501076_0036695 Ga0501076_0036695_1161_1814 208
200 3300049741 Ga0501079_0063662 Ga0501079_0063662_1985_2638 208
201 3300049743 Ga0501081_0114055 Ga0501081_0114055_586_1239 208
202 3300049824 Ga0501045_0054252 Ga0501045_0054252_2177_2830 208
203 3300050507 nmdc:mga05p37_2706_c1 nmdc:mga05p37_2706_c1_6927_7610 208
204 3300050507 nmdc:mga05p37_36822_c1 nmdc:mga05p37_36822_c1_1504_2187 208
205 3300050512 nmdc:mga0n895_52001_c1 nmdc:mga0n895_52001_c1_2176_2859 208
206 3300050515 nmdc:mga0a205_174537_c1 nmdc:mga0a205_174537_c1_1309_1992 208
207 3300054114 Ga0501084_0172625 Ga0501084_0172625_311_964 208
208 3300005341 Ga0070691_10027912 Ga0070691_100279122 209
209 3300005354 Ga0070675_100090971 Ga0070675_1000909714 209
210 3300005354 Ga0070675_100647047 Ga0070675_1006470472 209
211 3300005564 Ga0070664_100314227 Ga0070664_1003142272 209
212 3300005616 Ga0068852_100025408 Ga0068852_1000254083 209
213 3300005842 Ga0068858_100160693 Ga0068858_1001606934 209
214 3300006847 Ga0075431_100070379 Ga0075431_1000703796 209
215 3300009101 Ga0105247_10185044 Ga0105247_101850442 209
216 3300025893 Ga0207682_10024190 Ga0207682_100241901 209
217 3300025903 Ga0207680_10131306 Ga0207680_101313062 209
218 3300025926 Ga0207659_10245267 Ga0207659_102452672 209
219 3300025945 Ga0207679_10587913 Ga0207679_105879132 209
220 3300026035 Ga0207703_10499900 Ga0207703_104999002 209
221 3300026075 Ga0207708_10001614 Ga0207708_100016145 209
222 3300044712 Ga0453684_0225246 Ga0453684_0225246_1030_1686 209
223 3300049572 Ga0501036_0076421 Ga0501036_0076421_1121_1783 209
224 3300049577 Ga0501041_0103295 Ga0501041_0103295_152_814 209
225 3300049587 Ga0501071_0072851 Ga0501071_0072851_1300_1962 209
226 3300049588 Ga0501072_0214388 Ga0501072_0214388_787_1449 209
227 3300049591 Ga0501075_0025191 Ga0501075_0025191_742_1404 209
228 3300049592 Ga0501076_0166370 Ga0501076_0166370_1066_1728 209
229 3300049743 Ga0501081_0056415 Ga0501081_0056415_2020_2682 209
230 3300049822 Ga0501035_0383642 Ga0501035_0383642_411_1073 209
231 3300049824 Ga0501045_0035210 Ga0501045_0035210_1811_2473 209
232 3300050510 nmdc:mga06r32_303381_c1 nmdc:mga06r32_303381_c1_32_721 209
233 3300053129 Ga0500628_002853 Ga0500628_002853_2056_2748 209
234 3300054114 Ga0501084_0546872 Ga0501084_0546872_204_866 209
235 3300005467 Ga0070706_100332109 Ga0070706_1003321092 210
236 3300005617 Ga0068859_101252391 Ga0068859_1012523911 210
237 3300006931 Ga0097620_101252399 Ga0097620_1012523991 210
238 3300009177 Ga0105248_10243459 Ga0105248_102434592 210
239 3300005331 Ga0070670_100008907 Ga0070670_1000089075 211
240 3300005436 Ga0070713_100020203 Ga0070713_1000202034 211
241 3300005471 Ga0070698_100587613 Ga0070698_1005876132 211
242 3300005543 Ga0070672_100317229 Ga0070672_1003172292 211
243 3300005564 Ga0070664_100186765 Ga0070664_1001867652 211
244 3300005617 Ga0068859_100337967 Ga0068859_1003379672 211
245 3300005618 Ga0068864_100065348 Ga0068864_1000653482 211
246 3300005719 Ga0068861_100170577 Ga0068861_1001705772 211
247 3300005844 Ga0068862_100008919 Ga0068862_1000089199 211
248 3300006931 Ga0097620_100337991 Ga0097620_1003379912 211
249 3300014325 Ga0163163_10039080 Ga0163163_100390806 211
250 3300014325 Ga0163163_10427095 Ga0163163_104270952 211
251 3300025928 Ga0207700_10003078 Ga0207700_100030789 211
252 3300025940 Ga0207691_10286009 Ga0207691_102860092 211
253 3300025945 Ga0207679_10191853 Ga0207679_101918532 211
254 3300026095 Ga0207676_10453804 Ga0207676_104538042 211
255 3300026118 Ga0207675_100177617 Ga0207675_1001776173 211
256 3300031548 Ga0307408_100098852 Ga0307408_1000988523 211
257 3300031903 Ga0307407_10312789 Ga0307407_103127891 211
258 3300031911 Ga0307412_10100362 Ga0307412_101003622 211
259 3300032005 Ga0307411_10055021 Ga0307411_100550212 211
260 3300032126 Ga0307415_100031272 Ga0307415_1000312723 211
261 3300048912 Ga0496109_0607778 Ga0496109_0607778_58_747 211
262 3300049572 Ga0501036_0268679 Ga0501036_0268679_550_1203 211
263 3300049587 Ga0501071_0155842 Ga0501071_0155842_652_1305 211
264 3300049588 Ga0501072_0036484 Ga0501072_0036484_2597_3250 211
265 3300049590 Ga0501074_0055568 Ga0501074_0055568_2072_2725 211
266 3300049591 Ga0501075_0134275 Ga0501075_0134275_438_1091 211
267 3300049741 Ga0501079_0009615 Ga0501079_0009615_2920_3573 211
268 3300049742 Ga0501080_0041313 Ga0501080_0041313_2546_3199 211
269 3300049743 Ga0501081_0027452 Ga0501081_0027452_1186_1839 211
270 3300060353 Ga0501082_0349904 Ga0501082_0349904_55_708 211
271 3300061734 Ga0530510_0183500 Ga0530510_0183500_782_1513 211
272 3300005293 Ga0065715_10007113 Ga0065715_100071132 212
273 3300005295 Ga0065707_10000834 Ga0065707_100008346 212
274 3300005364 Ga0070673_100188476 Ga0070673_1001884762 212
275 3300006852 Ga0075433_10063822 Ga0075433_100638222 212
276 3300009147 Ga0114129_10624963 Ga0114129_106249632 212
277 3300009177 Ga0105248_10162416 Ga0105248_101624162 212
278 3300009553 Ga0105249_10113728 Ga0105249_101137282 212
279 3300014326 Ga0157380_10045868 Ga0157380_100458682 212
280 3300031911 Ga0307412_10089590 Ga0307412_100895903 212
281 3300032002 Ga0307416_100354114 Ga0307416_1003541143 212
282 3300035083 Ga0373926_0008201 Ga0373926_0008201_2265_2927 212
283 3300035692 Ga0373935_0097227 Ga0373935_0097227_980_1642 212
284 3300037068 Ga0373925_0098098 Ga0373925_0098098_601_1263 212
285 3300041406 Ga0439439_0015945 Ga0439439_0015945_1007_1669 212
286 3300041997 Ga0439431_0021554 Ga0439431_0021554_805_1467 212
287 3300041999 Ga0439433_0035924 Ga0439433_0035924_119_781 212
288 3300042156 Ga0439446_0010643 Ga0439446_0010643_45_707 212
289 3300049578 Ga0501042_0243300 Ga0501042_0243300_603_1271 212
290 3300049741 Ga0501079_0323813 Ga0501079_0323813_388_1056 212
291 3300050512 nmdc:mga0n895_876676_c1 nmdc:mga0n895_876676_c1_57_761 212
292 3300005364 Ga0070673_100080865 Ga0070673_1000808651 213
293 3300009147 Ga0114129_10136172 Ga0114129_101361723 213
294 3300025960 Ga0207651_10981248 Ga0207651_109812481 213
295 3300032002 Ga0307416_101342117 Ga0307416_1013421171 213
296 3300035119 Ga0373956_0258449 Ga0373956_0258449_94_783 213
297 3300041410 Ga0439461_0037172 Ga0439461_0037172_41_733 213
298 3300047319 Ga0495674_0219955 Ga0495674_0219955_208_897 213
299 3300049585 Ga0501069_0407432 Ga0501069_0407432_36_719 213
300 3300050507 nmdc:mga05p37_46502_c1 nmdc:mga05p37_46502_c1_561_1244 213
301 3300053727 Ga0500611_009352 Ga0500611_009352_372_1043 213
302 3300059421 Ga0590071_004343 Ga0590071_004343_1021_1719 213
303 3300059426 Ga0590077_003048 Ga0590077_003048_1176_1865 213
304 3300060353 Ga0501082_0296378 Ga0501082_0296378_623_1351 213
305 3300005293 Ga0065715_10170128 Ga0065715_101701282 214
306 3300005329 Ga0070683_100061153 Ga0070683_1000611535 214
307 3300005354 Ga0070675_100060238 Ga0070675_1000602383 214
308 3300005355 Ga0070671_100008320 Ga0070671_1000083202 214
309 3300005365 Ga0070688_100021315 Ga0070688_1000213155 214
310 3300005367 Ga0070667_100504587 Ga0070667_1005045872 214
311 3300005406 Ga0070703_10038597 Ga0070703_100385972 214
312 3300005445 Ga0070708_100086957 Ga0070708_1000869572 214
313 3300005468 Ga0070707_100128713 Ga0070707_1001287132 214
314 3300005535 Ga0070684_100185501 Ga0070684_1001855011 214
315 3300005536 Ga0070697_100349017 Ga0070697_1003490172 214
316 3300005543 Ga0070672_100072649 Ga0070672_1000726493 214
317 3300005545 Ga0070695_100067396 Ga0070695_1000673963 214
318 3300005564 Ga0070664_100032472 Ga0070664_1000324722 214
319 3300005577 Ga0068857_100537833 Ga0068857_1005378332 214
320 3300005617 Ga0068859_100017025 Ga0068859_1000170253 214
321 3300005618 Ga0068864_100077251 Ga0068864_1000772512 214
322 3300005841 Ga0068863_100064191 Ga0068863_1000641915 214
323 3300005842 Ga0068858_100102307 Ga0068858_1001023074 214
324 3300005843 Ga0068860_100005299 Ga0068860_1000052998 214
325 3300006042 Ga0075368_10035739 Ga0075368_100357393 214
326 3300006048 Ga0075363_100011958 Ga0075363_1000119585 214
327 3300006051 Ga0075364_10004582 Ga0075364_100045828 214
328 3300006051 Ga0075364_10005737 Ga0075364_100057375 214
329 3300006177 Ga0075362_10000489 Ga0075362_1000048910 214
330 3300006178 Ga0075367_10004668 Ga0075367_100046685 214
331 3300006195 Ga0075366_10012749 Ga0075366_100127492 214
332 3300006195 Ga0075366_10316982 Ga0075366_103169822 214
333 3300006844 Ga0075428_100357830 Ga0075428_1003578302 214
334 3300006852 Ga0075433_10005701 Ga0075433_100057019 214
335 3300006871 Ga0075434_100002362 Ga0075434_10000236211 214
336 3300006871 Ga0075434_100071599 Ga0075434_1000715993 214
337 3300006871 Ga0075434_100379257 Ga0075434_1003792572 214
338 3300006931 Ga0097620_100017024 Ga0097620_1000170243 214
339 3300009147 Ga0114129_10016501 Ga0114129_100165018 214
340 3300009147 Ga0114129_10042294 Ga0114129_100422948 214
341 3300009147 Ga0114129_10175158 Ga0114129_101751582 214
342 3300013296 Ga0157374_10203209 Ga0157374_102032092 214
343 3300013308 Ga0157375_10327160 Ga0157375_103271602 214
344 3300013308 Ga0157375_10362523 Ga0157375_103625233 214
345 3300014745 Ga0157377_10113955 Ga0157377_101139552 214
346 3300025918 Ga0207662_10047418 Ga0207662_100474184 214
347 3300025922 Ga0207646_10111714 Ga0207646_101117142 214
348 3300025922 Ga0207646_10548415 Ga0207646_105484152 214
349 3300025926 Ga0207659_10001465 Ga0207659_100014659 214
350 3300025926 Ga0207659_10112199 Ga0207659_101121994 214
351 3300025931 Ga0207644_10081315 Ga0207644_100813154 214
352 3300025940 Ga0207691_10312122 Ga0207691_103121222 214
353 3300025941 Ga0207711_10127745 Ga0207711_101277451 214
354 3300025944 Ga0207661_10019055 Ga0207661_100190554 214
355 3300025945 Ga0207679_10228111 Ga0207679_102281112 214
356 3300025945 Ga0207679_10468762 Ga0207679_104687622 214
357 3300025960 Ga0207651_10666177 Ga0207651_106661772 214
358 3300025986 Ga0207658_10061167 Ga0207658_100611673 214
359 3300025986 Ga0207658_10638681 Ga0207658_106386812 214
360 3300026035 Ga0207703_10081417 Ga0207703_100814174 214
361 3300026075 Ga0207708_10091600 Ga0207708_100916004 214
362 3300026088 Ga0207641_10196513 Ga0207641_101965132 214
363 3300026088 Ga0207641_10261749 Ga0207641_102617492 214
364 3300026095 Ga0207676_10445870 Ga0207676_104458702 214
365 3300026116 Ga0207674_10256462 Ga0207674_102564622 214
366 3300026121 Ga0207683_10614497 Ga0207683_106144972 214
367 3300027866 Ga0209813_10045523 Ga0209813_100455231 214
368 3300028381 Ga0268264_10007214 Ga0268264_100072148 214
369 3300031995 Ga0307409_100107264 Ga0307409_1001072642 214
370 3300036401 Ga0373937_0619256 Ga0373937_0619256_153_821 214
371 3300042876 Ga0451577_0514545 Ga0451577_0514545_180_863 214
372 3300045051 Ga0451576_0012634 Ga0451576_0012634_8366_9049 214
373 3300045051 Ga0451576_0083199 Ga0451576_0083199_1544_2227 214
374 3300046528 Ga0495642_0119794 Ga0495642_0119794_180_863 214
375 3300046539 Ga0495621_0067629 Ga0495621_0067629_297_980 214
376 3300046664 Ga0495659_0012673 Ga0495659_0012673_1688_2371 214
377 3300048907 Ga0496104_0331563 Ga0496104_0331563_642_1310 214
378 3300048908 Ga0496105_0385158 Ga0496105_0385158_108_776 214
379 3300050489 nmdc:mga03683_3561_c1 nmdc:mga03683_3561_c1_1117_1830 214
380 3300050490 nmdc:mga03n38_17500_c1 nmdc:mga03n38_17500_c1_718_1431 214
381 3300050491 nmdc:mga00v17_28425_c1 nmdc:mga00v17_28425_c1_2170_2883 214
382 3300050491 nmdc:mga00v17_3738_c2 nmdc:mga00v17_3738_c2_1940_2653 214
383 3300050492 nmdc:mga0yw44_58199_c1 nmdc:mga0yw44_58199_c1_598_1311 214
384 3300050493 nmdc:mga0k408_168526_c1 nmdc:mga0k408_168526_c1_537_1226 214
385 3300050493 nmdc:mga0k408_7377_c1 nmdc:mga0k408_7377_c1_4189_4902 214
386 3300050493 nmdc:mga0k408_8269_c1 nmdc:mga0k408_8269_c1_550_1263 214
387 3300050494 nmdc:mga06z11_54799_c1 nmdc:mga06z11_54799_c1_597_1310 214
388 3300050495 nmdc:mga04h51_29463_c1 nmdc:mga04h51_29463_c1_352_1065 214
389 3300050495 nmdc:mga04h51_84404_c1 nmdc:mga04h51_84404_c1_223_936 214
390 3300050507 nmdc:mga05p37_10687_c1 nmdc:mga05p37_10687_c1_5647_6327 214
391 3300050507 nmdc:mga05p37_133190_c1 nmdc:mga05p37_133190_c1_1206_1889 214
392 3300050507 nmdc:mga05p37_133663_c1 nmdc:mga05p37_133663_c1_1188_1904 214
393 3300050508 nmdc:mga09592_242321_c1 nmdc:mga09592_242321_c1_638_1354 214
394 3300050509 nmdc:mga0qj67_303671_c1 nmdc:mga0qj67_303671_c1_490_1170 214
395 3300050509 nmdc:mga0qj67_442619_c1 nmdc:mga0qj67_442619_c1_123_794 214
396 3300050512 nmdc:mga0n895_42495_c1 nmdc:mga0n895_42495_c1_2452_3135 214
397 3300050513 nmdc:mga0rr50_154058_c1 nmdc:mga0rr50_154058_c1_46_729 214
398 3300050513 nmdc:mga0rr50_97954_c1 nmdc:mga0rr50_97954_c1_140_823 214
399 3300050515 nmdc:mga0a205_207632_c1 nmdc:mga0a205_207632_c1_626_1309 214
400 3300005328 Ga0070676_10031080 Ga0070676_100310802 215
401 3300005331 Ga0070670_100048171 Ga0070670_1000481714 215
402 3300005337 Ga0070682_100497450 Ga0070682_1004974502 215
403 3300005338 Ga0068868_100123488 Ga0068868_1001234883 215
404 3300005354 Ga0070675_100748951 Ga0070675_1007489511 215
405 3300005367 Ga0070667_100071791 Ga0070667_1000717913 215
406 3300005444 Ga0070694_100541154 Ga0070694_1005411541 215
407 3300005457 Ga0070662_100102819 Ga0070662_1001028193 215
408 3300005535 Ga0070684_100231299 Ga0070684_1002312993 215
409 3300005548 Ga0070665_100136824 Ga0070665_1001368244 215
410 3300005841 Ga0068863_100350914 Ga0068863_1003509142 215
411 3300005843 Ga0068860_100267790 Ga0068860_1002677903 215
412 3300006237 Ga0097621_100098805 Ga0097621_1000988052 215
413 3300006847 Ga0075431_100272389 Ga0075431_1002723892 215
414 3300009093 Ga0105240_10552325 Ga0105240_105523252 215
415 3300009174 Ga0105241_10054310 Ga0105241_100543103 215
416 3300009177 Ga0105248_10455003 Ga0105248_104550033 215
417 3300009553 Ga0105249_10083147 Ga0105249_100831474 215
418 3300013296 Ga0157374_10059231 Ga0157374_100592313 215
419 3300013306 Ga0163162_10740975 Ga0163162_107409751 215
420 3300013308 Ga0157375_10215124 Ga0157375_102151241 215
421 3300014969 Ga0157376_10060414 Ga0157376_100604144 215
422 3300017792 Ga0163161_10011304 Ga0163161_100113047 215
423 3300021384 Ga0213876_10178340 Ga0213876_101783402 215
424 3300025893 Ga0207682_10085036 Ga0207682_100850361 215
425 3300025899 Ga0207642_10014612 Ga0207642_100146123 215
426 3300025907 Ga0207645_10047629 Ga0207645_100476292 215
427 3300025913 Ga0207695_10451286 Ga0207695_104512861 215
428 3300025925 Ga0207650_10052334 Ga0207650_100523342 215
429 3300025925 Ga0207650_10712219 Ga0207650_107122192 215
430 3300025937 Ga0207669_10079899 Ga0207669_100798993 215
431 3300025938 Ga0207704_10216504 Ga0207704_102165041 215
432 3300025940 Ga0207691_10368910 Ga0207691_103689102 215
433 3300025941 Ga0207711_10258098 Ga0207711_102580982 215
434 3300025986 Ga0207658_10277894 Ga0207658_102778943 215
435 3300026023 Ga0207677_10267757 Ga0207677_102677572 215
436 3300026089 Ga0207648_10357299 Ga0207648_103572992 215
437 3300026121 Ga0207683_10173179 Ga0207683_101731793 215
438 3300026142 Ga0207698_10957252 Ga0207698_109572521 215
439 3300028379 Ga0268266_10022055 Ga0268266_100220553 215
440 3300028381 Ga0268264_10766612 Ga0268264_107666121 215
441 3300031548 Ga0307408_100166711 Ga0307408_1001667111 215
442 3300032002 Ga0307416_100253705 Ga0307416_1002537052 215
443 3300032002 Ga0307416_101266020 Ga0307416_1012660201 215
444 3300032126 Ga0307415_100379989 Ga0307415_1003799892 215
445 3300035172 Ga0373955_0018405 Ga0373955_0018405_2684_3403 215
446 3300037068 Ga0373925_0524712 Ga0373925_0524712_150_869 215
447 3300039437 Ga0436365_0372794 Ga0436365_0372794_213_884 215
448 3300041999 Ga0439433_0005225 Ga0439433_0005225_517_1221 215
449 3300042007 Ga0439449_0053609 Ga0439449_0053609_262_966 215
450 3300042156 Ga0439446_0012217 Ga0439446_0012217_1015_1719 215
451 3300042435 Ga0439434_0055597 Ga0439434_0055597_93_797 215
452 3300046459 Ga0495629_0010127 Ga0495629_0010127_976_1668 215
453 3300046499 Ga0495594_0020424 Ga0495594_0020424_1454_2146 215
454 3300046809 Ga0495600_0106179 Ga0495600_0106179_640_1359 215
455 3300047321 Ga0495676_0062131 Ga0495676_0062131_446_1138 215
456 3300047471 Ga0495684_0315783 Ga0495684_0315783_333_1052 215
457 3300048903 Ga0496100_0037095 Ga0496100_0037095_265_984 215
458 3300048907 Ga0496104_0016740 Ga0496104_0016740_4948_5667 215
459 3300048907 Ga0496104_0781236 Ga0496104_0781236_105_824 215
460 3300048908 Ga0496105_0062768 Ga0496105_0062768_2012_2731 215
461 3300048910 Ga0496107_0112817 Ga0496107_0112817_230_949 215
462 3300048911 Ga0496108_0017856 Ga0496108_0017856_3641_4360 215
463 3300048917 Ga0496114_0001396 Ga0496114_0001396_1088_1807 215
464 3300049572 Ga0501036_0042355 Ga0501036_0042355_398_1108 215
465 3300049574 Ga0501038_0095757 Ga0501038_0095757_1214_1924 215
466 3300049575 Ga0501039_0086708 Ga0501039_0086708_1187_1897 215
467 3300049578 Ga0501042_0015915 Ga0501042_0015915_1995_2705 215
468 3300049579 Ga0501043_0365133 Ga0501043_0365133_274_984 215
469 3300049580 Ga0501046_0087843 Ga0501046_0087843_939_1649 215
470 3300049582 Ga0501048_0034807 Ga0501048_0034807_17_727 215
471 3300049587 Ga0501071_0252052 Ga0501071_0252052_516_1226 215
472 3300049588 Ga0501072_0009895 Ga0501072_0009895_4111_4821 215
473 3300049591 Ga0501075_0001534 Ga0501075_0001534_7133_7843 215
474 3300049592 Ga0501076_0113450 Ga0501076_0113450_1412_2122 215
475 3300049593 Ga0501077_0125764 Ga0501077_0125764_411_1121 215
476 3300049741 Ga0501079_0045180 Ga0501079_0045180_1578_2288 215
477 3300049742 Ga0501080_0197373 Ga0501080_0197373_1013_1723 215
478 3300049824 Ga0501045_0180592 Ga0501045_0180592_200_910 215
479 3300053077 Ga0495601_0016468 Ga0495601_0016468_309_1028 215
480 3300053085 Ga0495619_0051407 Ga0495619_0051407_917_1636 215
481 3300054114 Ga0501084_0301493 Ga0501084_0301493_582_1292 215
482 3300059421 Ga0590071_000282 Ga0590071_000282_11553_12224 215
483 3300059423 Ga0590074_007341 Ga0590074_007341_633_1304 215
484 3300059426 Ga0590077_000238 Ga0590077_000238_7192_7863 215
485 3300061734 Ga0530510_0001988 Ga0530510_0001988_7649_8359 215
486 3300005333 Ga0070677_10055162 Ga0070677_100551622 216
487 3300005339 Ga0070660_100115994 Ga0070660_1001159942 216
488 3300005344 Ga0070661_100176475 Ga0070661_1001764752 216
489 3300005353 Ga0070669_100236358 Ga0070669_1002363582 216
490 3300005356 Ga0070674_100038383 Ga0070674_1000383835 216
491 3300005366 Ga0070659_100443326 Ga0070659_1004433262 216
492 3300005563 Ga0068855_100058478 Ga0068855_1000584785 216
493 3300005564 Ga0070664_100221792 Ga0070664_1002217922 216
494 3300005616 Ga0068852_100098602 Ga0068852_1000986021 216
495 3300006844 Ga0075428_100038342 Ga0075428_1000383427 216
496 3300006844 Ga0075428_100331368 Ga0075428_1003313683 216
497 3300006846 Ga0075430_100008531 Ga0075430_1000085318 216
498 3300006846 Ga0075430_100231481 Ga0075430_1002314811 216
499 3300006847 Ga0075431_100231316 Ga0075431_1002313162 216
500 3300006880 Ga0075429_100032450 Ga0075429_1000324504 216
501 3300009093 Ga0105240_10213803 Ga0105240_102138032 216
502 3300009147 Ga0114129_10007226 Ga0114129_1000722611 216
503 3300013105 Ga0157369_10084492 Ga0157369_100844925 216
504 3300013307 Ga0157372_10151914 Ga0157372_101519144 216
505 3300025920 Ga0207649_10135714 Ga0207649_101357142 216
506 3300025937 Ga0207669_10040227 Ga0207669_100402273 216
507 3300025944 Ga0207661_10226598 Ga0207661_102265982 216
508 3300025945 Ga0207679_10158951 Ga0207679_101589512 216
509 3300025949 Ga0207667_10106183 Ga0207667_101061832 216
510 3300026142 Ga0207698_10119787 Ga0207698_101197873 216
511 3300037418 Ga0395900_0543035 Ga0395900_0543035_177_887 216
512 3300037471 Ga0395905_0626219 Ga0395905_0626219_164_862 216
513 3300042435 Ga0439434_0055486 Ga0439434_0055486_25_705 216
514 3300045976 Ga0466967_0200247 Ga0466967_0200247_43_741 216
515 3300049571 Ga0501034_0113457 Ga0501034_0113457_510_1208 216
516 3300049593 Ga0501077_0075813 Ga0501077_0075813_838_1527 216
517 3300049744 Ga0501083_0133136 Ga0501083_0133136_731_1429 216
518 3300050507 nmdc:mga05p37_10546_c1 nmdc:mga05p37_10546_c1_9511_10188 216
519 3300050508 nmdc:mga09592_55254_c1 nmdc:mga09592_55254_c1_787_1464 216
520 3300050509 nmdc:mga0qj67_655915_c1 nmdc:mga0qj67_655915_c1_93_785 216
521 3300050510 nmdc:mga06r32_109267_c1 nmdc:mga06r32_109267_c1_621_1301 216
522 3300050510 nmdc:mga06r32_877273_c1 nmdc:mga06r32_877273_c1_149_826 216
523 3300005290 Ga0065712_10068599 Ga0065712_100685999 217
524 3300005329 Ga0070683_100000326 Ga0070683_10000032613 217
525 3300005331 Ga0070670_100025013 Ga0070670_1000250136 217
526 3300005344 Ga0070661_100022313 Ga0070661_1000223136 217
527 3300005354 Ga0070675_100413278 Ga0070675_1004132781 217
528 3300005355 Ga0070671_100006550 Ga0070671_1000065508 217
529 3300005367 Ga0070667_100113453 Ga0070667_1001134532 217
530 3300005455 Ga0070663_100009370 Ga0070663_1000093709 217
531 3300005457 Ga0070662_100151431 Ga0070662_1001514312 217
532 3300005466 Ga0070685_10358124 Ga0070685_103581242 217
533 3300005535 Ga0070684_100000168 Ga0070684_10000016825 217
534 3300005564 Ga0070664_100001248 Ga0070664_1000012485 217
535 3300005844 Ga0068862_100532011 Ga0068862_1005320112 217
536 3300006852 Ga0075433_10339416 Ga0075433_103394162 217
537 3300009094 Ga0111539_10481753 Ga0111539_104817532 217
538 3300009177 Ga0105248_10116361 Ga0105248_101163612 217
539 3300013296 Ga0157374_10227404 Ga0157374_102274043 217
540 3300014325 Ga0163163_10028350 Ga0163163_100283502 217
541 3300014968 Ga0157379_10322929 Ga0157379_103229292 217
542 3300025920 Ga0207649_10154268 Ga0207649_101542682 217
543 3300025925 Ga0207650_10053839 Ga0207650_100538394 217
544 3300025933 Ga0207706_10077823 Ga0207706_100778234 217
545 3300025941 Ga0207711_10262024 Ga0207711_102620243 217
546 3300025944 Ga0207661_10004405 Ga0207661_100044055 217
547 3300025945 Ga0207679_10005466 Ga0207679_1000546610 217
548 3300025986 Ga0207658_10172252 Ga0207658_101722522 217
549 3300026067 Ga0207678_10198326 Ga0207678_101983262 217
550 3300027552 Ga0209982_1005767 Ga0209982_10057672 217
551 3300031548 Ga0307408_100147281 Ga0307408_1001472812 217
552 3300032002 Ga0307416_100167528 Ga0307416_1001675282 217
553 3300042437 Ga0439444_0015903 Ga0439444_0015903_222_953 217
554 3300042439 Ga0439464_0080509 Ga0439464_0080509_199_930 217
555 3300042993 Ga0439440_0030529 Ga0439440_0030529_367_1044 217
556 3300048907 Ga0496104_0001797 Ga0496104_0001797_2131_2838 217
557 3300048908 Ga0496105_0119830 Ga0496105_0119830_440_1147 217
558 3300048911 Ga0496108_0004028 Ga0496108_0004028_3650_4357 217
559 3300048912 Ga0496109_0001846 Ga0496109_0001846_7722_8429 217
560 3300048913 Ga0496110_0339458 Ga0496110_0339458_501_1208 217
561 3300048914 Ga0496111_0019021 Ga0496111_0019021_854_1561 217
562 3300048915 Ga0496112_0012297 Ga0496112_0012297_1710_2417 217
563 3300048916 Ga0496113_0207885 Ga0496113_0207885_497_1204 217
564 3300049568 Ga0501031_0156411 Ga0501031_0156411_259_945 217
565 3300049572 Ga0501036_0061654 Ga0501036_0061654_45_731 217
566 3300049587 Ga0501071_0004355 Ga0501071_0004355_4799_5503 217
567 3300049588 Ga0501072_0093286 Ga0501072_0093286_1327_2007 217
568 3300049590 Ga0501074_0213864 Ga0501074_0213864_175_855 217
569 3300049591 Ga0501075_0024470 Ga0501075_0024470_1053_1733 217
570 3300049743 Ga0501081_0051693 Ga0501081_0051693_1727_2407 217
571 3300050510 nmdc:mga06r32_479225_c1 nmdc:mga06r32_479225_c1_407_1090 217
572 3300050515 nmdc:mga0a205_107877_c1 nmdc:mga0a205_107877_c1_321_1016 217
573 3300050515 nmdc:mga0a205_327463_c1 nmdc:mga0a205_327463_c1_240_935 217
574 3300005329 Ga0070683_100002445 Ga0070683_10000244511 218
575 3300005535 Ga0070684_100129898 Ga0070684_1001298982 218
576 3300005564 Ga0070664_100363153 Ga0070664_1003631532 218
577 3300005844 Ga0068862_100576982 Ga0068862_1005769822 218
578 3300006042 Ga0075368_10025260 Ga0075368_100252603 218
579 3300006195 Ga0075366_10126822 Ga0075366_101268222 218
580 3300006847 Ga0075431_100008733 Ga0075431_1000087336 218
581 3300009147 Ga0114129_10011087 Ga0114129_100110879 218
582 3300025944 Ga0207661_10001481 Ga0207661_100014818 218
583 3300042436 Ga0439435_0065639 Ga0439435_0065639_75_779 218
584 3300048903 Ga0496100_0079241 Ga0496100_0079241_652_1356 218
585 3300048904 Ga0496101_0058339 Ga0496101_0058339_1343_2047 218
586 3300048912 Ga0496109_0287186 Ga0496109_0287186_61_765 218
587 3300049572 Ga0501036_0086664 Ga0501036_0086664_1464_2168 218
588 3300049575 Ga0501039_0061114 Ga0501039_0061114_1695_2399 218
589 3300049575 Ga0501039_0262851 Ga0501039_0262851_513_1217 218
590 3300049576 Ga0501040_0066727 Ga0501040_0066727_1659_2363 218
591 3300049577 Ga0501041_0046095 Ga0501041_0046095_82_786 218
592 3300049577 Ga0501041_0264681 Ga0501041_0264681_345_1049 218
593 3300049578 Ga0501042_0252830 Ga0501042_0252830_221_925 218
594 3300049580 Ga0501046_0303974 Ga0501046_0303974_11_715 218
595 3300049582 Ga0501048_0042593 Ga0501048_0042593_2302_3006 218
596 3300049587 Ga0501071_0210629 Ga0501071_0210629_598_1302 218
597 3300049588 Ga0501072_0057194 Ga0501072_0057194_50_754 218
598 3300049588 Ga0501072_0135272 Ga0501072_0135272_302_1006 218
599 3300049589 Ga0501073_0095153 Ga0501073_0095153_1144_1851 218
600 3300049591 Ga0501075_0098892 Ga0501075_0098892_1266_1970 218
601 3300049591 Ga0501075_0194268 Ga0501075_0194268_758_1501 218
602 3300049591 Ga0501075_0411045 Ga0501075_0411045_81_764 218
603 3300049591 Ga0501075_0425911 Ga0501075_0425911_35_742 218
604 3300049592 Ga0501076_0044318 Ga0501076_0044318_1955_2659 218
605 3300049592 Ga0501076_0099060 Ga0501076_0099060_1289_1993 218
606 3300049593 Ga0501077_0056570 Ga0501077_0056570_1026_1727 218
607 3300049593 Ga0501077_0177884 Ga0501077_0177884_287_994 218
608 3300049741 Ga0501079_0061582 Ga0501079_0061582_40_744 218
609 3300049743 Ga0501081_0199976 Ga0501081_0199976_308_1021 218
610 3300049822 Ga0501035_0161684 Ga0501035_0161684_1194_1898 218
611 3300049824 Ga0501045_0147967 Ga0501045_0147967_814_1518 218
612 3300049824 Ga0501045_0632996 Ga0501045_0632996_30_731 218
613 3300050493 nmdc:mga0k408_117395_c1 nmdc:mga0k408_117395_c1_419_1117 218
614 3300050495 nmdc:mga04h51_15230_c1 nmdc:mga04h51_15230_c1_457_1155 218
615 3300050507 nmdc:mga05p37_93925_c1 nmdc:mga05p37_93925_c1_1600_2301 218
616 3300054114 Ga0501084_0209160 Ga0501084_0209160_862_1566 218
617 3300054114 Ga0501084_0823297 Ga0501084_0823297_61_762 218
618 3300060353 Ga0501082_0020583 Ga0501082_0020583_4866_5570 218
619 3300060353 Ga0501082_0076373 Ga0501082_0076373_1247_1954 218
620 3300060353 Ga0501082_0302428 Ga0501082_0302428_168_872 218
621 3300005293 Ga0065715_10277478 Ga0065715_102774781 219
622 3300005356 Ga0070674_100076131 Ga0070674_1000761311 219
623 3300005456 Ga0070678_100129312 Ga0070678_1001293122 219
624 3300006237 Ga0097621_100410810 Ga0097621_1004108102 219
625 3300014326 Ga0157380_10178911 Ga0157380_101789112 219
626 3300025937 Ga0207669_10254247 Ga0207669_102542472 219
627 3300026121 Ga0207683_10121950 Ga0207683_101219502 219
628 3300031731 Ga0307405_10396988 Ga0307405_103969882 219
629 3300031824 Ga0307413_10047599 Ga0307413_100475993 219
630 3300031852 Ga0307410_10134643 Ga0307410_101346432 219
631 3300031903 Ga0307407_10075768 Ga0307407_100757681 219
632 3300032002 Ga0307416_100047586 Ga0307416_1000475863 219
633 3300041408 Ga0439453_0022440 Ga0439453_0022440_60_794 219
634 3300042122 Ga0450920_009630 Ga0450920_009630_841_1575 219
635 3300042125 Ga0450923_004427 Ga0450923_004427_646_1380 219
636 3300042135 Ga0450899_010690 Ga0450899_010690_148_882 219
637 3300042531 Ga0450918_003731 Ga0450918_003731_1043_1777 219
638 3300059424 Ga0590075_006983 Ga0590075_006983_790_1518 219
639 3300032005 Ga0307411_10182057 Ga0307411_101820572 220
640 3300050512 nmdc:mga0n895_63479_c1 nmdc:mga0n895_63479_c1_1461_2174 221
641 2162886012 MBSR1b_contig_822942 MBSR1b_0948.00003350 227
642 3300005456 Ga0070678_100652120 Ga0070678_1006521201 227
643 3300005457 Ga0070662_100232970 Ga0070662_1002329702 227
644 3300006844 Ga0075428_100017106 Ga0075428_1000171066 227
645 3300006844 Ga0075428_100112653 Ga0075428_1001126533 227
646 3300006846 Ga0075430_100012219 Ga0075430_1000122196 227
647 3300006847 Ga0075431_100004362 Ga0075431_1000043626 227
648 3300006847 Ga0075431_100019271 Ga0075431_1000192714 227
649 3300006880 Ga0075429_100004407 Ga0075429_1000044076 227
650 3300009094 Ga0111539_10023936 Ga0111539_100239366 227
651 3300009094 Ga0111539_10071906 Ga0111539_100719064 227
652 3300009094 Ga0111539_10669522 Ga0111539_106695221 227
653 3300009147 Ga0114129_10000288 Ga0114129_100002886 227
654 3300009147 Ga0114129_10041543 Ga0114129_100415436 227
655 3300025315 Ga0207697_10046210 Ga0207697_100462102 227
656 3300025933 Ga0207706_10136039 Ga0207706_101360392 227
657 3300027907 Ga0207428_10001421 Ga0207428_1000142111 227
658 3300031548 Ga0307408_100012418 Ga0307408_1000124186 227
659 3300031548 Ga0307408_100077537 Ga0307408_1000775373 227
660 3300031548 Ga0307408_100152577 Ga0307408_1001525772 227
661 3300031731 Ga0307405_10035559 Ga0307405_100355593 227
662 3300031852 Ga0307410_10270470 Ga0307410_102704702 227
663 3300031901 Ga0307406_10093469 Ga0307406_100934693 227
664 3300031911 Ga0307412_10115053 Ga0307412_101150532 227
665 3300031995 Ga0307409_100354227 Ga0307409_1003542271 227
666 3300032002 Ga0307416_100005976 Ga0307416_1000059766 227
667 3300032002 Ga0307416_100045600 Ga0307416_1000456002 227
668 3300032005 Ga0307411_10067051 Ga0307411_100670512 227
669 3300032005 Ga0307411_10227502 Ga0307411_102275022 227
670 3300032005 Ga0307411_10476153 Ga0307411_104761531 227
671 3300042008 Ga0439450_000213 Ga0439450_000213_1913_2596 227
672 3300042461 Ga0439460_0085975 Ga0439460_0085975_88_771 227
673 3300050507 nmdc:mga05p37_89795_c1 nmdc:mga05p37_89795_c1_2079_2762 227
674 3300050509 nmdc:mga0qj67_1191_c1 nmdc:mga0qj67_1191_c1_230_913 227
675 3300050509 nmdc:mga0qj67_69070_c1 nmdc:mga0qj67_69070_c1_38_721 227
676 3300050510 nmdc:mga06r32_19697_c1 nmdc:mga06r32_19697_c1_2996_3679 227
677 3300050510 nmdc:mga06r32_21085_c1 nmdc:mga06r32_21085_c1_2152_2835 227
678 3300050511 nmdc:mga08y16_12185_c1 nmdc:mga08y16_12185_c1_5607_6290 227
679 3300050511 nmdc:mga08y16_484813_c1 nmdc:mga08y16_484813_c1_174_857 227
680 3300050511 nmdc:mga08y16_58651_c1 nmdc:mga08y16_58651_c1_1302_1985 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

11

192

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e27-assembly2.cif.gz_D nicotinic acid mononucleotide (namn) adenylyltransferase from bacillus anthracis: product complex 0.9235 9 217
2qtr-assembly1.cif.gz_A crystal structure of nicotinate mononucleotide adenylyltransferase 0.9187 9 219
1kaq-assembly3.cif.gz_E structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase 0.917 9 217
3e27-assembly2.cif.gz_D nicotinic acid mononucleotide (namn) adenylyltransferase from bacillus anthracis: product complex 0.9093 9 217
1kaq-assembly1.cif.gz_D structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase 0.9086 9 217
ID Description Score Start End Superfamily
2h2aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9027 8 217 3.40.50.620
5virA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8867 9 217 3.40.50.620
2h2aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8844 8 217 3.40.50.620
1k4kB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8689 9 217 3.40.50.620
5virA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8684 9 217 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A521T6F1-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9725 10 219 GO:0004515
GO:0005524
GO:0009435
AF-A0A2E7BLV7-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9687 6 217 GO:0004515
GO:0005524
GO:0009435
AF-A0A432HU36-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9639 8 221 GO:0004515
GO:0005524
GO:0009435
AF-A0A2E5LAG4-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9582 9 219 GO:0004515
GO:0005524
GO:0009435
AF-A0A2E4W6X0-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.958 9 217 GO:0004515
GO:0005524
GO:0009435

Feature Viewer

pLDDT pTM Quality
91.4 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map